BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029L18

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601118.1|  PREDICTED: zinc finger CCCH domain-containin...    260   1e-79   Nicotiana tomentosiformis
ref|XP_009782012.1|  PREDICTED: zinc finger CCCH domain-containin...    260   1e-79   Nicotiana sylvestris
ref|XP_009601117.1|  PREDICTED: zinc finger CCCH domain-containin...    256   4e-78   Nicotiana tomentosiformis
ref|XP_009782011.1|  PREDICTED: zinc finger CCCH domain-containin...    256   5e-78   Nicotiana sylvestris
ref|XP_010260865.1|  PREDICTED: zinc finger CCCH domain-containin...    254   3e-77   Nelumbo nucifera [Indian lotus]
ref|XP_010260864.1|  PREDICTED: zinc finger CCCH domain-containin...    255   3e-77   Nelumbo nucifera [Indian lotus]
gb|KDP37468.1|  hypothetical protein JCGZ_06908                         246   1e-74   Jatropha curcas
emb|CDP19345.1|  unnamed protein product                                246   3e-74   Coffea canephora [robusta coffee]
ref|XP_006422335.1|  hypothetical protein CICLE_v100047901mg            234   9e-74   
ref|XP_002528658.1|  conserved hypothetical protein                     242   7e-73   Ricinus communis
ref|XP_004251961.1|  PREDICTED: zinc finger CCCH domain-containin...    241   1e-72   Solanum lycopersicum
ref|XP_010313972.1|  PREDICTED: zinc finger CCCH domain-containin...    241   2e-72   Solanum lycopersicum
ref|XP_002269152.1|  PREDICTED: zinc finger CCCH domain-containin...    241   4e-72   Vitis vinifera
ref|XP_011014515.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    237   9e-71   Populus euphratica
emb|CAN72812.1|  hypothetical protein VITISV_004748                     247   1e-70   Vitis vinifera
ref|XP_011096138.1|  PREDICTED: zinc finger CCCH domain-containin...    236   1e-70   
ref|XP_006493723.1|  PREDICTED: zinc finger CCCH domain-containin...    234   2e-70   Citrus sinensis [apfelsine]
ref|XP_002315096.1|  enhancer of AG-4 1 family protein                  236   2e-70   
ref|XP_006344928.1|  PREDICTED: zinc finger CCCH domain-containin...    235   3e-70   Solanum tuberosum [potatoes]
ref|XP_006493722.1|  PREDICTED: zinc finger CCCH domain-containin...    234   1e-69   Citrus sinensis [apfelsine]
ref|XP_007022804.1|  Floral homeotic protein isoform 5                  231   1e-69   
gb|KHN38167.1|  Zinc finger CCCH domain-containing protein 37           228   7e-69   Glycine soja [wild soybean]
ref|XP_007022800.1|  Floral homeotic protein isoform 1                  231   8e-69   Theobroma cacao [chocolate]
ref|XP_010924870.1|  PREDICTED: zinc finger CCCH domain-containin...    232   2e-68   Elaeis guineensis
ref|XP_006585719.1|  PREDICTED: zinc finger CCCH domain-containin...    229   5e-68   Glycine max [soybeans]
ref|XP_007133464.1|  hypothetical protein PHAVU_011G180700g             228   8e-68   Phaseolus vulgaris [French bean]
gb|KHN35319.1|  Zinc finger CCCH domain-containing protein 37           225   1e-67   Glycine soja [wild soybean]
gb|EYU27607.1|  hypothetical protein MIMGU_mgv1a0053432mg               223   1e-67   Erythranthe guttata [common monkey flower]
ref|XP_010645074.1|  PREDICTED: zinc finger CCCH domain-containin...    229   2e-67   Vitis vinifera
ref|XP_010924871.1|  PREDICTED: zinc finger CCCH domain-containin...    228   4e-67   Elaeis guineensis
ref|XP_003545729.1|  PREDICTED: zinc finger CCCH domain-containin...    226   7e-67   Glycine max [soybeans]
gb|KJB81460.1|  hypothetical protein B456_013G146700                    220   4e-66   Gossypium raimondii
ref|XP_011012050.1|  PREDICTED: zinc finger CCCH domain-containin...    224   4e-66   Populus euphratica
ref|XP_008225967.1|  PREDICTED: zinc finger CCCH domain-containin...    223   9e-66   Prunus mume [ume]
gb|KJB81459.1|  hypothetical protein B456_013G146700                    222   1e-65   Gossypium raimondii
gb|KHG27644.1|  Zinc finger CCCH domain-containing 37 -like protein     222   1e-65   Gossypium arboreum [tree cotton]
gb|KJB81457.1|  hypothetical protein B456_013G146700                    222   1e-65   Gossypium raimondii
ref|XP_004148293.1|  PREDICTED: zinc finger CCCH domain-containin...    222   8e-65   Cucumis sativus [cucumbers]
ref|XP_010543113.1|  PREDICTED: zinc finger CCCH domain-containin...    221   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_008447068.1|  PREDICTED: zinc finger CCCH domain-containin...    221   2e-64   Cucumis melo [Oriental melon]
ref|XP_008225965.1|  PREDICTED: zinc finger CCCH domain-containin...    218   1e-63   Prunus mume [ume]
ref|XP_009368594.1|  PREDICTED: zinc finger CCCH domain-containin...    216   4e-63   Pyrus x bretschneideri [bai li]
gb|KEH19319.1|  zinc finger CCCH domain protein                         211   2e-62   Medicago truncatula
ref|XP_007211846.1|  hypothetical protein PRUPE_ppa004704mg             214   4e-62   Prunus persica
ref|XP_008791420.1|  PREDICTED: zinc finger CCCH domain-containin...    212   3e-61   Phoenix dactylifera
gb|KEH19318.1|  zinc finger CCCH domain protein                         212   3e-61   Medicago truncatula
ref|XP_010913403.1|  PREDICTED: zinc finger CCCH domain-containin...    212   4e-61   Elaeis guineensis
ref|XP_002884918.1|  enhancer of ag-4 1                                 211   1e-60   Arabidopsis lyrata subsp. lyrata
gb|KFK38615.1|  hypothetical protein AALP_AA3G137300                    211   1e-60   Arabis alpina [alpine rockcress]
gb|AAG51026.1|AC069474_25  zinc finger protein, putative, 5' part...    205   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008383223.1|  PREDICTED: zinc finger CCCH domain-containin...    209   2e-60   
ref|XP_006297429.1|  hypothetical protein CARUB_v10013453mg             209   2e-60   
ref|XP_010499333.1|  PREDICTED: zinc finger CCCH domain-containin...    210   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010499317.1|  PREDICTED: zinc finger CCCH domain-containin...    210   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006297430.1|  hypothetical protein CARUB_v10013453mg             209   3e-60   Capsella rubella
ref|XP_004517028.1|  PREDICTED: zinc finger CCCH domain-containin...    209   3e-60   Cicer arietinum [garbanzo]
ref|XP_006407308.1|  hypothetical protein EUTSA_v10020494mg             209   5e-60   
ref|XP_010465044.1|  PREDICTED: zinc finger CCCH domain-containin...    209   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006407307.1|  hypothetical protein EUTSA_v10020494mg             208   6e-60   
ref|XP_010465043.1|  PREDICTED: zinc finger CCCH domain-containin...    209   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006407309.1|  hypothetical protein EUTSA_v10020494mg             209   7e-60   Eutrema salsugineum [saltwater cress]
dbj|BAF01019.1|  floral homeotic protein HUA1                           206   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499325.1|  PREDICTED: zinc finger CCCH domain-containin...    207   4e-59   
ref|NP_187874.2|  floral homeotic protein HUA1                          206   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004517027.1|  PREDICTED: zinc finger CCCH domain-containin...    206   9e-59   Cicer arietinum [garbanzo]
ref|XP_009146600.1|  PREDICTED: zinc finger CCCH domain-containin...    205   1e-58   Brassica rapa
ref|XP_010489794.1|  PREDICTED: zinc finger CCCH domain-containin...    204   2e-58   
ref|XP_010693153.1|  PREDICTED: zinc finger CCCH domain-containin...    204   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009420696.1|  PREDICTED: zinc finger CCCH domain-containin...    204   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420703.1|  PREDICTED: zinc finger CCCH domain-containin...    204   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146599.1|  PREDICTED: zinc finger CCCH domain-containin...    204   4e-58   
ref|XP_004295542.1|  PREDICTED: zinc finger CCCH domain-containin...    203   5e-58   Fragaria vesca subsp. vesca
ref|XP_010557387.1|  PREDICTED: zinc finger CCCH domain-containin...    200   8e-58   Tarenaya hassleriana [spider flower]
ref|XP_004517029.1|  PREDICTED: zinc finger CCCH domain-containin...    202   1e-57   Cicer arietinum [garbanzo]
emb|CDY42164.1|  BnaC05g40550D                                          202   2e-57   Brassica napus [oilseed rape]
ref|XP_009146598.1|  PREDICTED: zinc finger CCCH domain-containin...    201   1e-56   
emb|CDY08415.1|  BnaA05g26510D                                          200   2e-56   Brassica napus [oilseed rape]
ref|XP_008798450.1|  PREDICTED: zinc finger CCCH domain-containin...    198   5e-56   
gb|EPS67891.1|  hypothetical protein M569_06884                         192   2e-54   Genlisea aurea
ref|XP_010913397.1|  PREDICTED: zinc finger CCCH domain-containin...    190   1e-52   
ref|XP_010913389.1|  PREDICTED: zinc finger CCCH domain-containin...    189   3e-52   Elaeis guineensis
ref|XP_010095999.1|  Zinc finger CCCH domain-containing protein 37      187   1e-51   
ref|XP_006830468.1|  hypothetical protein AMTR_s00115p00126760          187   1e-51   Amborella trichopoda
ref|XP_006422341.1|  hypothetical protein CICLE_v100047901mg            164   3e-47   
dbj|BAB02411.1|  zinc finger protein-like                               168   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644369.1|  PREDICTED: zinc finger CCCH domain-containin...    168   4e-45   Oryza brachyantha
gb|EEC71090.1|  hypothetical protein OsI_02867                          166   2e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001043577.1|  Os01g0616400                                       166   2e-44   
sp|Q5ZDJ6.2|C3H8_ORYSJ  RecName: Full=Zinc finger CCCH domain-con...    166   3e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232025.1|  PREDICTED: zinc finger CCCH domain-containin...    163   3e-44   Brachypodium distachyon [annual false brome]
tpg|DAA58980.2|  TPA: hypothetical protein ZEAMMB73_531605              160   6e-44   
gb|KGN44308.1|  hypothetical protein Csa_7G252650                       165   8e-44   Cucumis sativus [cucumbers]
ref|XP_007022803.1|  Floral homeotic protein isoform 4                  162   1e-43   
ref|XP_002312214.1|  enhancer of AG-4 1 family protein                  164   2e-43   
ref|XP_003569363.1|  PREDICTED: zinc finger CCCH domain-containin...    163   4e-43   Brachypodium distachyon [annual false brome]
ref|XP_007022801.1|  Floral homeotic protein isoform 2                  162   4e-43   Theobroma cacao [chocolate]
ref|NP_001169053.1|  uncharacterized protein LOC100382893               160   5e-42   Zea mays [maize]
emb|CDM83363.1|  unnamed protein product                                159   1e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004986449.1|  PREDICTED: zinc finger CCCH domain-containin...    154   4e-41   Setaria italica
gb|EMS62698.1|  Zinc finger CCCH domain-containing protein 8            157   1e-40   Triticum urartu
ref|XP_004969171.1|  PREDICTED: zinc finger CCCH domain-containin...    155   4e-40   Setaria italica
ref|XP_004969170.1|  PREDICTED: zinc finger CCCH domain-containin...    155   6e-40   
gb|KCW71429.1|  hypothetical protein EUGRSUZ_F04489                     152   3e-39   Eucalyptus grandis [rose gum]
ref|XP_010064114.1|  PREDICTED: zinc finger CCCH domain-containin...    150   1e-38   Eucalyptus grandis [rose gum]
ref|XP_010064113.1|  PREDICTED: zinc finger CCCH domain-containin...    149   5e-38   Eucalyptus grandis [rose gum]
ref|XP_010064112.1|  PREDICTED: zinc finger CCCH domain-containin...    148   9e-38   Eucalyptus grandis [rose gum]
ref|NP_001136594.1|  uncharacterized protein LOC100216717               135   1e-35   
gb|AFW83269.1|  hypothetical protein ZEAMMB73_943527                    136   2e-34   
gb|AFW83266.1|  hypothetical protein ZEAMMB73_943527                    136   3e-34   
ref|XP_001766711.1|  predicted protein                                  136   4e-34   
ref|XP_008654463.1|  PREDICTED: uncharacterized protein LOC100216...    136   2e-33   
ref|XP_008791419.1|  PREDICTED: zinc finger CCCH domain-containin...    119   3e-30   
gb|AIB05645.1|  C3H transcription factor                                119   4e-30   synthetic construct
ref|XP_001771210.1|  predicted protein                                  116   2e-27   
ref|XP_009382899.1|  PREDICTED: zinc finger CCCH domain-containin...    110   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011085488.1|  PREDICTED: zinc finger CCCH domain-containin...    108   6e-24   Sesamum indicum [beniseed]
ref|XP_002993272.1|  hypothetical protein SELMODRAFT_45667              107   7e-24   
gb|KDO47609.1|  hypothetical protein CISIN_1g0472481mg                  106   8e-24   Citrus sinensis [apfelsine]
ref|XP_011085490.1|  PREDICTED: zinc finger CCCH domain-containin...    108   9e-24   Sesamum indicum [beniseed]
ref|XP_002993790.1|  hypothetical protein SELMODRAFT_45658              107   9e-24   
ref|XP_010558591.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_003566542.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   
ref|XP_010525081.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_006587810.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   Glycine max [soybeans]
ref|XP_010525082.1|  PREDICTED: zinc finger CCCH domain-containin...    107   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_010248777.1|  PREDICTED: zinc finger CCCH domain-containin...    106   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006428579.1|  hypothetical protein CICLE_v10011741mg             106   5e-23   
ref|XP_006428577.1|  hypothetical protein CICLE_v10011741mg             105   5e-23   
ref|XP_009626542.1|  PREDICTED: zinc finger CCCH domain-containin...    105   6e-23   Nicotiana tomentosiformis
ref|XP_006376056.1|  hypothetical protein POPTR_0013s08490g             104   6e-23   
dbj|BAJ86598.1|  predicted protein                                      106   7e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008792910.1|  PREDICTED: zinc finger CCCH domain-containin...    106   7e-23   
gb|EEC70342.1|  hypothetical protein OsI_01241                          105   8e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_008355849.1|  PREDICTED: zinc finger CCCH domain-containin...    105   9e-23   
ref|XP_008792915.1|  PREDICTED: zinc finger CCCH domain-containin...    105   9e-23   
ref|XP_009338000.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_011084651.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   
ref|XP_011085489.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   Sesamum indicum [beniseed]
ref|XP_002512627.1|  nucleic acid binding protein, putative             105   1e-22   Ricinus communis
ref|NP_974790.1|  zinc finger nuclease 3                                104   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851041.1|  zinc finger nuclease 3                                104   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495537.1|  PREDICTED: zinc finger CCCH domain-containin...    104   1e-22   Cicer arietinum [garbanzo]
ref|XP_008359920.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   Malus domestica [apple tree]
gb|KDP23293.1|  hypothetical protein JCGZ_23126                         105   1e-22   Jatropha curcas
ref|XP_009420319.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420318.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042632.2|  Os01g0257400                                       105   1e-22   
emb|CDP04213.1|  unnamed protein product                                104   1e-22   Coffea canephora [robusta coffee]
ref|XP_011077188.1|  PREDICTED: zinc finger CCCH domain-containin...    103   2e-22   
ref|XP_004302155.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   Fragaria vesca subsp. vesca
ref|XP_008799408.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   Phoenix dactylifera
ref|XP_010248778.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009611379.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   Nicotiana tomentosiformis
ref|XP_011077184.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   Sesamum indicum [beniseed]
gb|EPS74454.1|  hypothetical protein M569_00301                         101   2e-22   Genlisea aurea
ref|XP_009769498.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   Nicotiana sylvestris
ref|XP_011077187.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   Sesamum indicum [beniseed]
gb|EEE65800.1|  hypothetical protein OsJ_21508                          106   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006848460.1|  hypothetical protein AMTR_s00013p00248880          104   2e-22   Amborella trichopoda
ref|XP_010507840.1|  PREDICTED: zinc finger CCCH domain-containin...    104   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006422326.1|  hypothetical protein CICLE_v100047902mg            100   3e-22   
gb|KCW84570.1|  hypothetical protein EUGRSUZ_B01407                     103   3e-22   Eucalyptus grandis [rose gum]
ref|XP_011015459.1|  PREDICTED: zinc finger CCCH domain-containin...    103   3e-22   Populus euphratica
ref|XP_009611380.1|  PREDICTED: zinc finger CCCH domain-containin...    103   4e-22   Nicotiana tomentosiformis
ref|XP_009793876.1|  PREDICTED: zinc finger CCCH domain-containin...    103   4e-22   Nicotiana sylvestris
ref|XP_007029392.1|  Zinc finger CCCH domain-containing protein 3...    103   4e-22   
ref|XP_007139733.1|  hypothetical protein PHAVU_008G054800g             103   4e-22   Phaseolus vulgaris [French bean]
ref|XP_011014133.1|  PREDICTED: zinc finger CCCH domain-containin...    103   4e-22   Populus euphratica
ref|XP_007139732.1|  hypothetical protein PHAVU_008G054800g             103   4e-22   Phaseolus vulgaris [French bean]
ref|XP_011024099.1|  PREDICTED: zinc finger CCCH domain-containin...    103   4e-22   Populus euphratica
gb|KCW84568.1|  hypothetical protein EUGRSUZ_B01407                     103   4e-22   Eucalyptus grandis [rose gum]
ref|XP_010024648.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-22   
ref|XP_007205202.1|  hypothetical protein PRUPE_ppa005813mg             103   5e-22   Prunus persica
ref|XP_007029391.1|  Zinc finger CCCH domain-containing protein 3...    103   5e-22   Theobroma cacao [chocolate]
ref|XP_008218439.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-22   Prunus mume [ume]
ref|XP_010038283.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-22   Eucalyptus grandis [rose gum]
emb|CDP03533.1|  unnamed protein product                                103   5e-22   Coffea canephora [robusta coffee]
ref|XP_004172583.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-22   
ref|XP_010024647.1|  PREDICTED: zinc finger CCCH domain-containin...    103   6e-22   
ref|XP_011024098.1|  PREDICTED: zinc finger CCCH domain-containin...    103   6e-22   Populus euphratica
ref|XP_009134713.1|  PREDICTED: zinc finger CCCH domain-containin...    102   6e-22   Brassica rapa
gb|KJB82178.1|  hypothetical protein B456_013G179800                    101   6e-22   Gossypium raimondii
ref|XP_010929824.1|  PREDICTED: zinc finger CCCH domain-containin...    101   6e-22   
ref|XP_009134712.1|  PREDICTED: zinc finger CCCH domain-containin...    102   6e-22   Brassica rapa
ref|XP_009776617.1|  PREDICTED: zinc finger CCCH domain-containin...    102   7e-22   Nicotiana sylvestris
ref|XP_006602842.1|  PREDICTED: zinc finger CCCH domain-containin...    102   7e-22   
emb|CDY28712.1|  BnaCnng05980D                                          102   7e-22   Brassica napus [oilseed rape]
ref|XP_008794629.1|  PREDICTED: zinc finger CCCH domain-containin...    103   7e-22   
ref|XP_004296815.1|  PREDICTED: zinc finger CCCH domain-containin...    103   7e-22   Fragaria vesca subsp. vesca
gb|KEH23393.1|  zinc finger CCCH domain protein                         102   7e-22   Medicago truncatula
gb|EYU43139.1|  hypothetical protein MIMGU_mgv1a007548mg                102   7e-22   Erythranthe guttata [common monkey flower]
ref|XP_003624157.1|  Zinc finger CCCH domain-containing protein         102   8e-22   Medicago truncatula
ref|XP_003534518.1|  PREDICTED: zinc finger CCCH domain-containin...    102   8e-22   Glycine max [soybeans]
gb|ACC85690.1|  zinc finger protein                                     102   8e-22   Medicago sativa [alfalfa]
ref|XP_006397979.1|  hypothetical protein EUTSA_v10001399mg             103   8e-22   
ref|XP_004157161.1|  PREDICTED: zinc finger CCCH domain-containin...    100   8e-22   
ref|XP_006606433.1|  PREDICTED: zinc finger CCCH domain-containin...    102   8e-22   Glycine max [soybeans]
ref|XP_009118612.1|  PREDICTED: zinc finger CCCH domain-containin...    102   8e-22   Brassica rapa
ref|XP_009147316.1|  PREDICTED: zinc finger CCCH domain-containin...    102   9e-22   Brassica rapa
ref|XP_009118604.1|  PREDICTED: zinc finger CCCH domain-containin...    102   9e-22   Brassica rapa
emb|CDY51531.1|  BnaA05g33310D                                          102   9e-22   Brassica napus [oilseed rape]
emb|CDY53749.1|  BnaAnng12770D                                          102   1e-21   Brassica napus [oilseed rape]
ref|XP_004967812.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Setaria italica
emb|CDY67901.1|  BnaCnng56860D                                          102   1e-21   Brassica napus [oilseed rape]
emb|CDM82689.1|  unnamed protein product                                102   1e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002278934.2|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Vitis vinifera
ref|XP_009417930.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB26823.1|  hypothetical protein B456_004G261700                    102   1e-21   Gossypium raimondii
ref|XP_011100472.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Sesamum indicum [beniseed]
ref|XP_006294141.1|  hypothetical protein CARUB_v10023134mg             102   1e-21   Capsella rubella
emb|CDX74233.1|  BnaA03g28140D                                          101   1e-21   
ref|XP_010913061.1|  PREDICTED: zinc finger CCCH domain-containin...    101   1e-21   Elaeis guineensis
tpg|DAA54001.1|  TPA: hypothetical protein ZEAMMB73_676626              100   1e-21   
ref|XP_009392477.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009337999.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_004250094.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Solanum lycopersicum
ref|XP_011100471.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   Sesamum indicum [beniseed]
ref|XP_011014371.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Populus euphratica
ref|XP_006353234.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Solanum tuberosum [potatoes]
gb|KJB75169.1|  hypothetical protein B456_012G028600                    101   2e-21   Gossypium raimondii
ref|XP_009418525.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   
ref|XP_003536159.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   Glycine max [soybeans]
ref|XP_010523985.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010270055.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_002325901.2|  zinc finger family protein                         102   2e-21   
ref|XP_009406323.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921758.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Elaeis guineensis
ref|XP_003577562.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_006829499.1|  hypothetical protein AMTR_s00074p00110430          100   2e-21   
ref|XP_010666383.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006422325.1|  hypothetical protein CICLE_v100047902mg            100   2e-21   
ref|XP_010666382.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002871723.1|  hypothetical protein ARALYDRAFT_488510             100   2e-21   
ref|XP_008359919.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   Malus domestica [apple tree]
ref|XP_008812314.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    102   2e-21   Phoenix dactylifera
ref|XP_002881253.1|  hypothetical protein ARALYDRAFT_345050             102   2e-21   Arabidopsis lyrata subsp. lyrata
gb|EYU39704.1|  hypothetical protein MIMGU_mgv1a0076882mg               101   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_006581890.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   Glycine max [soybeans]
ref|XP_010928414.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   Elaeis guineensis
gb|EWM30456.1|  zinc finger ccch type domain-containing protein z...    100   3e-21   Nannochloropsis gaditana
ref|XP_004142565.1|  PREDICTED: zinc finger CCCH domain-containin...    100   3e-21   
gb|KHN31930.1|  Zinc finger CCCH domain-containing protein 43           102   3e-21   Glycine soja [wild soybean]
ref|XP_010513101.1|  PREDICTED: zinc finger CCCH domain-containin...    100   3e-21   Camelina sativa [gold-of-pleasure]
gb|ADN33845.1|  nucleic acid binding protein                            100   3e-21   Cucumis melo subsp. melo
ref|NP_182306.2|  zinc finger CCCH domain-containing protein 32         101   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006380188.1|  hypothetical protein POPTR_0008s22730g             102   3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010929827.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   Elaeis guineensis
ref|XP_010929825.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   Elaeis guineensis
ref|XP_008796232.1|  PREDICTED: zinc finger CCCH domain-containin...    100   3e-21   Phoenix dactylifera
gb|KJB82177.1|  hypothetical protein B456_013G179800                    101   3e-21   Gossypium raimondii
ref|XP_008443710.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    101   3e-21   
gb|KJB75168.1|  hypothetical protein B456_012G028600                    101   3e-21   Gossypium raimondii
ref|XP_002450713.1|  hypothetical protein SORBIDRAFT_05g013190          101   3e-21   Sorghum bicolor [broomcorn]
ref|XP_007143976.1|  hypothetical protein PHAVU_007G118500g             101   3e-21   Phaseolus vulgaris [French bean]
ref|XP_008802110.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   Phoenix dactylifera
ref|XP_010943246.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   Elaeis guineensis
gb|KJB22541.1|  hypothetical protein B456_004G053200                  99.8    3e-21   Gossypium raimondii
ref|XP_010927660.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
gb|KJB75170.1|  hypothetical protein B456_012G028600                    100   3e-21   Gossypium raimondii
ref|XP_010938478.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   Elaeis guineensis
gb|KJB41978.1|  hypothetical protein B456_007G130500                    101   4e-21   Gossypium raimondii
ref|XP_010943244.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   
ref|XP_010413928.1|  PREDICTED: zinc finger CCCH domain-containin...    101   4e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002892258.1|  predicted protein                                  100   4e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_009418524.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385235.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP05691.1|  unnamed protein product                                100   4e-21   Coffea canephora [robusta coffee]
ref|XP_011018690.1|  PREDICTED: zinc finger CCCH domain-containin...    101   4e-21   Populus euphratica
ref|NP_566183.1|  zinc finger protein 1                                 100   4e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAC63639.1|  unknown protein                                         102   4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880326.1|  zinc finger (CCCH-type) family protein             101   4e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_004979251.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   Setaria italica
emb|CDX79496.1|  BnaC03g18320D                                          100   5e-21   
ref|XP_004979252.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-21   
gb|KJB81458.1|  hypothetical protein B456_013G146700                    100   5e-21   Gossypium raimondii
ref|XP_010245962.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    100   5e-21   
ref|XP_008796233.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    5e-21   
ref|XP_009415456.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004967813.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-21   
gb|AGT16494.1|  zinc finger CCCH type domain-containing protein         100   5e-21   
gb|AAF26977.1|AC018363_22  zinc finger protein 1 (zfn1)                 100   5e-21   
ref|XP_010501847.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-21   
ref|XP_007022802.1|  Floral homeotic protein isoform 3                99.8    5e-21   
ref|XP_010501886.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
ref|XP_006662931.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
ref|XP_002882253.1|  hypothetical protein ARALYDRAFT_477525             100   6e-21   
gb|EMS67785.1|  Zinc finger CCCH domain-containing protein 5            100   6e-21   
ref|XP_008796231.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
gb|EYU46719.1|  hypothetical protein MIMGU_mgv1a008599mg              99.8    6e-21   
ref|XP_006644012.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
gb|EYU46720.1|  hypothetical protein MIMGU_mgv1a008599mg              99.8    6e-21   
ref|XP_010469532.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
ref|XP_009417932.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    6e-21   
gb|EYU46718.1|  hypothetical protein MIMGU_mgv1a008599mg              99.8    7e-21   
ref|XP_002277300.1|  PREDICTED: zinc finger CCCH domain-containin...    100   7e-21   
ref|NP_001130819.1|  uncharacterized protein LOC100191923               100   7e-21   
ref|XP_006855486.1|  hypothetical protein AMTR_s00057p00193570          100   8e-21   
ref|XP_010485612.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    8e-21   
gb|EMS58335.1|  Zinc finger CCCH domain-containing protein 6          99.8    8e-21   
ref|XP_010649761.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    8e-21   
gb|KDO47608.1|  hypothetical protein CISIN_1g0472482mg                97.4    8e-21   
ref|XP_006408379.1|  hypothetical protein EUTSA_v10020900mg           99.4    8e-21   
gb|KJB23208.1|  hypothetical protein B456_004G086700                  99.0    8e-21   
gb|KJB22540.1|  hypothetical protein B456_004G053200                  99.4    9e-21   
ref|XP_009417931.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    9e-21   
ref|XP_006829498.1|  hypothetical protein AMTR_s00074p00109750        97.1    9e-21   
ref|NP_001150919.1|  zinc finger CCCH type domain-containing prot...    100   9e-21   
gb|KFK37691.1|  hypothetical protein AALP_AA3G016100                  99.4    9e-21   
gb|EPS74440.1|  hypothetical protein M569_00316                       99.4    1e-20   
ref|XP_010463710.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-20   
dbj|BAK02824.1|  predicted protein                                      100   1e-20   
ref|XP_006408377.1|  hypothetical protein EUTSA_v10020900mg           99.0    1e-20   
ref|NP_001147888.1|  zinc finger CCCH type domain-containing prot...  99.8    1e-20   
gb|ABG22481.1|  Zinc finger CCCH type domain containing protein Z...  99.4    1e-20   
gb|EMT01168.1|  Zinc finger CCCH domain-containing protein 6            100   1e-20   
ref|XP_010463709.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-20   
emb|CDX92015.1|  BnaC03g33170D                                        99.0    1e-20   
gb|ACN28458.1|  unknown                                               99.8    1e-20   
ref|XP_009391577.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    100   1e-20   
emb|CDM82679.1|  unnamed protein product                                100   1e-20   
ref|NP_001067878.1|  Os11g0472000                                     99.4    1e-20   
ref|XP_010475174.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-20   
ref|XP_002276435.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
ref|XP_010545037.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
gb|KDP40004.1|  hypothetical protein JCGZ_02002                         100   1e-20   
gb|KHN44751.1|  Zinc finger CCCH domain-containing protein 3          99.4    1e-20   
ref|XP_002457592.1|  hypothetical protein SORBIDRAFT_03g009920        99.8    1e-20   
ref|XP_010545038.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    1e-20   
ref|XP_008799415.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    1e-20   
sp|Q2R4J4.2|C3H63_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...  99.4    1e-20   
emb|CAN78551.1|  hypothetical protein VITISV_003243                     100   2e-20   
gb|KHN05794.1|  Zinc finger CCCH domain-containing protein 43           100   2e-20   
ref|XP_008803515.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_009411695.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    2e-20   
ref|XP_009611374.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_003522417.1|  PREDICTED: zinc finger CCCH domain-containin...    100   2e-20   
gb|KDP28101.1|  hypothetical protein JCGZ_13872                       99.4    2e-20   
ref|XP_009776613.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_008810537.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  99.4    2e-20   
ref|XP_008803514.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_010243539.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
sp|Q9SWF9.1|ZFNL_PEA  RecName: Full=Zinc finger CCCH domain-conta...  98.6    2e-20   
gb|EEE52080.1|  hypothetical protein OsJ_33853                          100   2e-20   
gb|KFK42845.1|  hypothetical protein AALP_AA1G046700                  98.6    2e-20   
ref|XP_008803512.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_009339837.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_008803513.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_010453818.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  98.6    2e-20   
ref|XP_002457593.1|  hypothetical protein SORBIDRAFT_03g009930        99.4    2e-20   
ref|XP_006663970.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    2e-20   
gb|KHN38500.1|  Zinc finger CCCH domain-containing protein 3          98.6    2e-20   
ref|XP_010652064.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_003519444.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    2e-20   
ref|XP_002875904.1|  zinc finger (CCCH-type) family protein           99.0    2e-20   
ref|XP_010673926.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_010673925.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    2e-20   
ref|XP_007222805.1|  hypothetical protein PRUPE_ppa005056mg           99.4    3e-20   
ref|XP_006296584.1|  hypothetical protein CARUB_v100138730mg          97.8    3e-20   
gb|ACN33323.1|  unknown                                               99.0    3e-20   
ref|XP_006294179.1|  hypothetical protein CARUB_v10023174mg           99.0    3e-20   
ref|XP_006663969.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-20   
ref|XP_002520668.1|  nucleic acid binding protein, putative           99.0    3e-20   
ref|XP_009626457.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-20   
ref|NP_001150480.1|  LOC100284111                                     99.0    3e-20   
ref|XP_009143918.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    3e-20   
ref|XP_009613170.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    3e-20   
ref|XP_010026837.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    3e-20   
ref|XP_008389043.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    4e-20   
ref|XP_006418072.1|  hypothetical protein EUTSA_v10007912mg           97.8    4e-20   
ref|XP_007141661.1|  hypothetical protein PHAVU_008G214600g           97.8    4e-20   
ref|XP_007141660.1|  hypothetical protein PHAVU_008G214600g           97.8    4e-20   
ref|XP_009352233.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    4e-20   
gb|ACN40302.1|  unknown                                               98.6    4e-20   
ref|XP_010519530.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    4e-20   
emb|CDO98891.1|  unnamed protein product                              98.6    4e-20   
ref|XP_008340827.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    4e-20   
ref|XP_009611378.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    4e-20   
gb|AGT16495.1|  zinc finger CCCH type domain-containing protein       98.6    4e-20   
gb|ABR16930.1|  unknown                                               99.0    4e-20   
ref|XP_006444253.1|  hypothetical protein CICLE_v10019968mg           98.6    4e-20   
ref|XP_004240519.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  97.8    5e-20   
ref|XP_003566545.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    5e-20   
ref|XP_003545603.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    5e-20   
ref|XP_002528968.1|  zinc finger protein, putative                    98.2    5e-20   
ref|XP_009132897.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    5e-20   
ref|XP_006595836.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    5e-20   
ref|XP_003576637.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    5e-20   
ref|XP_010237293.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    5e-20   
ref|XP_010484523.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    5e-20   
ref|XP_006480414.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    5e-20   
ref|XP_010426339.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    6e-20   
ref|XP_009142498.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    6e-20   
emb|CDX80137.1|  BnaA05g00190D                                        97.8    6e-20   
ref|XP_010503474.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    6e-20   
ref|XP_009142499.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    6e-20   
ref|XP_010503473.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    6e-20   
ref|XP_008676804.1|  PREDICTED: hypothetical protein isoform X2       97.4    6e-20   
emb|CDY18279.1|  BnaC05g03020D                                        97.4    6e-20   
ref|NP_001141157.1|  hypothetical protein                             97.8    6e-20   
ref|XP_010426337.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    6e-20   
ref|XP_010688921.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    6e-20   
ref|XP_010457569.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    6e-20   
ref|XP_001768387.1|  predicted protein                                96.7    6e-20   
ref|XP_008223126.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    6e-20   
ref|XP_010688919.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    6e-20   
ref|XP_008676803.1|  PREDICTED: hypothetical protein isoform X1       97.4    7e-20   
gb|AAD33769.1|AF138743_1  zinc finger protein 1                       97.4    7e-20   
ref|XP_004967811.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    7e-20   
gb|KHG13153.1|  hypothetical protein F383_04055                       97.8    7e-20   
ref|XP_006366677.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    8e-20   
gb|KFK34147.1|  hypothetical protein AALP_AA5G106800                  97.1    8e-20   
ref|NP_563725.1|  zinc finger CCCH domain-containing protein 3        96.7    9e-20   
ref|XP_009416576.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    9e-20   
ref|XP_010420349.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    9e-20   
ref|XP_002864843.1|  zinc finger (CCCH-type) family protein           97.1    1e-19   
ref|XP_009369128.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    1e-19   
ref|XP_009416575.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-19   
ref|XP_009791086.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    1e-19   
gb|KCW58527.1|  hypothetical protein EUGRSUZ_H01196                   96.7    1e-19   
ref|XP_010420350.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-19   
ref|XP_010110220.1|  Zinc finger CCCH domain-containing protein 3     97.1    1e-19   
ref|XP_010069978.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    1e-19   
ref|XP_009133833.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-19   
gb|AFW79657.1|  hypothetical protein ZEAMMB73_788382                  94.7    1e-19   
ref|XP_008389190.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    1e-19   
dbj|BAD81402.1|  putative floral homeotic protein HUA1                97.1    1e-19   
gb|EEC80722.1|  hypothetical protein OsI_23177                        98.2    1e-19   
ref|XP_001752915.1|  predicted protein                                90.5    1e-19   
ref|NP_001057742.1|  Os06g0520600                                     98.2    1e-19   
ref|XP_009394545.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-19   
ref|NP_001066624.1|  Os12g0405100                                     96.7    1e-19   
dbj|BAG99345.1|  unnamed protein product                              97.1    1e-19   
ref|XP_011013662.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    1e-19   
ref|XP_010241841.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    2e-19   
emb|CDY53022.1|  BnaC04g00080D                                        96.7    2e-19   
ref|XP_009119217.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    2e-19   
ref|NP_001042637.1|  Os01g0258700                                     97.1    2e-19   
ref|XP_003616871.1|  Zinc finger CCCH domain-containing protein       96.3    2e-19   
ref|XP_006291143.1|  hypothetical protein CARUB_v10017261mg           96.3    2e-19   
ref|XP_002314462.1|  hypothetical protein POPTR_0010s02320g           96.7    2e-19   
ref|XP_004247451.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  96.7    2e-19   
emb|CDY53399.1|  BnaAnng12470D                                        95.9    2e-19   
ref|XP_009416574.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-19   
ref|XP_004515843.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    2e-19   
ref|XP_009416573.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-19   
gb|EPS71438.1|  hypothetical protein M569_03319                       96.3    2e-19   
ref|XP_009802826.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    2e-19   
ref|XP_009802825.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    2e-19   
ref|XP_010556971.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    2e-19   
ref|XP_007137964.1|  hypothetical protein PHAVU_009G169600g           96.7    2e-19   
ref|XP_006407949.1|  hypothetical protein EUTSA_v10020686mg           96.3    2e-19   
gb|KJB28621.1|  hypothetical protein B456_005G058800                  96.3    2e-19   
gb|KDO75085.1|  hypothetical protein CISIN_1g0118532mg                95.1    2e-19   
ref|XP_007154244.1|  hypothetical protein PHAVU_003G102600g           96.7    2e-19   
ref|XP_009588295.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    2e-19   
gb|AAV66094.1|  At5g63260                                             95.9    2e-19   
ref|XP_006287837.1|  hypothetical protein CARUB_v10001057mg           95.5    2e-19   
gb|KDO75084.1|  hypothetical protein CISIN_1g0118532mg                95.1    2e-19   
gb|KHN14776.1|  Zinc finger CCCH domain-containing protein ZFN-like   95.5    2e-19   
ref|XP_007050814.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  96.3    2e-19   
ref|XP_010684493.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-19   
ref|NP_201131.1|  zinc finger CCCH domain-containing protein 67       95.9    2e-19   
ref|XP_011071464.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    3e-19   
gb|KHF99697.1|  hypothetical protein F383_18975                       96.3    3e-19   
ref|XP_009774842.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    3e-19   
emb|CDY08072.1|  BnaA06g16540D                                        95.5    3e-19   
ref|XP_006852277.1|  hypothetical protein AMTR_s00049p00179390        95.1    3e-19   
ref|XP_010515161.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    3e-19   
dbj|BAG99488.1|  unnamed protein product                              93.6    3e-19   
ref|NP_190414.1|  zinc finger CCCH domain-containing protein 43       95.9    3e-19   
gb|KJB39997.1|  hypothetical protein B456_007G041600                  95.9    3e-19   
gb|EYU22370.1|  hypothetical protein MIMGU_mgv1a005385mg              96.3    3e-19   
gb|KJB23207.1|  hypothetical protein B456_004G086700                  95.9    3e-19   
ref|XP_009408339.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    3e-19   
ref|XP_009392482.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    3e-19   
ref|XP_006400193.1|  hypothetical protein EUTSA_v10013743mg           95.1    3e-19   
gb|KHN29278.1|  Zinc finger CCCH domain-containing protein ZFN-like   94.0    3e-19   
gb|KJB72635.1|  hypothetical protein B456_011G188400                  94.7    3e-19   
ref|XP_011090931.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    3e-19   
ref|XP_009392483.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    4e-19   
ref|XP_009392481.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    4e-19   
ref|XP_010542997.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    4e-19   
gb|KHG07834.1|  hypothetical protein F383_35307                       95.9    4e-19   
ref|XP_006408378.1|  hypothetical protein EUTSA_v10020900mg           94.7    4e-19   
ref|XP_008438828.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    4e-19   
ref|NP_001150792.1|  zinc finger CCCH type domain-containing prot...  95.5    4e-19   
ref|XP_010532994.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    4e-19   
ref|XP_004491091.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    4e-19   
ref|XP_009631342.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    4e-19   
ref|XP_010674845.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    4e-19   
ref|XP_010532995.1|  PREDICTED: zinc finger CCCH domain-containin...  94.4    4e-19   
gb|KHG22563.1|  hypothetical protein F383_29382                       95.5    5e-19   
ref|XP_008389189.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    5e-19   
ref|XP_006394295.1|  hypothetical protein EUTSA_v10004204mg           95.1    5e-19   
gb|KJB47069.1|  hypothetical protein B456_008G009500                  95.5    5e-19   
ref|XP_006404258.1|  hypothetical protein EUTSA_v10010405mg           94.4    5e-19   
gb|EEE55890.1|  hypothetical protein OsJ_04549                        94.4    5e-19   
ref|XP_010270053.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    5e-19   
ref|XP_008439243.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    5e-19   
gb|AFW79656.1|  zinc finger CCCH type domain-containing protein Z...  95.1    5e-19   



>ref|XP_009601118.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Nicotiana tomentosiformis]
Length=518

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 143/183 (78%), Gaps = 10/183 (5%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP-----PAAHLNVGVVNPTASLFQTFDPRLTQTMFGF  580
            LKTGSCKYG TCRYNHP+R  I P     PA HLN+G+VNP ASL Q  DPRLTQTM G 
Sbjct  340  LKTGSCKYGGTCRYNHPERTAIGPALVASPATHLNIGMVNPAASLLQNLDPRLTQTMLGL  399

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
             + +YPQRPGQ+ECDFYMKTGECKFGERC+FHHPLD S  + S+ + +Q N KL+LAGLP
Sbjct  400  LSPVYPQRPGQIECDFYMKTGECKFGERCKFHHPLDRSAPLVSAKDVQQPNVKLTLAGLP  459

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGYAKLVEAIQ  223
            RREGA+HCPYYMKTG+CK+GATCKFDHPPPGE++G  TSQ  S SV  E+     V+  +
Sbjct  460  RREGAVHCPYYMKTGMCKYGATCKFDHPPPGEVLGMATSQGASLSVEGED----TVDVKE  515

Query  222  KQQ  214
            +QQ
Sbjct  516  QQQ  518


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 78/165 (47%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP   T     AHL  G V       Q  D            ++ 
Sbjct  217  MKTQKCKFGNRCKFNHPKDNT-----AHL--GSV-------QNSD-----------VSVL  251

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN--------------  427
            P+RP +  C FYMKTG CKFG  C+FHHP D  L       G  +N              
Sbjct  252  PERPSEPSCTFYMKTGTCKFGATCKFHHPRDIQLPSPKQESGSAENPGSANNEMTEDVNL  311

Query  426  -FKLSL-------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               LS+        GLP R G + CP+Y+KTG CK+G TC+++HP
Sbjct  312  IKPLSVPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGGTCRYNHP  356


 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 77/143 (54%), Gaps = 29/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               +  P   +    +  +T       T   
Sbjct  167  MQTRTCKFGDSCKFDHP---------------IWVPEGGIPDWKEVPVT-------TESL  204

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C ++MKT +CKFG RC+F+HP D++  +     G  QN  +S+  LP R   
Sbjct  205  PERSGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHL-----GSVQNSDVSV--LPERPSE  257

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  258  PSCTFYMKTGTCKFGATCKFHHP  280


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +IYPQRPG+ +C  YM+T  CKFG+ C+F HP    + V      + +   ++   LP R
Sbjct  152  SIYPQRPGEKDCAHYMQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEVPVTTESLPER  207

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
             G   CPY+MKT  CKFG  CKF+HP       G+ Q +  SV  E
Sbjct  208  SGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHLGSVQNSDVSVLPE  253



>ref|XP_009782012.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Nicotiana sylvestris]
Length=518

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 142/183 (78%), Gaps = 10/183 (5%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP-----PAAHLNVGVVNPTASLFQTFDPRLTQTMFGF  580
            LKTGSCKYG TCRYNHP+R  I P     PA HLN+G+VNP ASL Q  DPRLTQTM G 
Sbjct  340  LKTGSCKYGGTCRYNHPERTAIGPALVASPATHLNIGMVNPAASLLQNLDPRLTQTMLGL  399

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
               +YPQRPGQ+ECDFYMKTGECKFGERC+FHHPLD S  V S+ + +Q N KL+LAGLP
Sbjct  400  LPPVYPQRPGQIECDFYMKTGECKFGERCKFHHPLDRSAPVVSAKDVQQPNVKLTLAGLP  459

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGYAKLVEAIQ  223
            RREGA+HCPYYMKTG+CK+GATCKFDHPPPGE++G  TSQ  S SV  E+     V+  +
Sbjct  460  RREGAVHCPYYMKTGMCKYGATCKFDHPPPGEVLGMATSQGASLSVEGED----TVDVKE  515

Query  222  KQQ  214
            +QQ
Sbjct  516  QQQ  518


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 78/165 (47%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP   T     AHL  G V       Q  D            ++ 
Sbjct  217  MKTQKCKFGNRCKFNHPKDNT-----AHL--GSV-------QNSD-----------VSVL  251

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN--------------  427
            P+RP +  C FYMKTG CKFG  C+FHHP D  L       G  +N              
Sbjct  252  PERPSEPSCAFYMKTGACKFGATCKFHHPRDIQLPSPKQESGSAENPGSANNEMTEDVNL  311

Query  426  -FKLSL-------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               LS+        GLP R G + CP+Y+KTG CK+G TC+++HP
Sbjct  312  IKPLSVPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGGTCRYNHP  356


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 31/144 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFD-PRLTQTMFGFATTI  568
            ++T +CK+G +C+++HP               +  P   +    + P +T+++       
Sbjct  167  MQTRTCKFGDSCKFDHP---------------IWVPEGGIPDWKEVPVITESL-------  204

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
             P+RPG+ +C ++MKT +CKFG RC+F+HP D++  +     G  QN  +S+  LP R  
Sbjct  205  -PERPGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHL-----GSVQNSDVSV--LPERPS  256

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +YMKTG CKFGATCKF HP
Sbjct  257  EPSCAFYMKTGACKFGATCKFHHP  280


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +IYPQRPG+ +C  YM+T  CKFG+ C+F HP    + V      + +   +    LP R
Sbjct  152  SIYPQRPGEKDCAHYMQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEVPVITESLPER  207

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
             G   CPY+MKT  CKFG  CKF+HP       G+ Q +  SV  E
Sbjct  208  PGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHLGSVQNSDVSVLPE  253



>ref|XP_009601117.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Nicotiana tomentosiformis]
Length=519

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%), Gaps = 11/184 (6%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------INPPAAHLNVGVVNPTASLFQTFDPRLTQTMFG  583
            LKTGSCKYG TCRYNHP+R        +  PA HLN+G+VNP ASL Q  DPRLTQTM G
Sbjct  340  LKTGSCKYGGTCRYNHPERTAAIGPALVASPATHLNIGMVNPAASLLQNLDPRLTQTMLG  399

Query  582  FATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGL  403
              + +YPQRPGQ+ECDFYMKTGECKFGERC+FHHPLD S  + S+ + +Q N KL+LAGL
Sbjct  400  LLSPVYPQRPGQIECDFYMKTGECKFGERCKFHHPLDRSAPLVSAKDVQQPNVKLTLAGL  459

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGYAKLVEAI  226
            PRREGA+HCPYYMKTG+CK+GATCKFDHPPPGE++G  TSQ  S SV  E+     V+  
Sbjct  460  PRREGAVHCPYYMKTGMCKYGATCKFDHPPPGEVLGMATSQGASLSVEGED----TVDVK  515

Query  225  QKQQ  214
            ++QQ
Sbjct  516  EQQQ  519


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 90/199 (45%), Gaps = 50/199 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP   T     AHL  G V       Q  D            ++ 
Sbjct  217  MKTQKCKFGNRCKFNHPKDNT-----AHL--GSV-------QNSD-----------VSVL  251

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN--------------  427
            P+RP +  C FYMKTG CKFG  C+FHHP D  L       G  +N              
Sbjct  252  PERPSEPSCTFYMKTGTCKFGATCKFHHPRDIQLPSPKQESGSAENPGSANNEMTEDVNL  311

Query  426  -FKLSL-------AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGG---TSQV  280
               LS+        GLP R G + CP+Y+KTG CK+G TC+++HP     IG     S  
Sbjct  312  IKPLSVPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGGTCRYNHPERTAAIGPALVASPA  371

Query  279  TSTSVGEEEGYAKLVEAIQ  223
            T  ++G     A L++ + 
Sbjct  372  THLNIGMVNPAASLLQNLD  390


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 77/143 (54%), Gaps = 29/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               +  P   +    +  +T       T   
Sbjct  167  MQTRTCKFGDSCKFDHP---------------IWVPEGGIPDWKEVPVT-------TESL  204

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C ++MKT +CKFG RC+F+HP D++  +     G  QN  +S+  LP R   
Sbjct  205  PERSGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHL-----GSVQNSDVSV--LPERPSE  257

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  258  PSCTFYMKTGTCKFGATCKFHHP  280


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 59/106 (56%), Gaps = 4/106 (4%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +IYPQRPG+ +C  YM+T  CKFG+ C+F HP    + V      + +   ++   LP R
Sbjct  152  SIYPQRPGEKDCAHYMQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEVPVTTESLPER  207

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
             G   CPY+MKT  CKFG  CKF+HP       G+ Q +  SV  E
Sbjct  208  SGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHLGSVQNSDVSVLPE  253



>ref|XP_009782011.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Nicotiana sylvestris]
Length=519

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 141/184 (77%), Gaps = 11/184 (6%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------INPPAAHLNVGVVNPTASLFQTFDPRLTQTMFG  583
            LKTGSCKYG TCRYNHP+R        +  PA HLN+G+VNP ASL Q  DPRLTQTM G
Sbjct  340  LKTGSCKYGGTCRYNHPERTAAIGPALVASPATHLNIGMVNPAASLLQNLDPRLTQTMLG  399

Query  582  FATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGL  403
                +YPQRPGQ+ECDFYMKTGECKFGERC+FHHPLD S  V S+ + +Q N KL+LAGL
Sbjct  400  LLPPVYPQRPGQIECDFYMKTGECKFGERCKFHHPLDRSAPVVSAKDVQQPNVKLTLAGL  459

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGYAKLVEAI  226
            PRREGA+HCPYYMKTG+CK+GATCKFDHPPPGE++G  TSQ  S SV  E+     V+  
Sbjct  460  PRREGAVHCPYYMKTGMCKYGATCKFDHPPPGEVLGMATSQGASLSVEGED----TVDVK  515

Query  225  QKQQ  214
            ++QQ
Sbjct  516  EQQQ  519


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 90/199 (45%), Gaps = 50/199 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP   T     AHL  G V       Q  D            ++ 
Sbjct  217  MKTQKCKFGNRCKFNHPKDNT-----AHL--GSV-------QNSD-----------VSVL  251

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN--------------  427
            P+RP +  C FYMKTG CKFG  C+FHHP D  L       G  +N              
Sbjct  252  PERPSEPSCAFYMKTGACKFGATCKFHHPRDIQLPSPKQESGSAENPGSANNEMTEDVNL  311

Query  426  -FKLSL-------AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGG---TSQV  280
               LS+        GLP R G + CP+Y+KTG CK+G TC+++HP     IG     S  
Sbjct  312  IKPLSVPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGGTCRYNHPERTAAIGPALVASPA  371

Query  279  TSTSVGEEEGYAKLVEAIQ  223
            T  ++G     A L++ + 
Sbjct  372  THLNIGMVNPAASLLQNLD  390


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 31/144 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFD-PRLTQTMFGFATTI  568
            ++T +CK+G +C+++HP               +  P   +    + P +T+++       
Sbjct  167  MQTRTCKFGDSCKFDHP---------------IWVPEGGIPDWKEVPVITESL-------  204

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
             P+RPG+ +C ++MKT +CKFG RC+F+HP D++  +     G  QN  +S+  LP R  
Sbjct  205  -PERPGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHL-----GSVQNSDVSV--LPERPS  256

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +YMKTG CKFGATCKF HP
Sbjct  257  EPSCAFYMKTGACKFGATCKFHHP  280


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +IYPQRPG+ +C  YM+T  CKFG+ C+F HP    + V      + +   +    LP R
Sbjct  152  SIYPQRPGEKDCAHYMQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEVPVITESLPER  207

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
             G   CPY+MKT  CKFG  CKF+HP       G+ Q +  SV  E
Sbjct  208  PGEPDCPYFMKTQKCKFGNRCKFNHPKDNTAHLGSVQNSDVSVLPE  253



>ref|XP_010260865.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Nelumbo nucifera]
Length=523

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 142/191 (74%), Gaps = 18/191 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP-------------AAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYGATCRYNHPDR  INPP             AA+LN+GV+NP ASL  T DPR
Sbjct  337  LKTGSCKYGATCRYNHPDRNAINPPVAAALSHALISSAAANLNIGVINPAASLLPTIDPR  396

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
            + QT  G   TIYPQRPGQ+ECD+YMKTGECKFGERC+FHHP+D S  +T   + +QQN 
Sbjct  397  IAQTALGLGPTIYPQRPGQIECDYYMKTGECKFGERCKFHHPIDRSAPMTK--QAQQQNV  454

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGY  247
            KL+LAGLPRREGAI CP+YMKTG CK+G TC+FDHPPPGE I   T Q  ST+VGEEE  
Sbjct  455  KLTLAGLPRREGAIICPFYMKTGTCKYGVTCRFDHPPPGEAIAMATVQGASTTVGEEE--  512

Query  246  AKLVEAIQKQQ  214
             K  + +Q+QQ
Sbjct  513  QKDAQMVQEQQ  523


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 75/169 (44%), Gaps = 54/169 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G  C++NHP                                 ++ G      
Sbjct  213  LKTQKCKFGFRCKFNHPKDKI----------------------------DSLVGSEAVEL  244

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV------------TSSMEGEQQNFK  421
            P+RP +  C FYMKTG+CKFG  C+FHHP D  + V            T ++  E     
Sbjct  245  PERPSEPTCAFYMKTGKCKFGASCKFHHPKDIQIPVSGQENGNGEETETVTINDETMAAD  304

Query  420  LSL--------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            ++L               GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  305  VNLKPFVPFTPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHP  353


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 71/143 (50%), Gaps = 30/143 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  161  MLTRTCKFGDSCKFDHP---------------LWVPEGGI-----PDWKEVPLIATSESL  200

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG RC+F+HP D   S+  S   E          LP R   
Sbjct  201  PERPGEPDCPYFLKTQKCKFGFRCKFNHPKDKIDSLVGSEAVE----------LPERPSE  250

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGA+CKF HP
Sbjct  251  PTCAFYMKTGKCKFGASCKFHHP  273


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG+ C+F HPL   +      + ++     +   LP R 
Sbjct  147  IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPL--WVPEGGIPDWKEVPLIATSESLPERP  204

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPY++KT  CKFG  CKF+HP
Sbjct  205  GEPDCPYFLKTQKCKFGFRCKFNHP  229



>ref|XP_010260864.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Nelumbo nucifera]
Length=556

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 142/191 (74%), Gaps = 18/191 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP-------------AAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYGATCRYNHPDR  INPP             AA+LN+GV+NP ASL  T DPR
Sbjct  370  LKTGSCKYGATCRYNHPDRNAINPPVAAALSHALISSAAANLNIGVINPAASLLPTIDPR  429

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
            + QT  G   TIYPQRPGQ+ECD+YMKTGECKFGERC+FHHP+D S  +T   + +QQN 
Sbjct  430  IAQTALGLGPTIYPQRPGQIECDYYMKTGECKFGERCKFHHPIDRSAPMTK--QAQQQNV  487

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGY  247
            KL+LAGLPRREGAI CP+YMKTG CK+G TC+FDHPPPGE I   T Q  ST+VGEEE  
Sbjct  488  KLTLAGLPRREGAIICPFYMKTGTCKYGVTCRFDHPPPGEAIAMATVQGASTTVGEEE--  545

Query  246  AKLVEAIQKQQ  214
             K  + +Q+QQ
Sbjct  546  QKDAQMVQEQQ  556


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 75/169 (44%), Gaps = 54/169 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G  C++NHP                                 ++ G      
Sbjct  246  LKTQKCKFGFRCKFNHPKDKI----------------------------DSLVGSEAVEL  277

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV------------TSSMEGEQQNFK  421
            P+RP +  C FYMKTG+CKFG  C+FHHP D  + V            T ++  E     
Sbjct  278  PERPSEPTCAFYMKTGKCKFGASCKFHHPKDIQIPVSGQENGNGEETETVTINDETMAAD  337

Query  420  LSL--------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            ++L               GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  338  VNLKPFVPFTPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHP  386


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 71/143 (50%), Gaps = 30/143 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  194  MLTRTCKFGDSCKFDHP---------------LWVPEGGI-----PDWKEVPLIATSESL  233

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG RC+F+HP D   S+  S   E          LP R   
Sbjct  234  PERPGEPDCPYFLKTQKCKFGFRCKFNHPKDKIDSLVGSEAVE----------LPERPSE  283

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGA+CKF HP
Sbjct  284  PTCAFYMKTGKCKFGASCKFHHP  306


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG+ C+F HPL   +      + ++     +   LP R 
Sbjct  180  IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPL--WVPEGGIPDWKEVPLIATSESLPERP  237

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPY++KT  CKFG  CKF+HP
Sbjct  238  GEPDCPYFLKTQKCKFGFRCKFNHP  262



>gb|KDP37468.1| hypothetical protein JCGZ_06908 [Jatropha curcas]
Length=461

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 135/177 (76%), Gaps = 17/177 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDR  INPPAA            +LN+GV+NP ASL+QT DPRL
Sbjct  288  LKTGSCKYGATCRYNHPDRNAINPPAAAISHPIVANPAANLNIGVINPAASLYQTIDPRL  347

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q M G  + IYPQRPGQ ECDFYMKTGECKFGERC+FHHP++ S    +  + EQQ  K
Sbjct  348  AQPMLGVGSIIYPQRPGQTECDFYMKTGECKFGERCKFHHPINRS----APTQAEQQAVK  403

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEE  253
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++    SQ  S+  GE++
Sbjct  404  LTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDHPPPGEVMAISASQGISSFDGEDD  460


 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 81/168 (48%), Gaps = 49/168 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CKYG  C++NHP                     +LFQ      ++   GFA    
Sbjct  161  LKTKRCKYGLNCKFNHPKD-----------------KLALFQGG----SEDNDGFA---L  196

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV------------TSSMEGEQQNFK  421
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +              T +MEG   +F 
Sbjct  197  PERPSEPTCAFYMKTGKCKFGATCKFHHPKDIQMQFGQETNNTVQIGSTVTMEGTTGDFN  256

Query  420  LSLA-------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +  A             GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  257  VVKASISLTPALGHNSKGLPIRLGEADCPFYLKTGSCKYGATCRYNHP  304


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 76/167 (46%), Gaps = 31/167 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               V  P   +     P   +          
Sbjct  109  MLTRTCKFGDSCKFDHP---------------VWVPEGGI-----PNWKEVPLIAEMESL  148

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RP + +C +++KT  CK+G  C+F+HP D  L++      +   F      LP R   
Sbjct  149  PERPREPDCPYFLKTKRCKYGLNCKFNHPKD-KLALFQGGSEDNDGF-----ALPERPSE  202

Query  384  IHCPYYMKTGICKFGATCKFDHPPP-----GELIGGTSQVTSTSVGE  259
              C +YMKTG CKFGATCKF HP       G+    T Q+ ST   E
Sbjct  203  PTCAFYMKTGKCKFGATCKFHHPKDIQMQFGQETNNTVQIGSTVTME  249


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 50/90 (56%), Gaps = 12/90 (13%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            IYPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   N+K       +  
Sbjct  95   IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPV-------WVPEGGIPNWKEVPLIAEMES  147

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            LP R     CPY++KT  CK+G  CKF+HP
Sbjct  148  LPERPREPDCPYFLKTKRCKYGLNCKFNHP  177



>emb|CDP19345.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 134/177 (76%), Gaps = 14/177 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYG TCRYNHPDR  INPP            A +L++G+VNP AS+ QTFDPRL
Sbjct  319  LKTGSCKYGQTCRYNHPDRNAINPPAAAIGAAYIASPAPNLSIGIVNPAASILQTFDPRL  378

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            TQT  G A  IYPQRPG+  CDFYMKTGECKFG+RC+FHHP+D S  + S  E +Q+N K
Sbjct  379  TQTTVGLAAAIYPQRPGEAACDFYMKTGECKFGQRCKFHHPIDRSAPIISGKETQQENVK  438

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELI--GGTSQVTSTSVGEE  256
            L+ AGLPRREGAIHCPYYMKTG CK+GATC+FDHPPPGE++  G T+Q T +  G E
Sbjct  439  LTRAGLPRREGAIHCPYYMKTGTCKYGATCRFDHPPPGEVLAMGTTAQGTWSPTGGE  495


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 75/165 (45%), Gaps = 48/165 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP             +  + P  +L                + + 
Sbjct  197  MKTQRCKFGTRCKFNHP-------------IEKITPLVALETN-------------SAVL  230

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLS----------  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +S         +  KLS          
Sbjct  231  PERPSEPPCAFYMKTGQCKFGATCKFHHPKDLQISTAGQENSFGEQSKLSTNETSGDFKA  290

Query  414  ------------LAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                          GLP R G + CP+Y+KTG CK+G TC+++HP
Sbjct  291  VKPPVTPAMMHNTKGLPIRLGEVDCPFYLKTGSCKYGQTCRYNHP  335


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 72/143 (50%), Gaps = 28/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CKYG +C+++HP               +  P   +     P   +      +   
Sbjct  145  MLTRTCKYGDSCKFDHP---------------IWVPEGGI-----PDWKEVPLVDTSEPL  184

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C F+MKT  CKFG RC+F+HP++    + +         + + A LP R   
Sbjct  185  PERPGEPDCPFFMKTQRCKFGTRCKFNHPIEKITPLVA--------LETNSAVLPERPSE  236

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  237  PPCAFYMKTGQCKFGATCKFHHP  259


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C +YM T  CK+G+ C+F HP+   +      + ++     +   LP R 
Sbjct  131  IYPQRPGEKDCAYYMLTRTCKYGDSCKFDHPI--WVPEGGIPDWKEVPLVDTSEPLPERP  188

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CP++MKT  CKFG  CKF+HP
Sbjct  189  GEPDCPFFMKTQRCKFGTRCKFNHP  213



>ref|XP_006422335.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422336.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422337.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422338.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422339.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422340.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35575.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35576.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35577.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35578.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35579.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35580.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
Length=196

 Score =   234 bits (598),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 134/176 (76%), Gaps = 17/176 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYG+TCRYNHP+R  INPPAA             L + VV+P ASL+QT DPRL
Sbjct  9    LKTGSCKYGSTCRYNHPERTAINPPAAAIVHPLITSPAASLGISVVSPAASLYQTIDPRL  68

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G + ++YPQRPGQ+ECD+YMKTG CKFGE+C+FHHP+D S + T S    Q+  K
Sbjct  69   AQATLGVSPSLYPQRPGQMECDYYMKTGVCKFGEKCKFHHPIDRSAAKTPS----QETVK  124

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS-QVTSTSVGEE  256
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++  ++   TST+VGEE
Sbjct  125  LTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDHPPPGEVMAISALDGTSTAVGEE  180



>ref|XP_002528658.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33724.1| conserved hypothetical protein [Ricinus communis]
Length=500

 Score =   242 bits (618),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 132/177 (75%), Gaps = 14/177 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDR  INPPAA            +LN+G +NP AS++Q   P  
Sbjct  317  LKTGSCKYGATCRYNHPDRNAINPPAAAIGHPLLASPAANLNLGDINPAASIYQAIYPSF  376

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +  M G   TIYPQRPG  ECD+YMKTGECKFGERCRFHHP+D S    ++ + +QQ  K
Sbjct  377  SSPMLGVGPTIYPQRPGHAECDYYMKTGECKFGERCRFHHPIDRS--APTATQAQQQAVK  434

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG  250
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++   SQ TSTS G+ EG
Sbjct  435  LTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDHPPPGEVMAIASQGTSTSAGDVEG  491


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 94/207 (45%), Gaps = 60/207 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CKYG+ C++NHP           L +G                +Q+   FA    
Sbjct  192  LKTQRCKYGSKCKFNHPKD--------ELALGS---------------SQSNDVFA---L  225

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD---------------HSLSVTSSMEGEQQ  430
            P+RP +  C FY KTG CKFG  C+FHHP D                + ++T    G+  
Sbjct  226  PERPSEPICAFYAKTGRCKFGATCKFHHPKDIQIALGQENCNIMQNEAAAMTHGTTGDVN  285

Query  429  NFKLSLA----------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELI  298
              K  ++          GLP R G + CP+Y+KTG CK+GATC+++HP      PP   I
Sbjct  286  AVKACISFNQALLHNSKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHPDRNAINPPAAAI  345

Query  297  GG---TSQVTSTSVGEEEGYAKLVEAI  226
            G     S   + ++G+    A + +AI
Sbjct  346  GHPLLASPAANLNLGDINPAASIYQAI  372


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 72/143 (50%), Gaps = 28/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               V  P   +     P   +      T   
Sbjct  140  MLTRTCKFGDSCKFDHP---------------VWVPEGGI-----PNWKEVPLAATTEPL  179

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CK+G +C+F+HP D  L++ SS   +       +  LP R   
Sbjct  180  PERPGEPDCPYFLKTQRCKYGSKCKFNHPKDE-LALGSSQSND-------VFALPERPSE  231

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y KTG CKFGATCKF HP
Sbjct  232  PICAFYAKTGRCKFGATCKFHHP  254


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 61/102 (60%), Gaps = 13/102 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-LSLAG---  406
            +IYPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   N+K + LA    
Sbjct  125  SIYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPV-------WVPEGGIPNWKEVPLAATTE  177

Query  405  -LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQ  283
             LP R G   CPY++KT  CK+G+ CKF+H P  EL  G+SQ
Sbjct  178  PLPERPGEPDCPYFLKTQRCKYGSKCKFNH-PKDELALGSSQ  218



>ref|XP_004251961.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Solanum lycopersicum]
Length=495

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 131/168 (78%), Gaps = 8/168 (5%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDR-------YTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMF  586
            LKTGSCKYG TCRY+HP+R         +  PA H N+G+VNP ASLFQ FDPRLT TM 
Sbjct  318  LKTGSCKYGGTCRYSHPERNGVGIGPALVASPATHWNIGMVNPAASLFQNFDPRLTHTML  377

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG  406
            G    +YPQRPGQVECDFYMKTGECK+GE+C+FHHPLD S S  S  + +Q N KL+LAG
Sbjct  378  GVLPPVYPQRPGQVECDFYMKTGECKYGEKCKFHHPLDRSASAVSVKDVQQPNVKLTLAG  437

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSV  265
            LPRREGA+ CPYYMKTG+CK+GA+CKFDHPPPGE++G  TSQ  S SV
Sbjct  438  LPRREGAVLCPYYMKTGMCKYGASCKFDHPPPGEVLGMTTSQGASLSV  485


 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 78/165 (47%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP   T     AHL   V NP  S                     
Sbjct  195  VKTKKCKFGDRCKFNHPKDNT-----AHLG-SVQNPGVSDL-------------------  229

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG-------------EQQNF  424
            P+RP + +C FYMKTG CKFG  C+FHHP D  L   +   G             E  N 
Sbjct  230  PERPSEQQCTFYMKTGTCKFGATCKFHHPRDIQLPSPTQKNGSVGKLGSANYEMTEDVNL  289

Query  423  --KLSLA-------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               LS+A       GLP R G + CP+Y+KTG CK+G TC++ HP
Sbjct  290  VKPLSVAALLHNSKGLPIRPGEVDCPFYLKTGSCKYGGTCRYSHP  334


 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 78/143 (55%), Gaps = 29/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               +  P   +     P   +     +T   
Sbjct  145  MQTRTCKFGDSCKFDHP---------------IWVPEGGI-----PNWKEVPV--STESL  182

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG+RC+F+HP D++  +     G  QN  +S   LP R   
Sbjct  183  PERPGEPDCPYFVKTKKCKFGDRCKFNHPKDNTAHL-----GSVQNPGVS--DLPERPSE  235

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  236  QQCTFYMKTGTCKFGATCKFHHP  258


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 16/123 (13%)
 Frame = -2

Query  669  AAHLNVGVVNPTASLFQTFDPRLTQTMFGFAT--TIYPQRPGQVECDFYMKTGECKFGER  496
             AH  +G     A  + + +P   +  F  A+  +IYPQRPG+ +C  YM+T  CKFG+ 
Sbjct  100  GAHNTIG----QAEAWCSANPLAKRPRFESASNLSIYPQRPGEKDCAHYMQTRTCKFGDS  155

Query  495  CRFHHPLDHSLSVTSSMEGEQQNFK---LSLAGLPRREGAIHCPYYMKTGICKFGATCKF  325
            C+F HP+          EG   N+K   +S   LP R G   CPY++KT  CKFG  CKF
Sbjct  156  CKFDHPI-------WVPEGGIPNWKEVPVSTESLPERPGEPDCPYFVKTKKCKFGDRCKF  208

Query  324  DHP  316
            +HP
Sbjct  209  NHP  211



>ref|XP_010313972.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Solanum lycopersicum]
Length=497

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 131/168 (78%), Gaps = 8/168 (5%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDR-------YTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMF  586
            LKTGSCKYG TCRY+HP+R         +  PA H N+G+VNP ASLFQ FDPRLT TM 
Sbjct  320  LKTGSCKYGGTCRYSHPERNGVGIGPALVASPATHWNIGMVNPAASLFQNFDPRLTHTML  379

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG  406
            G    +YPQRPGQVECDFYMKTGECK+GE+C+FHHPLD S S  S  + +Q N KL+LAG
Sbjct  380  GVLPPVYPQRPGQVECDFYMKTGECKYGEKCKFHHPLDRSASAVSVKDVQQPNVKLTLAG  439

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSV  265
            LPRREGA+ CPYYMKTG+CK+GA+CKFDHPPPGE++G  TSQ  S SV
Sbjct  440  LPRREGAVLCPYYMKTGMCKYGASCKFDHPPPGEVLGMTTSQGASLSV  487


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 79/166 (48%), Gaps = 47/166 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV-NPTASLFQTFDPRLTQTMFGFATTI  568
            +KT  CK+G  C++NHP   T     AHL  G V NP  S                    
Sbjct  195  VKTKKCKFGDRCKFNHPKDNT-----AHLFQGSVQNPGVSDL------------------  231

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG-------------EQQN  427
             P+RP + +C FYMKTG CKFG  C+FHHP D  L   +   G             E  N
Sbjct  232  -PERPSEQQCTFYMKTGTCKFGATCKFHHPRDIQLPSPTQKNGSVGKLGSANYEMTEDVN  290

Query  426  F--KLSLA-------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                LS+A       GLP R G + CP+Y+KTG CK+G TC++ HP
Sbjct  291  LVKPLSVAALLHNSKGLPIRPGEVDCPFYLKTGSCKYGGTCRYSHP  336


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 79/143 (55%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               +  P   +     P   +     +T   
Sbjct  145  MQTRTCKFGDSCKFDHP---------------IWVPEGGI-----PNWKEVPV--STESL  182

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG+RC+F+HP D++  +    +G  QN  +S   LP R   
Sbjct  183  PERPGEPDCPYFVKTKKCKFGDRCKFNHPKDNTAHL---FQGSVQNPGVS--DLPERPSE  237

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  238  QQCTFYMKTGTCKFGATCKFHHP  260


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 16/123 (13%)
 Frame = -2

Query  669  AAHLNVGVVNPTASLFQTFDPRLTQTMFGFAT--TIYPQRPGQVECDFYMKTGECKFGER  496
             AH  +G     A  + + +P   +  F  A+  +IYPQRPG+ +C  YM+T  CKFG+ 
Sbjct  100  GAHNTIG----QAEAWCSANPLAKRPRFESASNLSIYPQRPGEKDCAHYMQTRTCKFGDS  155

Query  495  CRFHHPLDHSLSVTSSMEGEQQNFK---LSLAGLPRREGAIHCPYYMKTGICKFGATCKF  325
            C+F HP+          EG   N+K   +S   LP R G   CPY++KT  CKFG  CKF
Sbjct  156  CKFDHPI-------WVPEGGIPNWKEVPVSTESLPERPGEPDCPYFVKTKKCKFGDRCKF  208

Query  324  DHP  316
            +HP
Sbjct  209  NHP  211



>ref|XP_002269152.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Vitis vinifera]
 emb|CBI24121.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 139/192 (72%), Gaps = 18/192 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDR  INPPAA            +LNVGVVNP  S+    DPRL
Sbjct  348  LKTGSCKYGATCRYNHPDRNAINPPAAAIGHAIVASPAANLNVGVVNPVTSILHPIDPRL  407

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +QTM G   TIYPQRPGQ+ECDFYMKTGECKFGERC+FHHP+D S    + +   QQN +
Sbjct  408  SQTM-GVGPTIYPQRPGQMECDFYMKTGECKFGERCKFHHPIDRSAPTATKL---QQNIR  463

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEE-EGY  247
            L+LAG PRREG I CP+Y+KTG CK+G TCKFDHPPPGE++   TSQ  STS GEE  G 
Sbjct  464  LTLAGFPRREGTIICPFYLKTGTCKYGVTCKFDHPPPGEVMAMATSQGASTSAGEEANGD  523

Query  246  AKLVEAIQKQQQ  211
             K  E  ++++Q
Sbjct  524  EKEDETAKEEEQ  535


 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 88/179 (49%), Gaps = 54/179 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP    I+  A                   P  T         + 
Sbjct  224  MKTQKCKFGHKCKFNHPKDQIISLGA-------------------PENTDVF------VL  258

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT--SSMEGEQQ-----------NF  424
            P+RP ++ C FY+KTG+CKFG  C+FHHP D  ++ T  ++ +GEQ            + 
Sbjct  259  PERPSELPCAFYVKTGKCKFGATCKFHHPKDIQIASTGKNNADGEQAETGAKGAGTTGDV  318

Query  423  KLSLA----------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIG  295
            KL ++          GLP R G + CP+Y+KTG CK+GATC+++HP      PP   IG
Sbjct  319  KLPVSVTPALVHNSKGLPMRLGEVDCPFYLKTGSCKYGATCRYNHPDRNAINPPAAAIG  377


 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 76/143 (53%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +     A    
Sbjct  172  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PDWKEVPIVAANEFL  211

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            PQRPG+ +C ++MKT +CKFG +C+F+HP D  +S+     G  +N  + +  LP R   
Sbjct  212  PQRPGEPDCPYFMKTQKCKFGHKCKFNHPKDQIISL-----GAPENTDVFV--LPERPSE  264

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
            + C +Y+KTG CKFGATCKF HP
Sbjct  265  LPCAFYVKTGKCKFGATCKFHHP  287


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG--LPR  397
            IYPQRPG+ +C  YM T  CKFG+ C+F HP    + V      + +   +  A   LP+
Sbjct  158  IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHP----IWVPEGGIPDWKEVPIVAANEFLPQ  213

Query  396  REGAIHCPYYMKTGICKFGATCKFDHP  316
            R G   CPY+MKT  CKFG  CKF+HP
Sbjct  214  RPGEPDCPYFMKTQKCKFGHKCKFNHP  240



>ref|XP_011014515.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 37 [Populus euphratica]
Length=530

 Score =   237 bits (605),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 133/180 (74%), Gaps = 16/180 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R  INPPAA            +LN GV NP AS++QT DPRL
Sbjct  353  LKTGSCKYGATCRYNHPERTAINPPAAAIGHPIVAPSLANLNFGVFNPAASIYQTIDPRL  412

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +  M G   T YPQRPGQ ECDFYMKTGECKFGERC+FHHP+D S      ++  QQ  K
Sbjct  413  S--MLGVGPTFYPQRPGQAECDFYMKTGECKFGERCKFHHPIDRSAPTEKQIQ--QQTVK  468

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAK  241
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++  ++ + +  +G E G ++
Sbjct  469  LTLAGLPRREGAVHCPYYMKTGACKYGATCKFDHPPPGEVMAVSTSLDAAVLGAEAGTSQ  528


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 85/180 (47%), Gaps = 56/180 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CKYG  C++NHP           L++G    ++                   +  
Sbjct  229  LKTQRCKYGLNCKFNHPKE--------KLSLGDSENSS------------------VSAL  262

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT-----------SSMEGEQQNFKL  418
            P+RP + +C FYMKTG+CKFG  C+FHHP D  + ++           S ++ E     +
Sbjct  263  PERPSEPQCAFYMKTGKCKFGASCKFHHPKDIQIPLSGLGNDNGVQTDSVVKNEGITGDV  322

Query  417  SL-------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIG  295
            ++              GLP R G + CP+Y+KTG CK+GATC+++HP      PP   IG
Sbjct  323  NVINSPVTPALHHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPERTAINPPAAAIG  382


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 89/178 (50%), Gaps = 32/178 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G TC+++HP               V  P   +     P   +      +  +
Sbjct  177  MLTRTCKFGDTCKFDHP---------------VWVPEGGI-----PDWKEVPLVATSETF  216

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CK+G  C+F+HP +  LS+     G+ +N   S++ LP R   
Sbjct  217  PERPGEPDCPYFLKTQRCKYGLNCKFNHPKE-KLSL-----GDSENS--SVSALPERPSE  268

Query  384  IHCPYYMKTGICKFGATCKFDHPP----PGELIGGTSQVTSTSVGEEEGYAKLVEAIQ  223
              C +YMKTG CKFGA+CKF HP     P   +G  + V + SV + EG    V  I 
Sbjct  269  PQCAFYMKTGKCKFGASCKFHHPKDIQIPLSGLGNDNGVQTDSVVKNEGITGDVNVIN  326


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 2/105 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG+ C+F HP+   +      + ++     +    P R 
Sbjct  163  IYPQRPGEKDCAHYMLTRTCKFGDTCKFDHPV--WVPEGGIPDWKEVPLVATSETFPERP  220

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
            G   CPY++KT  CK+G  CKF+HP     +G +   + +++ E 
Sbjct  221  GEPDCPYFLKTQRCKYGLNCKFNHPKEKLSLGDSENSSVSALPER  265



>emb|CAN72812.1| hypothetical protein VITISV_004748 [Vitis vinifera]
Length=1504

 Score =   247 bits (630),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 121/214 (57%), Positives = 140/214 (65%), Gaps = 37/214 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDR  INPPAA            +LNVGVVNP  S+    DPRL
Sbjct  514  LKTGSCKYGATCRYNHPDRNAINPPAAAIGHAIVASPAANLNVGVVNPVTSILHPIDPRL  573

Query  600  TQTMFGFATTIYPQRPGQVECD-------------------FYMKTGECKFGERCRFHHP  478
            +QTM G   TIYPQRPGQ+ECD                   FYMKTGECKFGERC+FHHP
Sbjct  574  SQTM-GVGPTIYPQRPGQMECDVCLHLLSNFIPTDATFMDEFYMKTGECKFGERCKFHHP  632

Query  477  LDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELI  298
            +D S    + +   QQN +L+LAG PRREG I CP+Y+KTG CK+G TCKFDHPPPGE++
Sbjct  633  IDRSAPTATKL---QQNIRLTLAGFPRREGTIICPFYLKTGTCKYGVTCKFDHPPPGEVM  689

Query  297  G-GTSQVTSTSVGEE-EGYAKLVEAIQKQQQ*TF  202
               TSQ  STS GEE  G  K  E  ++++Q  F
Sbjct  690  AMATSQGASTSAGEEANGDEKEDETAKEEEQFAF  723


 Score =   112 bits (280),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 88/179 (49%), Gaps = 54/179 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP    I+  A                   P  T         + 
Sbjct  390  MKTQKCKFGHKCKFNHPKDQIISLGA-------------------PENTDVF------VL  424

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT--SSMEGEQQ-----------NF  424
            P+RP ++ C FY+KTG+CKFG  C+FHHP D  ++ T  ++ +GEQ            + 
Sbjct  425  PERPSELPCAFYVKTGKCKFGATCKFHHPKDIQIASTGKNNADGEQAETGAKGAGTTGDV  484

Query  423  KLSLA----------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIG  295
            KL ++          GLP R G + CP+Y+KTG CK+GATC+++HP      PP   IG
Sbjct  485  KLPVSVTPALVHNSKGLPMRLGEVDCPFYLKTGSCKYGATCRYNHPDRNAINPPAAAIG  543


 Score = 95.1 bits (235),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 7/88 (8%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            A    PQRPG+ +C ++MKT +CKFG +C+F+HP D  +S+     G  +N  + +  LP
Sbjct  373  ANEFLPQRPGEPDCPYFMKTQKCKFGHKCKFNHPKDQIISL-----GAPENTDVFV--LP  425

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R   + C +Y+KTG CKFGATCKF HP
Sbjct  426  ERPSELPCAFYVKTGKCKFGATCKFHHP  453



>ref|XP_011096138.1| PREDICTED: zinc finger CCCH domain-containing protein 37 [Sesamum 
indicum]
Length=509

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 127/167 (76%), Gaps = 7/167 (4%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------INPPAAHLNVGVVNPTASLFQTFDPRLTQTMFG  583
            LKTGSCKYGATCRYNHPDRY       +  P  H N+GV+ PTASL  +FDPRLTQT  G
Sbjct  310  LKTGSCKYGATCRYNHPDRYAAIASTLLTSPTTHFNLGVIAPTASLLSSFDPRLTQTTLG  369

Query  582  FATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGL  403
               TIYPQRPGQ+ECD+YMKTG CKFG  C+FHHP+D S    S+ E   QN KL+LAGL
Sbjct  370  LGPTIYPQRPGQLECDYYMKTGICKFGYNCKFHHPVDRSAPTASAAESLLQNVKLTLAGL  429

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSV  265
            PRREGAIHCPYYMKTG CK+G+TCKFDHPPPGE++   TSQ  S+S 
Sbjct  430  PRREGAIHCPYYMKTGTCKYGSTCKFDHPPPGEVMAVATSQPGSSSA  476


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 80/171 (47%), Gaps = 35/171 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA----  577
            LKTG CK+G TC+++HP    I      +   V N       T D +  Q  F  A    
Sbjct  241  LKTGKCKFGTTCKFHHPKGVQIQSTGVEMGTEVKN-------TGDAKTGQPPFAPALMHN  293

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG---  406
            +   P RPG+ +C FY+KTG CK+G  CR++HP  ++   ++ +     +F L +     
Sbjct  294  SKGLPVRPGEEDCPFYLKTGSCKYGATCRYNHPDRYAAIASTLLTSPTTHFNLGVIAPTA  353

Query  405  ---------------------LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                                  P+R G + C YYMKTGICKFG  CKF HP
Sbjct  354  SLLSSFDPRLTQTTLGLGPTIYPQRPGQLECDYYMKTGICKFGYNCKFHHP  404


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 78/159 (49%), Gaps = 44/159 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G  C++NHP DR  I PP A  +  ++                         
Sbjct  196  LKTQRCKFGIRCKFNHPKDR--IAPPGAPEDGDIL-------------------------  228

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHP-----------LDHSLSVTSSMEGEQQNFK  421
             P+RP +  C FY+KTG+CKFG  C+FHHP           +   +  T   +  Q  F 
Sbjct  229  -PERPSEPPCAFYLKTGKCKFGTTCKFHHPKGVQIQSTGVEMGTEVKNTGDAKTGQPPFA  287

Query  420  LSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             +L     GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  288  PALMHNSKGLPVRPGEEDCPFYLKTGSCKYGATCRYNHP  326


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C +YM+T  CKFG+ C+F HP+         +   ++   +    LP R 
Sbjct  131  IYPQRPGEKDCAYYMQTRTCKFGDSCKFDHPI---WVPEGGIPDWKEVPPVPAESLPERP  187

Query  390  GAIHCPYYMKTGICKFGATCKFDHP-----PPG  307
            G   CPY++KT  CKFG  CKF+HP     PPG
Sbjct  188  GEPDCPYFLKTQRCKFGIRCKFNHPKDRIAPPG  220



>ref|XP_006493723.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
isoform X2 [Citrus sinensis]
Length=420

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 134/176 (76%), Gaps = 17/176 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYG+TCRYNHP+R  INPPAA             L + VV+P ASL+QT DPRL
Sbjct  233  LKTGSCKYGSTCRYNHPERTAINPPAAAIVHPLITSPAASLGISVVSPAASLYQTIDPRL  292

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G + ++YPQRPGQ+ECD+YMKTG CKFGE+C+FHHP+D S + T S    Q+  K
Sbjct  293  AQATLGVSPSLYPQRPGQMECDYYMKTGVCKFGEKCKFHHPIDRSAAKTPS----QETVK  348

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS-QVTSTSVGEE  256
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++  ++   TST+VGEE
Sbjct  349  LTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDHPPPGEVMAISALDGTSTAVGEE  404


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 16/118 (14%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D  +  + S  G+       ++ LP R   
Sbjct  94   PERPGEPDCPYFLKTQRCKFGSKCKFNHPKDKLIGSSDSGNGD-------VSALPERPSE  146

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
              C +Y+K G CKFGATCKFDHP   +L          SVG+E G  +  E++ K  +
Sbjct  147  PPCAFYLKNGTCKFGATCKFDHPKDFQL---------PSVGQENGIGEQNESVIKTDE  195


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 75/169 (44%), Gaps = 51/169 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP    I   ++    G V                       +  
Sbjct  106  LKTQRCKFGSKCKFNHPKDKLIG--SSDSGNGDV-----------------------SAL  140

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG--EQQ-------------  430
            P+RP +  C FY+K G CKFG  C+F HP D  L       G  EQ              
Sbjct  141  PERPSEPPCAFYLKNGTCKFGATCKFDHPKDFQLPSVGQENGIGEQNESVIKTDETTGLL  200

Query  429  NFKLSL-----------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N  +SL            GLP R G + CP+Y+KTG CK+G+TC+++HP
Sbjct  201  NPGMSLFSHAPAMLHNSKGLPIRPGELDCPFYLKTGSCKYGSTCRYNHP  249



>ref|XP_002315096.1| enhancer of AG-4 1 family protein [Populus trichocarpa]
 gb|EEF01267.1| enhancer of AG-4 1 family protein [Populus trichocarpa]
Length=532

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 132/180 (73%), Gaps = 16/180 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R  INPPAA            +LN GV NP AS++QT DPRL
Sbjct  355  LKTGSCKYGATCRYNHPERTAINPPAAAIGHPIVAPSLANLNFGVFNPAASIYQTIDPRL  414

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +  M G   T YPQRPGQ ECDFYMKTGECKFGERC+FHHP+D S      ++  QQ  K
Sbjct  415  S--MLGVGPTFYPQRPGQTECDFYMKTGECKFGERCKFHHPIDRSAPTEKQIQ--QQTVK  470

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAK  241
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++   + + +  +G E G ++
Sbjct  471  LTLAGLPRREGAVHCPYYMKTGACKYGATCKFDHPPPGEVMAVATSLDAAVLGAEAGTSQ  530


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 83/180 (46%), Gaps = 56/180 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CKYG  C++NHP           L++G    ++                   +  
Sbjct  231  LKTQRCKYGLNCKFNHPKE--------KLSLGDSENSS------------------VSAL  264

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT-----------SSMEGEQQNFKL  418
            P+RP +  C FYMKTG+CKFG  C+FHHP D  + ++           S ++ E     +
Sbjct  265  PERPSEPPCAFYMKTGKCKFGASCKFHHPKDIQIPLSGLGNDNGVQTDSVVKNEGITGDV  324

Query  417  SL-------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIG  295
             +              GLP R G + CP+Y+KTG CK+GATC+++HP      PP   IG
Sbjct  325  DVIYSPVTPALHHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPERTAINPPAAAIG  384


 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 90/177 (51%), Gaps = 32/177 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G TC+++HP               V  P   +     P   +      +  +
Sbjct  179  MLTRTCKFGDTCKFDHP---------------VWVPEGGI-----PDWKEVPLIATSETF  218

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CK+G  C+F+HP +  LS+     G+ +N   S++ LP R   
Sbjct  219  PERPGEPDCPYFLKTQRCKYGLNCKFNHPKE-KLSL-----GDSENS--SVSALPERPSE  270

Query  384  IHCPYYMKTGICKFGATCKFDHPP----PGELIGGTSQVTSTSVGEEEGYAKLVEAI  226
              C +YMKTG CKFGA+CKF HP     P   +G  + V + SV + EG    V+ I
Sbjct  271  PPCAFYMKTGKCKFGASCKFHHPKDIQIPLSGLGNDNGVQTDSVVKNEGITGDVDVI  327


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 2/105 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG+ C+F HP+   +      + ++     +    P R 
Sbjct  165  IYPQRPGEKDCAHYMLTRTCKFGDTCKFDHPV--WVPEGGIPDWKEVPLIATSETFPERP  222

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
            G   CPY++KT  CK+G  CKF+HP     +G +   + +++ E 
Sbjct  223  GEPDCPYFLKTQRCKYGLNCKFNHPKEKLSLGDSENSSVSALPER  267



>ref|XP_006344928.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
[Solanum tuberosum]
Length=494

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 129/167 (77%), Gaps = 10/167 (6%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT-------INPPAAHLNVGVVNPTASLFQTFDPRLTQTMF  586
            LKTGSCKYG TCRY+HP+R         +  PA H N+G+VNP ASL Q FDPRLT TM 
Sbjct  321  LKTGSCKYGGTCRYSHPERNAAGIGPTLVASPATHWNIGMVNPAASLLQNFDPRLTHTML  380

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG  406
            G    +YPQRPGQ+ECDFYMKTGECK+GE+C+FHHPLD S S  S +  +Q N KL+LAG
Sbjct  381  GLLPPVYPQRPGQIECDFYMKTGECKYGEKCKFHHPLDRSASAVSDV--QQPNVKLTLAG  438

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
            LPRREGA+HCPYYMKT +CK+GA+CKFDHPPPGE++ G +Q  S SV
Sbjct  439  LPRREGAVHCPYYMKTSMCKYGASCKFDHPPPGEVL-GMAQGASLSV  484


 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 74/165 (45%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  CR+NHP   T     AHL   V NP  S                     
Sbjct  198  VKTQKCKFGNRCRFNHPKDNT-----AHLG-SVQNPGVSDL-------------------  232

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG-------------EQQNF  424
            P+RP + +C FYM TG CKFG  C+FHHP D      +   G             E  N 
Sbjct  233  PERPSEQQCTFYMNTGTCKFGATCKFHHPRDIQFPSPTQENGSVGKLGSANYEMTEDVNL  292

Query  423  KLSLA---------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               L+         GLP R G + CP+Y+KTG CK+G TC++ HP
Sbjct  293  VKPLSVPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGGTCRYSHP  337


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 77/143 (54%), Gaps = 29/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP      P     N   V           P  T+++        
Sbjct  148  MQTRTCKFGDSCKFDHP---IWVPEGGIPNWKEV-----------PVTTESL--------  185

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG RCRF+HP D++  +     G  QN  +S   LP R   
Sbjct  186  PERPGEPDCPYFVKTQKCKFGNRCRFNHPKDNTAHL-----GSVQNPGVS--DLPERPSE  238

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YM TG CKFGATCKF HP
Sbjct  239  QQCTFYMNTGTCKFGATCKFHHP  261


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 16/123 (13%)
 Frame = -2

Query  669  AAHLNVGVVNPTASLFQTFDPRLTQTMFGFAT--TIYPQRPGQVECDFYMKTGECKFGER  496
             AH  +G     A  + + +P   +  F  A+  +IYPQRPG+ +C  YM+T  CKFG+ 
Sbjct  103  GAHNTIG----QAEAWFSANPLAKRPRFESASNLSIYPQRPGEKDCAHYMQTRTCKFGDS  158

Query  495  CRFHHPLDHSLSVTSSMEGEQQNFK---LSLAGLPRREGAIHCPYYMKTGICKFGATCKF  325
            C+F HP+          EG   N+K   ++   LP R G   CPY++KT  CKFG  C+F
Sbjct  159  CKFDHPI-------WVPEGGIPNWKEVPVTTESLPERPGEPDCPYFVKTQKCKFGNRCRF  211

Query  324  DHP  316
            +HP
Sbjct  212  NHP  214



>ref|XP_006493722.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
isoform X1 [Citrus sinensis]
 gb|KDO61503.1| hypothetical protein CISIN_1g040937mg [Citrus sinensis]
Length=508

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 134/176 (76%), Gaps = 17/176 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYG+TCRYNHP+R  INPPAA             L + VV+P ASL+QT DPRL
Sbjct  321  LKTGSCKYGSTCRYNHPERTAINPPAAAIVHPLITSPAASLGISVVSPAASLYQTIDPRL  380

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G + ++YPQRPGQ+ECD+YMKTG CKFGE+C+FHHP+D S + T S    Q+  K
Sbjct  381  AQATLGVSPSLYPQRPGQMECDYYMKTGVCKFGEKCKFHHPIDRSAAKTPS----QETVK  436

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS-QVTSTSVGEE  256
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++  ++   TST+VGEE
Sbjct  437  LTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDHPPPGEVMAISALDGTSTAVGEE  492


 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 89/178 (50%), Gaps = 36/178 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G TC+++HP               +  P   +     P   +     ++   
Sbjct  142  MQTRTCKFGDTCKFDHP---------------IWVPEGGI-----PDWKEVPVIASSESL  181

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D  +  + S  G+       ++ LP R   
Sbjct  182  PERPGEPDCPYFLKTQRCKFGSKCKFNHPKDKLIGSSDSGNGD-------VSALPERPSE  234

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
              C +Y+K G CKFGATCKFDHP   +L          SVG+E G  +  E++ K  +
Sbjct  235  PPCAFYLKNGTCKFGATCKFDHPKDFQL---------PSVGQENGIGEQNESVIKTDE  283


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 77/170 (45%), Gaps = 53/170 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G+ C++NHP D+   +  + + +V  +                         
Sbjct  194  LKTQRCKFGSKCKFNHPKDKLIGSSDSGNGDVSAL-------------------------  228

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG--EQQ------------  430
             P+RP +  C FY+K G CKFG  C+F HP D  L       G  EQ             
Sbjct  229  -PERPSEPPCAFYLKNGTCKFGATCKFDHPKDFQLPSVGQENGIGEQNESVIKTDETTGL  287

Query  429  -NFKLSL-----------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             N  +SL            GLP R G + CP+Y+KTG CK+G+TC+++HP
Sbjct  288  LNPGMSLFSHAPAMLHNSKGLPIRPGELDCPFYLKTGSCKYGSTCRYNHP  337


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            +YPQRPG+ +C +YM+T  CKFG+ C+F HP+          EG   ++K      S   
Sbjct  128  VYPQRPGEKDCAYYMQTRTCKFGDTCKFDHPI-------WVPEGGIPDWKEVPVIASSES  180

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
            LP R G   CPY++KT  CKFG+ CKF+H P  +LIG +
Sbjct  181  LPERPGEPDCPYFLKTQRCKFGSKCKFNH-PKDKLIGSS  218



>ref|XP_007022804.1| Floral homeotic protein isoform 5 [Theobroma cacao]
 gb|EOY14329.1| Floral homeotic protein isoform 5 [Theobroma cacao]
Length=401

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 135/181 (75%), Gaps = 23/181 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA-----------HLNVGVVNPTASLFQTFDPRLT  598
            LKTGSCKYG++CRYNHPDR   NPPAA           +LN+GVV P AS++QT DPRL 
Sbjct  200  LKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVASASNLNIGVVTPAASIYQTIDPRLG  259

Query  597  QTMF---------GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            Q+           G A T+YPQRPGQ EC++YMKTG+CKFG+RC+FHHP+D S+S T   
Sbjct  260  QSTLLAQPTFPTLGVAPTVYPQRPGQTECEYYMKTGDCKFGDRCKFHHPIDRSVSKTK--  317

Query  444  EGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTS  268
            +  +Q  KL+LAGLPRREG +HCPYYMKTG CK+GATCKFDHPPPGE++G  T+Q TST+
Sbjct  318  QTSEQAVKLTLAGLPRREGGVHCPYYMKTGTCKYGATCKFDHPPPGEVMGIATAQGTSTT  377

Query  267  V  265
            V
Sbjct  378  V  378


 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 97/200 (49%), Gaps = 52/200 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G+ C++NHP D+  I+    ++ V V+                         
Sbjct  82   LKTQRCKFGSKCKFNHPKDKLAISGAFENIQVAVL-------------------------  116

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS-------------VTSSMEGEQQN  427
             P+RP +  C FY+KTG+CKFG  C+FHHP D  ++             + +   G   +
Sbjct  117  -PERPSEPSCSFYVKTGKCKFGATCKFHHPKDIQIASSGQDNARGEQPEIVTKTGGATAD  175

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIGGT--SQ  283
             K +L     GLP R   + CP+Y+KTG CK+G++C+++HP      PP  ++G +  + 
Sbjct  176  VKPALFHNSKGLPIRPDEVDCPFYLKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVAS  235

Query  282  VTSTSVGEEEGYAKLVEAIQ  223
             ++ ++G     A + + I 
Sbjct  236  ASNLNIGVVTPAASIYQTID  255


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 7/83 (8%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C +++KT  CKFG +C+F+HP D  L+++ + E  Q      +A LP R   
Sbjct  70   PERAGEPDCPYFLKTQRCKFGSKCKFNHPKD-KLAISGAFENIQ------VAVLPERPSE  122

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CKFGATCKF HP
Sbjct  123  PSCSFYVKTGKCKFGATCKFHHP  145



>gb|KHN38167.1| Zinc finger CCCH domain-containing protein 37 [Glycine soja]
Length=371

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 132/180 (73%), Gaps = 19/180 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCKYG TCRYNHPDR  INPP            AA+LN+G++NP  S++Q F+PRL
Sbjct  187  MKTGSCKYGVTCRYNHPDRNAINPPIAGLGASIFPSSAANLNIGLLNPAVSVYQAFEPRL  246

Query  600  TQTM--FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
            +  M   G A TIYPQRPGQ+ECDFYMKTGECKFGERC++HHP+D S    S    +Q  
Sbjct  247  SNPMSQVGIADTIYPQRPGQIECDFYMKTGECKFGERCKYHHPIDRSAPSLS----KQAT  302

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEG  250
             KL+ AGLPRREGA+ CPYY+KTG CKFGATCKFDHPPPGE++    SQ TS + GE EG
Sbjct  303  VKLTPAGLPRREGAVICPYYLKTGTCKFGATCKFDHPPPGEVMEMAKSQGTSANGGEAEG  362


 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 80/166 (48%), Gaps = 53/166 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP   + N   A ++ G+                           
Sbjct  68   LKTQRCKFGSKCKFNHPKVSSEN---ADVSSGL---------------------------  97

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS----SMEGEQQNFKLSLA----  409
            P+RP +  C FYMKTG+C++G  C+FHHP D  + +++    ++   Q N  +  A    
Sbjct  98   PERPSEPPCAFYMKTGKCRYGAACKFHHPKDIQIQLSNDSSQTVAQTQTNSIMGWATGDT  157

Query  408  ---------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           GLP R G + CP+YMKTG CK+G TC+++HP
Sbjct  158  QPIQSLISPSLQNSKGLPVRLGEVDCPFYMKTGSCKYGVTCRYNHP  203


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 69/143 (48%), Gaps = 33/143 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP             V +V                      +   
Sbjct  17   MLTRTCKFGDSCKFDHPFWVPEGGIPDWKEVPIVT---------------------SETP  55

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP   S           +N  +S +GLP R   
Sbjct  56   PERPGEPDCPYFLKTQRCKFGSKCKFNHPKVSS-----------ENADVS-SGLPERPSE  103

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG C++GA CKF HP
Sbjct  104  PPCAFYMKTGKCRYGAACKFHHP  126


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 52/90 (58%), Gaps = 11/90 (12%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAG  406
            TIYPQRPG+ +C  YM T  CKFG+ C+F HP           EG   ++K    ++   
Sbjct  2    TIYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPF-------WVPEGGIPDWKEVPIVTSET  54

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             P R G   CPY++KT  CKFG+ CKF+HP
Sbjct  55   PPERPGEPDCPYFLKTQRCKFGSKCKFNHP  84



>ref|XP_007022800.1| Floral homeotic protein isoform 1 [Theobroma cacao]
 gb|EOY14325.1| Floral homeotic protein isoform 1 [Theobroma cacao]
Length=489

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 135/181 (75%), Gaps = 23/181 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA-----------HLNVGVVNPTASLFQTFDPRLT  598
            LKTGSCKYG++CRYNHPDR   NPPAA           +LN+GVV P AS++QT DPRL 
Sbjct  288  LKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVASASNLNIGVVTPAASIYQTIDPRLG  347

Query  597  QTMF---------GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            Q+           G A T+YPQRPGQ EC++YMKTG+CKFG+RC+FHHP+D S+S T   
Sbjct  348  QSTLLAQPTFPTLGVAPTVYPQRPGQTECEYYMKTGDCKFGDRCKFHHPIDRSVSKTK--  405

Query  444  EGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTS  268
            +  +Q  KL+LAGLPRREG +HCPYYMKTG CK+GATCKFDHPPPGE++G  T+Q TST+
Sbjct  406  QTSEQAVKLTLAGLPRREGGVHCPYYMKTGTCKYGATCKFDHPPPGEVMGIATAQGTSTT  465

Query  267  V  265
            V
Sbjct  466  V  466


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 94/184 (51%), Gaps = 50/184 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G+ C++NHP D+  I+    ++ V V+                         
Sbjct  170  LKTQRCKFGSKCKFNHPKDKLAISGAFENIQVAVL-------------------------  204

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT--SSMEGEQ-----------QN  427
             P+RP +  C FY+KTG+CKFG  C+FHHP D  ++ +   +  GEQ            +
Sbjct  205  -PERPSEPSCSFYVKTGKCKFGATCKFHHPKDIQIASSGQDNARGEQPEIVTKTGGATAD  263

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIGGTSQVT  277
             K +L     GLP R   + CP+Y+KTG CK+G++C+++HP      PP  ++G +   +
Sbjct  264  VKPALFHNSKGLPIRPDEVDCPFYLKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVAS  323

Query  276  STSV  265
            ++++
Sbjct  324  ASNL  327


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 74/143 (52%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  118  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PDWKEVPLATTSESL  157

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C +++KT  CKFG +C+F+HP D  L+++ + E  Q      +A LP R   
Sbjct  158  PERAGEPDCPYFLKTQRCKFGSKCKFNHPKD-KLAISGAFENIQ------VAVLPERPSE  210

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CKFGATCKF HP
Sbjct  211  PSCSFYVKTGKCKFGATCKFHHP  233


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 57/106 (54%), Gaps = 2/106 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG+ C+F HP+   +      + ++     +   LP R 
Sbjct  104  IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPI--WVPEGGIPDWKEVPLATTSESLPERA  161

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
            G   CPY++KT  CKFG+ CKF+HP     I G  +    +V  E 
Sbjct  162  GEPDCPYFLKTQRCKFGSKCKFNHPKDKLAISGAFENIQVAVLPER  207



>ref|XP_010924870.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Elaeis guineensis]
Length=549

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 132/193 (68%), Gaps = 19/193 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP-------------AAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYGATCRYNHPDR +INPP             A +L  GV+NP ASL Q  + +
Sbjct  357  LKTGSCKYGATCRYNHPDRSSINPPLASALGQAVIPSPATNLPFGVLNPAASLLQNINLQ  416

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
              Q   G   TIYPQRPG++ECDFYMKTG+CKFGERC+FHHP+D S   +   +  QQN 
Sbjct  417  SAQASLGVVPTIYPQRPGEIECDFYMKTGQCKFGERCKFHHPIDRSAPSSDVKQSLQQNV  476

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELI------GGTSQVTSTSVG  262
            KL+LAGLPRREGA+ C +YMKTG CKFGATCKFDHPPPGE I      G  + V++T  G
Sbjct  477  KLTLAGLPRREGAVICSFYMKTGTCKFGATCKFDHPPPGEAIAMATGSGTATGVSATDGG  536

Query  261  EEEGYAKLVEAIQ  223
            E +  A L E +Q
Sbjct  537  ENKAAAALAEGLQ  549


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 79/163 (48%), Gaps = 30/163 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  176  MLTRTCKFGNSCKFDHP---------------IWVPEGGI-----PDWKEVPLVPTSESL  215

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ EC +YMKT +CKFG RC+F+HP D   +    + GE  +  +    LP R   
Sbjct  216  PERPGEPECPYYMKTQKCKFGSRCKFNHPKDILNASAGEVGGEGPDNSV----LPERPSE  271

Query  384  IHCPYYMKTGICKFGATCKFDH------PPPGELIGGTSQVTS  274
              C +YMKTG CKFG  CKF H      PP GE  G T QV S
Sbjct  272  PFCSFYMKTGKCKFGPNCKFHHPKDLQIPPNGEDTGNTGQVES  314


 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 80/168 (48%), Gaps = 47/168 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G+ C++NHP +  +N  A    VG   P  S                   + 
Sbjct  228  MKTQKCKFGSRCKFNHP-KDILNASAGE--VGGEGPDNS-------------------VL  265

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------SVTSSMEGEQQN-------  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +         T  +E E+ +       
Sbjct  266  PERPSEPFCSFYMKTGKCKFGPNCKFHHPKDLQIPPNGEDTGNTGQVESEKDDGAAGDPK  325

Query  426  -----------FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                          +  GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  326  PANGHVPITPALLHNSKGLPIRPGETDCPFYLKTGSCKYGATCRYNHP  373


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 62/125 (50%), Gaps = 11/125 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++     +   LP R 
Sbjct  162  IYPQRPGEKDCTHYMLTRTCKFGNSCKFDHPI--WVPEGGIPDWKEVPLVPTSESLPERP  219

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
            G   CPYYMKT  CKFG+ CKF+HP           + + S GE  G       + ++  
Sbjct  220  GEPECPYYMKTQKCKFGSRCKFNHP---------KDILNASAGEVGGEGPDNSVLPERPS  270

Query  210  *TFCS  196
              FCS
Sbjct  271  EPFCS  275



>ref|XP_006585719.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
[Glycine max]
Length=508

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 132/180 (73%), Gaps = 19/180 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCKYG TCRYNHPDR  INPP            AA+LN+G++NP  S++Q F+PRL
Sbjct  324  MKTGSCKYGVTCRYNHPDRNAINPPIAGLGASIFPSSAANLNIGLLNPAVSVYQAFEPRL  383

Query  600  TQTM--FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
            +  M   G A TIYPQRPGQ+ECDFYMKTGECKFGERC++HHP+D S    S    +Q  
Sbjct  384  SNPMSQVGIADTIYPQRPGQIECDFYMKTGECKFGERCKYHHPIDRSAPSLS----KQAT  439

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEG  250
             KL+ AGLPRREGA+ CPYY+KTG CKFGATCKFDHPPPGE++    SQ TS + GE EG
Sbjct  440  VKLTPAGLPRREGAVICPYYLKTGTCKFGATCKFDHPPPGEVMEMAKSQGTSANGGEAEG  499


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 80/166 (48%), Gaps = 53/166 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP   + N   A ++ G+                           
Sbjct  205  LKTQRCKFGSKCKFNHPKVSSEN---ADVSSGL---------------------------  234

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS----SMEGEQQNFKLSLA----  409
            P+RP +  C FYMKTG+C++G  C+FHHP D  + +++    ++   Q N  +  A    
Sbjct  235  PERPSEPPCAFYMKTGKCRYGAACKFHHPKDIQIQLSNDSSQTVAQTQTNSIMGWATGDT  294

Query  408  ---------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           GLP R G + CP+YMKTG CK+G TC+++HP
Sbjct  295  PPIQSLISPSLQNSKGLPVRLGEVDCPFYMKTGSCKYGVTCRYNHP  340


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 52/90 (58%), Gaps = 11/90 (12%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAG  406
            TIYPQRPG+ +C  YM T  CKFG+ C+F HP           EG   ++K    ++   
Sbjct  139  TIYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPF-------WVPEGGIPDWKEVPIVTSET  191

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             P R G   CPY++KT  CKFG+ CKF+HP
Sbjct  192  PPERPGEPDCPYFLKTQRCKFGSKCKFNHP  221


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (50%), Gaps = 33/143 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP             V +V                      +   
Sbjct  154  MLTRTCKFGDSCKFDHPFWVPEGGIPDWKEVPIVT---------------------SETP  192

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP      V+S      +N  +S +GLP R   
Sbjct  193  PERPGEPDCPYFLKTQRCKFGSKCKFNHP-----KVSS------ENADVS-SGLPERPSE  240

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG C++GA CKF HP
Sbjct  241  PPCAFYMKTGKCRYGAACKFHHP  263



>ref|XP_007133464.1| hypothetical protein PHAVU_011G180700g [Phaseolus vulgaris]
 gb|ESW05458.1| hypothetical protein PHAVU_011G180700g [Phaseolus vulgaris]
Length=484

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 131/179 (73%), Gaps = 19/179 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCKYGATCRYNHPDR  INPP            AA LN+G+++P  S++Q FDPRL
Sbjct  309  MKTGSCKYGATCRYNHPDRNAINPPIAGLGASILPSSAASLNIGLLSPAVSVYQAFDPRL  368

Query  600  TQTM--FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
            +  M   G A +IYPQRPGQ+ECDFYMKTGECKFGERC++HHP+D S    S    +Q +
Sbjct  369  SNPMSQVGIAESIYPQRPGQIECDFYMKTGECKFGERCKYHHPIDRSAPSLS----KQAS  424

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEE  253
             KL+ AGLPRREGA+ CPYY+KTG CKFGATCKFDHPPPGE++    SQ TS   GE E
Sbjct  425  VKLTPAGLPRREGAVICPYYLKTGTCKFGATCKFDHPPPGEVVEMAKSQGTSADGGEAE  483


 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 82/166 (49%), Gaps = 53/166 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP   + N     ++ G+                           
Sbjct  190  LKTQRCKFGSKCKFNHPMVSSEN---EDISSGL---------------------------  219

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV------------TSSME----GEQ  433
            P+RP +  C FYMKTG+CKFG  C+FHHP D  + +            TSSM     G+ 
Sbjct  220  PERPSEPPCTFYMKTGKCKFGAACKFHHPKDIQIQLSDEFSHTAAQTETSSMIGGAFGDI  279

Query  432  QNFKLSLA-------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            Q  K  ++       GLP R G + CP+YMKTG CK+GATC+++HP
Sbjct  280  QPIKSLISPSLQNSKGLPVRLGEVDCPFYMKTGSCKYGATCRYNHP  325


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 72/143 (50%), Gaps = 32/143 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               V  P   +     P   +      +   
Sbjct  138  MLTRTCKFGDSCKFDHP---------------VWVPEGGI-----PDWKEVPNVVTSETP  177

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP+  S           +N  +S +GLP R   
Sbjct  178  PERPGEPDCPYFLKTQRCKFGSKCKFNHPMVSS-----------ENEDIS-SGLPERPSE  225

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGA CKF HP
Sbjct  226  PPCTFYMKTGKCKFGAACKFHHP  248


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 12/91 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLA  409
            TIYPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   ++K     ++  
Sbjct  123  TIYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPV-------WVPEGGIPDWKEVPNVVTSE  175

Query  408  GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              P R G   CPY++KT  CKFG+ CKF+HP
Sbjct  176  TPPERPGEPDCPYFLKTQRCKFGSKCKFNHP  206



>gb|KHN35319.1| Zinc finger CCCH domain-containing protein 37 [Glycine soja]
Length=369

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 134/187 (72%), Gaps = 19/187 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCKYG +CRYNHPDR  INPP            AA+LN+G++NP  S +Q F+PRL
Sbjct  188  MKTGSCKYGVSCRYNHPDRNAINPPIAGLGASILPSSAANLNIGLLNPAVSAYQAFEPRL  247

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS-LSVTSSMEGEQQNF  424
            +  M G A TIYPQRPGQ+ECDFYMKTG CKFGERC++HHP+D S LS++     +Q   
Sbjct  248  SNPMVGIAETIYPQRPGQIECDFYMKTGVCKFGERCKYHHPIDRSALSLS-----KQATV  302

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGY  247
            KL+ AGLPRREG + CPYY+KTG CKFGATCKFDHPPPGE++    SQ TS +  E EG 
Sbjct  303  KLTPAGLPRREGDVICPYYLKTGTCKFGATCKFDHPPPGEVMEMAKSQGTSANGEEAEGD  362

Query  246  AKLVEAI  226
               +E +
Sbjct  363  TSALEQL  369


 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 53/166 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP   + N   A ++ G+                           
Sbjct  69   LKTQRCKFGSKCKFNHPKVSSEN---ADVSSGL---------------------------  98

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME----------------GEQ  433
            P+RP +  C FYMKTG+C++G  C+FHHP D  + ++  +                 G+ 
Sbjct  99   PERPSEPPCAFYMKTGKCRYGTACKFHHPKDIQIQLSDDLSQNVAQTQTNSMMGGATGDT  158

Query  432  QNFKLSLA-------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            Q  K  ++       GLP R G + CP+YMKTG CK+G +C+++HP
Sbjct  159  QPIKSLISPSLQNSKGLPVRLGEVDCPFYMKTGSCKYGVSCRYNHP  204


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 32/143 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               V  P   +     P   +      +   
Sbjct  17   MLTRTCKFGDSCKFDHP---------------VWVPEGGI-----PDWKEVPNVVTSETP  56

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP      V+S      +N  +S +GLP R   
Sbjct  57   PERPGEPDCPYFLKTQRCKFGSKCKFNHP-----KVSS------ENADVS-SGLPERPSE  104

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG C++G  CKF HP
Sbjct  105  PPCAFYMKTGKCRYGTACKFHHP  127


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 12/91 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLA  409
            TIYPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   ++K     ++  
Sbjct  2    TIYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPV-------WVPEGGIPDWKEVPNVVTSE  54

Query  408  GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              P R G   CPY++KT  CKFG+ CKF+HP
Sbjct  55   TPPERPGEPDCPYFLKTQRCKFGSKCKFNHP  85



>gb|EYU27607.1| hypothetical protein MIMGU_mgv1a0053432mg, partial [Erythranthe 
guttata]
 gb|EYU27608.1| hypothetical protein MIMGU_mgv1a0053432mg, partial [Erythranthe 
guttata]
Length=309

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 121/159 (76%), Gaps = 9/159 (6%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------INPPAAHLNVGVVNPTASLFQTFDPRLTQTMFG  583
            LKT SCKYGATCRYNHPDRYT      +  P+AH N GVV PTASL   +DP L QT  G
Sbjct  139  LKTNSCKYGATCRYNHPDRYTAIAPTLMTSPSAHYNYGVVAPTASLLSAYDPMLAQTALG  198

Query  582  FATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDH---SLSVTSSMEGEQQNFKLSL  412
             +   YPQRPGQ+ECD+YMKTG CKFG  C+FHHPLD    S++ T + E  Q+N KL+L
Sbjct  199  LSPAFYPQRPGQLECDYYMKTGICKFGITCKFHHPLDRSTTSVAATYTTESLQENVKLTL  258

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            AGLPRREGAIHCPYYMKTG CKFGATC+FDHPPPGE++ 
Sbjct  259  AGLPRREGAIHCPYYMKTGTCKFGATCRFDHPPPGEVMA  297


 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 88/190 (46%), Gaps = 37/190 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPA----AHLNVGVVNPTASLFQTFDPRLTQTMFGFA  577
            +KTGSCK+G TC+++HP    I P      A +   +V    ++ Q F P L     G  
Sbjct  68   MKTGSCKFGPTCKFHHPKGVPIQPAGEEIGAEVQTSLVGDGKTVQQPFAPALVHNTKGL-  126

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG--------------  439
                P RPG+  C FY+KT  CK+G  CR++HP  ++    + M                
Sbjct  127  ----PIRPGEENCPFYLKTNSCKYGATCRYNHPDRYTAIAPTLMTSPSAHYNYGVVAPTA  182

Query  438  ----------EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
                       Q    LS A  P+R G + C YYMKTGICKFG TCKF HP    L   T
Sbjct  183  SLLSAYDPMLAQTALGLSPAFYPQRPGQLECDYYMKTGICKFGITCKFHHP----LDRST  238

Query  288  SQVTSTSVGE  259
            + V +T   E
Sbjct  239  TSVAATYTTE  248


 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 78/160 (49%), Gaps = 43/160 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G  CR+NHP    +                SL  T D            T  
Sbjct  22   LKTQRCKFGIRCRFNHPKDRIV----------------SLGATED----------DGTYL  55

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL---------DHSLSVTSSMEGE----QQNF  424
            P+RP +  C FYMKTG CKFG  C+FHHP          +    V +S+ G+    QQ F
Sbjct  56   PERPSEPPCAFYMKTGSCKFGPTCKFHHPKGVPIQPAGEEIGAEVQTSLVGDGKTVQQPF  115

Query  423  KLSLA----GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              +L     GLP R G  +CP+Y+KT  CK+GATC+++HP
Sbjct  116  APALVHNTKGLPIRPGEENCPFYLKTNSCKYGATCRYNHP  155


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 14/108 (13%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG  +C +++KT  CKFG RCRF+HP D  +S+ ++ +            LP R   
Sbjct  10   PERPGDPDCPYFLKTQRCKFGIRCRFNHPKDRIVSLGATEDDGTY--------LPERPSE  61

Query  384  IHCPYYMKTGICKFGATCKFDHP------PPGELIGGTSQVTSTSVGE  259
              C +YMKTG CKFG TCKF HP      P GE IG   Q +    G+
Sbjct  62   PPCAFYMKTGSCKFGPTCKFHHPKGVPIQPAGEEIGAEVQTSLVGDGK  109


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 56/107 (52%), Gaps = 18/107 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G TC+++HP DR T +       V     T SL +     +  T+ G     
Sbjct  217  MKTGICKFGITCKFHHPLDRSTTS-------VAATYTTESLQEN----VKLTLAGL----  261

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
             P+R G + C +YMKTG CKFG  CRF HP    +    S E EQQN
Sbjct  262  -PRREGAIHCPYYMKTGTCKFGATCRFDHPPPGEVMAVPSAE-EQQN  306



>ref|XP_010645074.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Vitis vinifera]
Length=554

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 139/211 (66%), Gaps = 37/211 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDR  INPPAA            +LNVGVVNP  S+    DPRL
Sbjct  348  LKTGSCKYGATCRYNHPDRNAINPPAAAIGHAIVASPAANLNVGVVNPVTSILHPIDPRL  407

Query  600  TQTMFGFATTIYPQRPGQVECD-------------------FYMKTGECKFGERCRFHHP  478
            +QTM G   TIYPQRPGQ+ECD                   FYMKTGECKFGERC+FHHP
Sbjct  408  SQTM-GVGPTIYPQRPGQMECDVCLHLLSNFIPTDATFMDEFYMKTGECKFGERCKFHHP  466

Query  477  LDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELI  298
            +D S    + +   QQN +L+LAG PRREG I CP+Y+KTG CK+G TCKFDHPPPGE++
Sbjct  467  IDRSAPTATKL---QQNIRLTLAGFPRREGTIICPFYLKTGTCKYGVTCKFDHPPPGEVM  523

Query  297  G-GTSQVTSTSVGEE-EGYAKLVEAIQKQQQ  211
               TSQ  STS GEE  G  K  E  ++++Q
Sbjct  524  AMATSQGASTSAGEEANGDEKEDETAKEEEQ  554


 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 88/179 (49%), Gaps = 54/179 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP    I+  A                   P  T         + 
Sbjct  224  MKTQKCKFGHKCKFNHPKDQIISLGA-------------------PENTDVF------VL  258

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT--SSMEGEQQ-----------NF  424
            P+RP ++ C FY+KTG+CKFG  C+FHHP D  ++ T  ++ +GEQ            + 
Sbjct  259  PERPSELPCAFYVKTGKCKFGATCKFHHPKDIQIASTGKNNADGEQAETGAKGAGTTGDV  318

Query  423  KLSLA----------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIG  295
            KL ++          GLP R G + CP+Y+KTG CK+GATC+++HP      PP   IG
Sbjct  319  KLPVSVTPALVHNSKGLPMRLGEVDCPFYLKTGSCKYGATCRYNHPDRNAINPPAAAIG  377


 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 76/143 (53%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +     A    
Sbjct  172  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PDWKEVPIVAANEFL  211

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            PQRPG+ +C ++MKT +CKFG +C+F+HP D  +S+     G  +N  + +  LP R   
Sbjct  212  PQRPGEPDCPYFMKTQKCKFGHKCKFNHPKDQIISL-----GAPENTDVFV--LPERPSE  264

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
            + C +Y+KTG CKFGATCKF HP
Sbjct  265  LPCAFYVKTGKCKFGATCKFHHP  287


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG--LPR  397
            IYPQRPG+ +C  YM T  CKFG+ C+F HP    + V      + +   +  A   LP+
Sbjct  158  IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHP----IWVPEGGIPDWKEVPIVAANEFLPQ  213

Query  396  REGAIHCPYYMKTGICKFGATCKFDHP  316
            R G   CPY+MKT  CKFG  CKF+HP
Sbjct  214  RPGEPDCPYFMKTQKCKFGHKCKFNHP  240



>ref|XP_010924871.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Elaeis guineensis]
Length=539

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 129/183 (70%), Gaps = 9/183 (5%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDR---YTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFAT  574
            LKTGSCKYGATCRYNHPDR     I  PA +L  GV+NP ASL Q  + +  Q   G   
Sbjct  357  LKTGSCKYGATCRYNHPDRSCQAVIPSPATNLPFGVLNPAASLLQNINLQSAQASLGVVP  416

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            TIYPQRPG++ECDFYMKTG+CKFGERC+FHHP+D S   +   +  QQN KL+LAGLPRR
Sbjct  417  TIYPQRPGEIECDFYMKTGQCKFGERCKFHHPIDRSAPSSDVKQSLQQNVKLTLAGLPRR  476

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELI------GGTSQVTSTSVGEEEGYAKLVE  232
            EGA+ C +YMKTG CKFGATCKFDHPPPGE I      G  + V++T  GE +  A L E
Sbjct  477  EGAVICSFYMKTGTCKFGATCKFDHPPPGEAIAMATGSGTATGVSATDGGENKAAAALAE  536

Query  231  AIQ  223
             +Q
Sbjct  537  GLQ  539


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 79/163 (48%), Gaps = 30/163 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  176  MLTRTCKFGNSCKFDHP---------------IWVPEGGI-----PDWKEVPLVPTSESL  215

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ EC +YMKT +CKFG RC+F+HP D   +    + GE  +  +    LP R   
Sbjct  216  PERPGEPECPYYMKTQKCKFGSRCKFNHPKDILNASAGEVGGEGPDNSV----LPERPSE  271

Query  384  IHCPYYMKTGICKFGATCKFDH------PPPGELIGGTSQVTS  274
              C +YMKTG CKFG  CKF H      PP GE  G T QV S
Sbjct  272  PFCSFYMKTGKCKFGPNCKFHHPKDLQIPPNGEDTGNTGQVES  314


 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 80/168 (48%), Gaps = 47/168 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G+ C++NHP +  +N  A    VG   P  S                   + 
Sbjct  228  MKTQKCKFGSRCKFNHP-KDILNASAGE--VGGEGPDNS-------------------VL  265

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------SVTSSMEGEQQN-------  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +         T  +E E+ +       
Sbjct  266  PERPSEPFCSFYMKTGKCKFGPNCKFHHPKDLQIPPNGEDTGNTGQVESEKDDGAAGDPK  325

Query  426  -----------FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                          +  GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  326  PANGHVPITPALLHNSKGLPIRPGETDCPFYLKTGSCKYGATCRYNHP  373


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 62/125 (50%), Gaps = 11/125 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++     +   LP R 
Sbjct  162  IYPQRPGEKDCTHYMLTRTCKFGNSCKFDHPI--WVPEGGIPDWKEVPLVPTSESLPERP  219

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
            G   CPYYMKT  CKFG+ CKF+HP           + + S GE  G       + ++  
Sbjct  220  GEPECPYYMKTQKCKFGSRCKFNHP---------KDILNASAGEVGGEGPDNSVLPERPS  270

Query  210  *TFCS  196
              FCS
Sbjct  271  EPFCS  275



>ref|XP_003545729.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
[Glycine max]
Length=507

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 134/187 (72%), Gaps = 19/187 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCKYG +CRYNHPDR  INPP            AA+LN+G++NP  S +Q F+PRL
Sbjct  326  MKTGSCKYGVSCRYNHPDRNAINPPIAGLGASILPSSAANLNIGLLNPAVSAYQAFEPRL  385

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS-LSVTSSMEGEQQNF  424
            +  M G A TIYPQRPGQ+ECDFYMKTG CKFGERC++HHP+D S LS++     +Q   
Sbjct  386  SNPMVGIAETIYPQRPGQIECDFYMKTGVCKFGERCKYHHPIDRSALSLS-----KQATV  440

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEEGY  247
            KL+ AGLPRREG + CPYY+KTG CKFGATCKFDHPPPGE++    SQ TS +  E EG 
Sbjct  441  KLTPAGLPRREGDVICPYYLKTGTCKFGATCKFDHPPPGEVMEMAKSQGTSANGEEAEGD  500

Query  246  AKLVEAI  226
               +E +
Sbjct  501  TSALEQL  507


 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 80/166 (48%), Gaps = 53/166 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP   + N   A ++ G+                           
Sbjct  207  LKTQRCKFGSKCKFNHPKVSSEN---ADVSSGL---------------------------  236

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME----------------GEQ  433
            P+RP +  C FYMKTG+C++G  C+FHHP D  + ++  +                 G+ 
Sbjct  237  PERPSEPPCAFYMKTGKCRYGTACKFHHPKDIQIQLSDDLSQNVAQTQTNSMMGGATGDT  296

Query  432  QNFKLSLA-------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            Q  K  ++       GLP R G + CP+YMKTG CK+G +C+++HP
Sbjct  297  QPIKSLISPSLQNSKGLPVRLGEVDCPFYMKTGSCKYGVSCRYNHP  342


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 32/143 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               V  P   +     P   +      +   
Sbjct  155  MLTRTCKFGDSCKFDHP---------------VWVPEGGI-----PDWKEVPNVVTSETP  194

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP      V+S      +N  +S +GLP R   
Sbjct  195  PERPGEPDCPYFLKTQRCKFGSKCKFNHP-----KVSS------ENADVS-SGLPERPSE  242

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG C++G  CKF HP
Sbjct  243  PPCAFYMKTGKCRYGTACKFHHP  265


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 12/91 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLA  409
            TIYPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   ++K     ++  
Sbjct  140  TIYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPV-------WVPEGGIPDWKEVPNVVTSE  192

Query  408  GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              P R G   CPY++KT  CKFG+ CKF+HP
Sbjct  193  TPPERPGEPDCPYFLKTQRCKFGSKCKFNHP  223



>gb|KJB81460.1| hypothetical protein B456_013G146700 [Gossypium raimondii]
Length=348

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 131/180 (73%), Gaps = 24/180 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP----------AAHLNVGVVNPTASLFQTFDPRLTQ  595
            LKTGSCKYG+TCRYNHPDR    PP          A++LN+GVVNP +SL+QT DPRL+Q
Sbjct  171  LKTGSCKYGSTCRYNHPDRNAFVPPVALGHSLIASASNLNIGVVNPASSLYQTIDPRLSQ  230

Query  594  TMFGFATT---------IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME  442
            T      T         +YPQRPGQ ECD+YMKTGECKFG+RC+FHHP+D      ++ E
Sbjct  231  TTLLAQQTMPTLVGTQPVYPQRPGQTECDYYMKTGECKFGDRCKFHHPIDR----LTTNE  286

Query  441  GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS-QVTSTSV  265
              QQ  KL+LAGLPRREG++HCPYYMKTG CK+GATCKFDHPPPGE++  T  Q TST++
Sbjct  287  ASQQAIKLTLAGLPRREGSVHCPYYMKTGTCKYGATCKFDHPPPGEVMSVTGVQGTSTTM  346


 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 104/227 (46%), Gaps = 53/227 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP +  ++ P    N+ V                           
Sbjct  53   LKTQRCKFGSKCKFNHP-KDKLDAPGDSENLTVSG------------------------L  87

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD--HSLSVTSSMEGEQQNFKLSLA------  409
            P+RP +  C FYMKTG CKFG  C+F+HP D    LS+ +++  EQ +  + +       
Sbjct  88   PERPSEPPCAFYMKTGTCKFGSTCKFNHPKDIQIQLSLQNNVNCEQSDIAMKIGGISGDI  147

Query  408  ---------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIGGTSQVTS  274
                     GLP R   + CP+Y+KTG CK+G+TC+++HP      PP  L  G S + S
Sbjct  148  KPALYHNSKGLPVRPDEVDCPFYLKTGSCKYGSTCRYNHPDRNAFVPPVAL--GHSLIAS  205

Query  273  TS---VGEEEGYAKLVEAIQKQQQ*TFCSVQQRI*SATSSSPDYTLR  142
             S   +G     + L + I  +   T    QQ + +   + P Y  R
Sbjct  206  ASNLNIGVVNPASSLYQTIDPRLSQTTLLAQQTMPTLVGTQPVYPQR  252


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +     A    
Sbjct  1    MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PYWKEVPPVPAGESL  40

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D          G+ +N  L+++GLP R   
Sbjct  41   PERPGEPDCPYFLKTQRCKFGSKCKFNHPKDKL-----DAPGDSEN--LTVSGLPERPSE  93

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFG+TCKF+HP
Sbjct  94   PPCAFYMKTGTCKFGSTCKFNHP  116



>ref|XP_011012050.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
[Populus euphratica]
Length=511

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 124/161 (77%), Gaps = 16/161 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R  INPPAA            +LN+GV +P AS++QT DPRL
Sbjct  342  LKTGSCKYGATCRYNHPERTAINPPAAAISHPIIAPSMANLNLGVFSPAASIYQTIDPRL  401

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +    G   T+YPQRPGQ ECDFYMKTGECKFGE C+FHHP+D S    ++ + E Q  K
Sbjct  402  S--TLGVGPTVYPQRPGQTECDFYMKTGECKFGETCKFHHPIDRS--APTAKQTEPQTVK  457

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELI  298
            L+LAGLPRREGA+HCPYYMKTG CK+GATCKFDHPPPGE++
Sbjct  458  LTLAGLPRREGAVHCPYYMKTGTCKYGATCKFDHPPPGEVM  498


 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 83/185 (45%), Gaps = 48/185 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTI------NPPAAHLN--------VGVVNPTASLFQTFDP  607
            +KTG CK+GATC+++HP    I      N      N         G VN   +L  +  P
Sbjct  262  MKTGICKFGATCKFHHPKDIQITLAGQGNDNGVQTNSVVDNGGITGDVNVIKALM-SVTP  320

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----------LDH---  469
             L     G      P RPG+V+C FY+KTG CK+G  CR++HP           + H   
Sbjct  321  ALLHNSKGL-----PMRPGEVDCPFYLKTGSCKYGATCRYNHPERTAINPPAAAISHPII  375

Query  468  -------SLSVTSSMEGEQQNFKLSLAGL-------PRREGAIHCPYYMKTGICKFGATC  331
                   +L V S      Q     L+ L       P+R G   C +YMKTG CKFG TC
Sbjct  376  APSMANLNLGVFSPAASIYQTIDPRLSTLGVGPTVYPQRPGQTECDFYMKTGECKFGETC  435

Query  330  KFDHP  316
            KF HP
Sbjct  436  KFHHP  440


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 87/179 (49%), Gaps = 34/179 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G TC+++HP             V V       ++   P  T   F       
Sbjct  164  MLTRTCKFGDTCKFDHP-------------VWVPEGGIPDWKEVPPIATSETF-------  203

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGLPRREG  388
            P+RPG  +C +++KT  CK+G  C+F+HP +  +L V+ +          S++ LP R  
Sbjct  204  PERPGVPDCPYFLKTQRCKYGVNCKFNHPKEKLALDVSENT---------SVSALPERPS  254

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELI----GGTSQVTSTSVGEEEGYAKLVEAIQ  223
               C +YMKTGICKFGATCKF HP   ++     G  + V + SV +  G    V  I+
Sbjct  255  EPPCAFYMKTGICKFGATCKFHHPKDIQITLAGQGNDNGVQTNSVVDNGGITGDVNVIK  313


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 59/111 (53%), Gaps = 13/111 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            IYPQRPG+ +C +YM T  CKFG+ C+F HP+          EG   ++K      +   
Sbjct  150  IYPQRPGEKDCAYYMLTRTCKFGDTCKFDHPV-------WVPEGGIPDWKEVPPIATSET  202

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
             P R G   CPY++KT  CK+G  CKF+H P  +L    S+ TS S   E 
Sbjct  203  FPERPGVPDCPYFLKTQRCKYGVNCKFNH-PKEKLALDVSENTSVSALPER  252



>ref|XP_008225967.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Prunus mume]
Length=497

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 138/191 (72%), Gaps = 22/191 (12%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDRY INPP            AA LN+GV+NP AS++QT    L
Sbjct  316  LKTGSCKYGATCRYNHPDRYAINPPIGAISHPIVAPPAAGLNIGVINPAASIYQT----L  371

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS-LSVTSSMEGEQQNF  424
             Q   G   T+YPQR GQ+ECD+YMKTGEC+FGE+C++HHP+D S ++++++   +QQN 
Sbjct  372  AQPTVGGGQTVYPQRFGQIECDYYMKTGECRFGEQCKYHHPIDRSAVALSTTKPVQQQNV  431

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYA  244
            KL+LAGLPRREG   C YY+KTG CK+GATCKFDHPPPGE++G      + S G   G A
Sbjct  432  KLTLAGLPRREGVAICVYYLKTGTCKYGATCKFDHPPPGEVMG-----MAASEGASGGEA  486

Query  243  KLVEAIQKQQQ  211
            K+ E  Q+QQQ
Sbjct  487  KVDEFTQEQQQ  497


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 75/165 (45%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP           L   V +  A  F                   
Sbjct  193  IKTQRCKFGMRCKFNHPKE--------KLAAAVASENADAF-----------------AL  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL----------SVTSSMEGEQQNFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +             ++++ E   F + 
Sbjct  228  PERPSEPPCAFYMKTGQCKFGATCKFHHPKDIQIPSAEQENKIGETGTTIQPEGTGFAVK  287

Query  414  L------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            L              LP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  288  LPVSFSPALLYNSKELPVRPGEPDCPFYLKTGSCKYGATCRYNHP  332


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G  C+++HP             V +V P+ SL                    
Sbjct  141  MLTRTCKFGELCKFDHPIWVPEGGIPDWKEVPLVAPSESL--------------------  180

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG RC+F+HP +   +  +S   +          LP R   
Sbjct  181  PERPGEPDCPYFIKTQRCKFGMRCKFNHPKEKLAAAVASENADA-------FALPERPSE  233

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  234  PPCAFYMKTGQCKFGATCKFHHP  256


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFGE C+F HP+   +      + ++         LP R 
Sbjct  127  IYPQRPGEKDCAHYMLTRTCKFGELCKFDHPI--WVPEGGIPDWKEVPLVAPSESLPERP  184

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPY++KT  CKFG  CKF+HP
Sbjct  185  GEPDCPYFIKTQRCKFGMRCKFNHP  209



>gb|KJB81459.1| hypothetical protein B456_013G146700 [Gossypium raimondii]
Length=456

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 131/180 (73%), Gaps = 24/180 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP----------AAHLNVGVVNPTASLFQTFDPRLTQ  595
            LKTGSCKYG+TCRYNHPDR    PP          A++LN+GVVNP +SL+QT DPRL+Q
Sbjct  279  LKTGSCKYGSTCRYNHPDRNAFVPPVALGHSLIASASNLNIGVVNPASSLYQTIDPRLSQ  338

Query  594  TMFGFATT---------IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME  442
            T      T         +YPQRPGQ ECD+YMKTGECKFG+RC+FHHP+D      ++ E
Sbjct  339  TTLLAQQTMPTLVGTQPVYPQRPGQTECDYYMKTGECKFGDRCKFHHPIDR----LTTNE  394

Query  441  GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS-QVTSTSV  265
              QQ  KL+LAGLPRREG++HCPYYMKTG CK+GATCKFDHPPPGE++  T  Q TST++
Sbjct  395  ASQQAIKLTLAGLPRREGSVHCPYYMKTGTCKYGATCKFDHPPPGEVMSVTGVQGTSTTM  454


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 104/224 (46%), Gaps = 50/224 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP +  ++ P    N+ V                           
Sbjct  164  LKTQRCKFGSKCKFNHP-KDKLDAPGDSENLTVSG------------------------L  198

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD--HSLSVTSSMEGEQQNFKLSLAGLP---  400
            P+RP +  C FYMKTG CKFG  C+F+HP D    LS+ +++  EQ +  + + G+    
Sbjct  199  PERPSEPPCAFYMKTGTCKFGSTCKFNHPKDIQIQLSLQNNVNCEQSDIAMKIGGISGDI  258

Query  399  ------RREG---AIHCPYYMKTGICKFGATCKFDHP------PPGELIGGTSQVTSTS-  268
                    +G    + CP+Y+KTG CK+G+TC+++HP      PP  L  G S + S S 
Sbjct  259  KPALYHNSKGLPDEVDCPFYLKTGSCKYGSTCRYNHPDRNAFVPPVAL--GHSLIASASN  316

Query  267  --VGEEEGYAKLVEAIQKQQQ*TFCSVQQRI*SATSSSPDYTLR  142
              +G     + L + I  +   T    QQ + +   + P Y  R
Sbjct  317  LNIGVVNPASSLYQTIDPRLSQTTLLAQQTMPTLVGTQPVYPQR  360


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 75/143 (52%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +     A    
Sbjct  112  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PYWKEVPPVPAGESL  151

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D        ++    +  L+++GLP R   
Sbjct  152  PERPGEPDCPYFLKTQRCKFGSKCKFNHPKD-------KLDAPGDSENLTVSGLPERPSE  204

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFG+TCKF+HP
Sbjct  205  PPCAFYMKTGTCKFGSTCKFNHP  227


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 50/92 (54%), Gaps = 16/92 (17%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHP-------LDHSLSVTSSMEGEQQNFKLSL  412
            IYPQRPG+ +C  YM T  CKFG+ C+F HP       + +   V     GE        
Sbjct  98   IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPIWVPEGGIPYWKEVPPVPAGE--------  149

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              LP R G   CPY++KT  CKFG+ CKF+HP
Sbjct  150  -SLPERPGEPDCPYFLKTQRCKFGSKCKFNHP  180



>gb|KHG27644.1| Zinc finger CCCH domain-containing 37 -like protein [Gossypium 
arboreum]
Length=459

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 131/180 (73%), Gaps = 24/180 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP----------AAHLNVGVVNPTASLFQTFDPRLTQ  595
            LKTGSCKYG+TCRYNHPDR    PP          A++LN+GVVNP +SL+QT DPRL+Q
Sbjct  282  LKTGSCKYGSTCRYNHPDRNAFIPPVALGHSLIASASNLNIGVVNPASSLYQTIDPRLSQ  341

Query  594  TMFGF---------ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME  442
            T               T+YPQRPGQ ECD+YMKTGECKFG+RC+FHHP+D      ++ E
Sbjct  342  TTLLAQQTMPTLVGTQTVYPQRPGQTECDYYMKTGECKFGDRCKFHHPIDR----LTTNE  397

Query  441  GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS-QVTSTSV  265
              QQ  KL+LAGLPRREG++HCPYYMKTG CK+GATCKFDHPPPGE++  T  Q TST++
Sbjct  398  ASQQAIKLTLAGLPRREGSVHCPYYMKTGTCKYGATCKFDHPPPGEVMSVTGVQGTSTTM  457


 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 80/160 (50%), Gaps = 42/160 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP +  ++ P    N+ V                           
Sbjct  164  LKTQRCKFGSKCKFNHP-KDKLDAPGDSENLTVSG------------------------L  198

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD--HSLSVTSSMEGEQQNFKLSLA------  409
            P+RP +  C FYMKTG CKFG  C+F+HP D    LS+ +++  EQ +  + +       
Sbjct  199  PERPSEPPCAFYMKTGTCKFGSTCKFNHPKDIQIQLSLQNNVNCEQSDIAMKIGGISGDI  258

Query  408  ---------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                     GLP R   + CP+Y+KTG CK+G+TC+++HP
Sbjct  259  KPALYHNSKGLPVRPDEVDCPFYLKTGSCKYGSTCRYNHP  298


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 75/143 (52%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +     A    
Sbjct  112  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PYWKEVPPVPAGESL  151

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D        ++    +  L+++GLP R   
Sbjct  152  PERPGEPDCPYFLKTQRCKFGSKCKFNHPKD-------KLDAPGDSENLTVSGLPERPSE  204

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFG+TCKF+HP
Sbjct  205  PPCAFYMKTGTCKFGSTCKFNHP  227


 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 82/185 (44%), Gaps = 48/185 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG-----VVNPTASLFQTFDPRLTQTMFGF  580
            +KTG+CK+G+TC++NHP    I   +   NV      +      +     P L     G 
Sbjct  211  MKTGTCKFGSTCKFNHPKDIQIQ-LSLQNNVNCEQSDIAMKIGGISGDIKPALYHNSKGL  269

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP----------LDHSLSVTSSMEG---  439
                 P RP +V+C FY+KTG CK+G  CR++HP          L HSL  ++S      
Sbjct  270  -----PVRPDEVDCPFYLKTGSCKYGSTCRYNHPDRNAFIPPVALGHSLIASASNLNIGV  324

Query  438  --------EQQNFKLSLAGL----------------PRREGAIHCPYYMKTGICKFGATC  331
                    +  + +LS   L                P+R G   C YYMKTG CKFG  C
Sbjct  325  VNPASSLYQTIDPRLSQTTLLAQQTMPTLVGTQTVYPQRPGQTECDYYMKTGECKFGDRC  384

Query  330  KFDHP  316
            KF HP
Sbjct  385  KFHHP  389


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 50/92 (54%), Gaps = 16/92 (17%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHP-------LDHSLSVTSSMEGEQQNFKLSL  412
            IYPQRPG+ +C  YM T  CKFG+ C+F HP       + +   V     GE        
Sbjct  98   IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPIWVPEGGIPYWKEVPPVPAGE--------  149

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              LP R G   CPY++KT  CKFG+ CKF+HP
Sbjct  150  -SLPERPGEPDCPYFLKTQRCKFGSKCKFNHP  180



>gb|KJB81457.1| hypothetical protein B456_013G146700 [Gossypium raimondii]
Length=459

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 131/180 (73%), Gaps = 24/180 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP----------AAHLNVGVVNPTASLFQTFDPRLTQ  595
            LKTGSCKYG+TCRYNHPDR    PP          A++LN+GVVNP +SL+QT DPRL+Q
Sbjct  282  LKTGSCKYGSTCRYNHPDRNAFVPPVALGHSLIASASNLNIGVVNPASSLYQTIDPRLSQ  341

Query  594  TMFGFATT---------IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME  442
            T      T         +YPQRPGQ ECD+YMKTGECKFG+RC+FHHP+D      ++ E
Sbjct  342  TTLLAQQTMPTLVGTQPVYPQRPGQTECDYYMKTGECKFGDRCKFHHPIDR----LTTNE  397

Query  441  GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS-QVTSTSV  265
              QQ  KL+LAGLPRREG++HCPYYMKTG CK+GATCKFDHPPPGE++  T  Q TST++
Sbjct  398  ASQQAIKLTLAGLPRREGSVHCPYYMKTGTCKYGATCKFDHPPPGEVMSVTGVQGTSTTM  457


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 104/227 (46%), Gaps = 53/227 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP +  ++ P    N+ V                           
Sbjct  164  LKTQRCKFGSKCKFNHP-KDKLDAPGDSENLTVSG------------------------L  198

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD--HSLSVTSSMEGEQQNFKLSLA------  409
            P+RP +  C FYMKTG CKFG  C+F+HP D    LS+ +++  EQ +  + +       
Sbjct  199  PERPSEPPCAFYMKTGTCKFGSTCKFNHPKDIQIQLSLQNNVNCEQSDIAMKIGGISGDI  258

Query  408  ---------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIGGTSQVTS  274
                     GLP R   + CP+Y+KTG CK+G+TC+++HP      PP  L  G S + S
Sbjct  259  KPALYHNSKGLPVRPDEVDCPFYLKTGSCKYGSTCRYNHPDRNAFVPPVAL--GHSLIAS  316

Query  273  TS---VGEEEGYAKLVEAIQKQQQ*TFCSVQQRI*SATSSSPDYTLR  142
             S   +G     + L + I  +   T    QQ + +   + P Y  R
Sbjct  317  ASNLNIGVVNPASSLYQTIDPRLSQTTLLAQQTMPTLVGTQPVYPQR  363


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 75/143 (52%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +     A    
Sbjct  112  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PYWKEVPPVPAGESL  151

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D        ++    +  L+++GLP R   
Sbjct  152  PERPGEPDCPYFLKTQRCKFGSKCKFNHPKD-------KLDAPGDSENLTVSGLPERPSE  204

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFG+TCKF+HP
Sbjct  205  PPCAFYMKTGTCKFGSTCKFNHP  227


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 50/92 (54%), Gaps = 16/92 (17%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHP-------LDHSLSVTSSMEGEQQNFKLSL  412
            IYPQRPG+ +C  YM T  CKFG+ C+F HP       + +   V     GE        
Sbjct  98   IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPIWVPEGGIPYWKEVPPVPAGE--------  149

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              LP R G   CPY++KT  CKFG+ CKF+HP
Sbjct  150  -SLPERPGEPDCPYFLKTQRCKFGSKCKFNHP  180



>ref|XP_004148293.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
[Cucumis sativus]
Length=527

 Score =   222 bits (565),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 133/187 (71%), Gaps = 18/187 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP-------PA----AHLNVGVVNPTASLFQTFDPRLT  598
            LKTGSCKYG TCRYNHPDR  INP       PA    A++N G VNP+ +++Q  DPRL 
Sbjct  347  LKTGSCKYGTTCRYNHPDRNAINPSTPAMVHPAMVSTANMNTGFVNPSNAIYQAVDPRLI  406

Query  597  QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKL  418
            Q + G  ++IYPQRPGQ+ECDFYMKTG+CKFGERC+FHHP+D S    +  +G   N KL
Sbjct  407  QPLLGSGSSIYPQRPGQIECDFYMKTGDCKFGERCKFHHPIDRS----APKQGALHNVKL  462

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKL  238
            +LAGLPRRE AI CPYY+KTG CK+G TCKFDHPPPGE++   +     S   +EG  ++
Sbjct  463  TLAGLPRREEAIICPYYLKTGTCKYGTTCKFDHPPPGEVM---TMAAVQSAPGKEGEDRI  519

Query  237  VEAIQKQ  217
             E++ ++
Sbjct  520  DESVDER  526


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 80/168 (48%), Gaps = 52/168 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G+ C++NHP DR          +VG     AS                    
Sbjct  223  LKTQRCKFGSRCKFNHPKDRSD--------SVGAEKSDASSL------------------  256

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-----------SVTSSMEGEQQNFK  421
             P+RP +  C FY+KTG CKFG  C+FHHP D  +           ++    E    +FK
Sbjct  257  -PERPSEPLCAFYVKTGNCKFGINCKFHHPKDIQILSGEEYGNSEQTLMVKTEERAGDFK  315

Query  420  L-----SLA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            L     SL+        GLP R G + CP+Y+KTG CK+G TC+++HP
Sbjct  316  LVKPPISLSPAIMHNSKGLPIRPGEVDCPFYLKTGSCKYGTTCRYNHP  363


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 79/176 (45%), Gaps = 33/176 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  171  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PDWKEVPQIANSEDL  210

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G  +C +++KT  CKFG RC+F+HP D S SV +         K   + LP R   
Sbjct  211  PERLGDPDCPYFLKTQRCKFGSRCKFNHPKDRSDSVGAE--------KSDASSLPERPSE  262

Query  384  IHCPYYMKTGICKFGATCKFDHPP-----PGELIGGTSQVTSTSVGEEEGYAKLVE  232
              C +Y+KTG CKFG  CKF HP       GE  G + Q       E  G  KLV+
Sbjct  263  PLCAFYVKTGNCKFGINCKFHHPKDIQILSGEEYGNSEQTLMVKTEERAGDFKLVK  318


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            +YPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   ++K      +   
Sbjct  157  VYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPI-------WVPEGGIPDWKEVPQIANSED  209

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGE  259
            LP R G   CPY++KT  CKFG+ CKF+HP       G  +  ++S+ E
Sbjct  210  LPERLGDPDCPYFLKTQRCKFGSRCKFNHPKDRSDSVGAEKSDASSLPE  258



>ref|XP_010543113.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
[Tarenaya hassleriana]
Length=517

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 123/165 (75%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYG TCRYNHPDR    PP            AA+LN+GVV P ASL+QT    L
Sbjct  347  LKTGSCKYGHTCRYNHPDRTAFIPPVAGVTYPLVASTAANLNLGVVTPAASLYQT----L  402

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G   T+YPQRPGQVECD+YMKTGECKFGERC+FHHP+D S + TS  +  Q+N K
Sbjct  403  AQPTIGVVPTVYPQRPGQVECDYYMKTGECKFGERCKFHHPIDRSAAATSK-QSSQENVK  461

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
             +LAG PRREGA+HCPYYMKTG+CK+GATC+FDHPPPGE+ G T+
Sbjct  462  FTLAGYPRREGAVHCPYYMKTGMCKYGATCRFDHPPPGEVKGKTA  506


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 77/174 (44%), Gaps = 47/174 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP   T             NP A                      
Sbjct  232  VKTQRCKYGSRCKFNHPKALTTG--------TSENPDA---------------------L  262

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P RP +  C FYMKTG+CKFG  C+FHHP D  +S      G  +               
Sbjct  263  PDRPSEPPCAFYMKTGKCKFGPTCKFHHPKDIQISSFDQENGSSEGLTSDTNAANKPPIT  322

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
            F  +L     GLP R G + CP+Y+KTG CK+G TC+++HP     I   + VT
Sbjct  323  FNPALYHNSKGLPVRPGEVDCPFYLKTGSCKYGHTCRYNHPDRTAFIPPVAGVT  376


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 59/100 (59%), Gaps = 13/100 (13%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLS-LA---GL  403
            IYPQRPG+ +C  YM+T  CKFG+ C+F HP+          EG   ++K + LA     
Sbjct  167  IYPQRPGEKDCTHYMQTRTCKFGDSCKFDHPI-------WVPEGGILDWKEAPLAPNESY  219

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQ  283
            P R G   CPY++KT  CK+G+ CKF+H  P  L  GTS+
Sbjct  220  PERPGEPDCPYFVKTQRCKYGSRCKFNH--PKALTTGTSE  257



>ref|XP_008447068.1| PREDICTED: zinc finger CCCH domain-containing protein 37 [Cucumis 
melo]
Length=526

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 133/187 (71%), Gaps = 18/187 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP-------PA----AHLNVGVVNPTASLFQTFDPRLT  598
            LKTGSCKYG TCRYNHPDR  INP       PA    A++N G VNP+ +++Q  DPRL 
Sbjct  346  LKTGSCKYGTTCRYNHPDRNAINPSTPAMVHPAMVSTANMNTGFVNPSNAIYQAVDPRLI  405

Query  597  QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKL  418
            Q + G  ++IYPQRPGQ+ECD+YMKTG+CKFGERC+FHHP+D S    +  +G   N KL
Sbjct  406  QPLLGSGSSIYPQRPGQIECDYYMKTGDCKFGERCKFHHPIDRS----APKQGALHNVKL  461

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKL  238
            +LAGLPRRE AI CPYY+KTG CK+G TCKFDHPPPGE++   +     S   +EG  ++
Sbjct  462  TLAGLPRREEAIICPYYLKTGTCKYGTTCKFDHPPPGEVM---TMAAIQSAPGKEGEDRI  518

Query  237  VEAIQKQ  217
             E++ ++
Sbjct  519  DESVDER  525


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 81/178 (46%), Gaps = 35/178 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI-  568
            +KTG+CK+G  C+++HP    I     + N        +  +  D +L       +  + 
Sbjct  268  IKTGNCKFGINCKFHHPKDIQILSGEENGNSEQTLMAKTEERAGDVKLKPPPVSLSPALM  327

Query  567  -----YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS------------VTSSM--  445
                  P RPG+V+C FY+KTG CK+G  CR++HP  ++++             T++M  
Sbjct  328  HNSKGLPIRPGEVDCPFYLKTGSCKYGTTCRYNHPDRNAINPSTPAMVHPAMVSTANMNT  387

Query  444  ----------EGEQQNFKLSLAG-----LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                      +         L G      P+R G I C YYMKTG CKFG  CKF HP
Sbjct  388  GFVNPSNAIYQAVDPRLIQPLLGSGSSIYPQRPGQIECDYYMKTGDCKFGERCKFHHP  445


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 77/174 (44%), Gaps = 33/174 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  170  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PDWKEVPQIANSEDL  209

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G  +C +++KT  CKFG RC+F+HP D S SV +         K   + LP R   
Sbjct  210  PERLGDPDCPYFLKTQRCKFGSRCKFNHPKDRSDSVGAE--------KSDASKLPERPSE  261

Query  384  IHCPYYMKTGICKFGATCKFDHPP-----PGELIGGTSQVTSTSVGEEEGYAKL  238
              C +Y+KTG CKFG  CKF HP       GE  G + Q       E  G  KL
Sbjct  262  PLCAFYIKTGNCKFGINCKFHHPKDIQILSGEENGNSEQTLMAKTEERAGDVKL  315


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 63/119 (53%), Gaps = 23/119 (19%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            +YPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   ++K      +   
Sbjct  156  VYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPI-------WVPEGGIPDWKEVPQIANSED  208

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYA-KLVE  232
            LP R G   CPY++KT  CKFG+ CKF+HP          +  S SVG E+  A KL E
Sbjct  209  LPERLGDPDCPYFLKTQRCKFGSRCKFNHP----------KDRSDSVGAEKSDASKLPE  257



>ref|XP_008225965.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Prunus mume]
Length=501

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/195 (56%), Positives = 137/195 (70%), Gaps = 26/195 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRY----------------TINPPAAHLNVGVVNPTASLFQTF  613
            LKTGSCKYGATCRYNHPDRY                 + PPAA LN+GV+NP AS++QT 
Sbjct  316  LKTGSCKYGATCRYNHPDRYDFCAAINPPIGAISHPIVAPPAAGLNIGVINPAASIYQT-  374

Query  612  DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS-LSVTSSMEGE  436
               L Q   G   T+YPQR GQ+ECD+YMKTGEC+FGE+C++HHP+D S ++++++   +
Sbjct  375  ---LAQPTVGGGQTVYPQRFGQIECDYYMKTGECRFGEQCKYHHPIDRSAVALSTTKPVQ  431

Query  435  QQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
            QQN KL+LAGLPRREG   C YY+KTG CK+GATCKFDHPPPGE++G      + S G  
Sbjct  432  QQNVKLTLAGLPRREGVAICVYYLKTGTCKYGATCKFDHPPPGEVMG-----MAASEGAS  486

Query  255  EGYAKLVEAIQKQQQ  211
             G AK+ E  Q+QQQ
Sbjct  487  GGEAKVDEFTQEQQQ  501


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 75/165 (45%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP           L   V +  A  F                   
Sbjct  193  IKTQRCKFGMRCKFNHPKE--------KLAAAVASENADAF-----------------AL  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL----------SVTSSMEGEQQNFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +             ++++ E   F + 
Sbjct  228  PERPSEPPCAFYMKTGQCKFGATCKFHHPKDIQIPSAEQENKIGETGTTIQPEGTGFAVK  287

Query  414  L------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            L              LP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  288  LPVSFSPALLYNSKELPVRPGEPDCPFYLKTGSCKYGATCRYNHP  332


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G  C+++HP             V +V P+ SL                    
Sbjct  141  MLTRTCKFGELCKFDHPIWVPEGGIPDWKEVPLVAPSESL--------------------  180

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG RC+F+HP +   +  +S   +          LP R   
Sbjct  181  PERPGEPDCPYFIKTQRCKFGMRCKFNHPKEKLAAAVASENADA-------FALPERPSE  233

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  234  PPCAFYMKTGQCKFGATCKFHHP  256


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFGE C+F HP+   +      + ++         LP R 
Sbjct  127  IYPQRPGEKDCAHYMLTRTCKFGELCKFDHPI--WVPEGGIPDWKEVPLVAPSESLPERP  184

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPY++KT  CKFG  CKF+HP
Sbjct  185  GEPDCPYFIKTQRCKFGMRCKFNHP  209



>ref|XP_009368594.1| PREDICTED: zinc finger CCCH domain-containing protein 37 [Pyrus 
x bretschneideri]
Length=499

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 135/193 (70%), Gaps = 26/193 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDRY INPP            AA LN+GV++P AS++QT    L
Sbjct  317  LKTGSCKYGATCRYNHPDRYAINPPIAAISHPIVATQAAGLNIGVIDPAASIYQT----L  372

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS---LSVTSSMEGEQQ  430
             Q   G   T+YPQR GQ+ECD+YMKTGECKFGE C+FHHP+D S   LS   ++  ++ 
Sbjct  373  AQPTVGVGPTVYPQRIGQIECDYYMKTGECKFGELCKFHHPIDRSVVALSTPKAVPVQEA  432

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEE  253
            N KL+LAGLPRREG   C YY+KTG CK+GA+CKFDHPPPGE++G G +Q TS+      
Sbjct  433  NVKLTLAGLPRREGVAICVYYLKTGTCKYGASCKFDHPPPGEVMGMGATQGTSS------  486

Query  252  GYAKLVEAIQKQQ  214
            G AK  E  Q+QQ
Sbjct  487  GEAKAGEFPQEQQ  499


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 76/165 (46%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP    I   A+          A +F                   
Sbjct  194  IKTQRCKFGMRCKFNHPKDKVIASDASE--------NADVF-----------------TL  228

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL----------SVTSSMEGEQQNFKL-  418
            P+RP +  C FY+KTG+CKFG  C+FHHP D  +             ++++ E   F + 
Sbjct  229  PERPSEPPCAFYLKTGQCKFGVTCKFHHPKDIQIPSANQENKAGETDTAIKTEGTGFSVK  288

Query  417  -----------SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                       +   LP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  289  APISFTPALLYNTKELPVRPGEPDCPFYLKTGSCKYGATCRYNHP  333


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (50%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      T + 
Sbjct  142  MLTRTCKFGESCKFDHP---------------IWVPEGGI-----PDWKEVPLVAPTEVL  181

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG  +C +++KT  CKFG RC+F+HP D  ++  +S   +       +  LP R   
Sbjct  182  PERPGAPDCPYFIKTQRCKFGMRCKFNHPKDKVIASDASENAD-------VFTLPERPSE  234

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CKFG TCKF HP
Sbjct  235  PPCAFYLKTGQCKFGVTCKFHHP  257


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFGE C+F HP+   +      + ++         LP R 
Sbjct  128  IYPQRPGEKDCAHYMLTRTCKFGESCKFDHPI--WVPEGGIPDWKEVPLVAPTEVLPERP  185

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            GA  CPY++KT  CKFG  CKF+HP
Sbjct  186  GAPDCPYFIKTQRCKFGMRCKFNHP  210



>gb|KEH19319.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=362

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 124/178 (70%), Gaps = 19/178 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPA------------AHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCK+GA+CRYNHPD   INPP             A+LN+G +NP AS +Q FDP L
Sbjct  172  MKTGSCKFGASCRYNHPDMNAINPPVSALGPSVLASSTANLNMGAINPAASFYQAFDPSL  231

Query  600  TQTM--FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
            +  M   G   TIYPQRPGQ+ECDFYMK+G CKFGERC++HHP+D     T+S+   Q N
Sbjct  232  SNPMSQVGVTGTIYPQRPGQIECDFYMKSGICKFGERCKYHHPIDR----TTSLSKLQSN  287

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEE  256
             KL+ AGLPRREG   CPYY+KT  CKFGATCKFDHPPPGE++    SQ  ST+ G E
Sbjct  288  VKLTAAGLPRREGVEICPYYLKTATCKFGATCKFDHPPPGEVMEMAKSQGASTTNGGE  345


 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 88/189 (47%), Gaps = 61/189 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G  C++NHP     N P+ + +V  +                          
Sbjct  53   LKTQKCKFGTKCKFNHP-----NVPSENDDVSGL--------------------------  81

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME-----------------GE  436
            P+RP +  C FY+KTG+CK+G  C+FHHP D  + ++  +                  G+
Sbjct  82   PERPQEPPCAFYLKTGKCKYGAACKFHHPKDIQIQLSDDLSRTVEQTQTNSSVFDGAIGD  141

Query  435  QQNFKLSLA-------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIG  295
             Q+    ++       GLP R   + CP+YMKTG CKFGA+C+++HP      PP   +G
Sbjct  142  TQSIMPLISPLSHNSKGLPVRPREVDCPFYMKTGSCKFGASCRYNHPDMNAINPPVSALG  201

Query  294  GTSQVTSTS  268
             +   +ST+
Sbjct  202  PSVLASSTA  210


 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 13/83 (16%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C F++KT +CKFG +C+F+HP     +V S  +         ++GLP R   
Sbjct  41   PERPGEPDCPFFLKTQKCKFGTKCKFNHP-----NVPSEND--------DVSGLPERPQE  87

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CK+GA CKF HP
Sbjct  88   PPCAFYLKTGKCKYGAACKFHHP  110



>ref|XP_007211846.1| hypothetical protein PRUPE_ppa004704mg [Prunus persica]
 gb|EMJ13045.1| hypothetical protein PRUPE_ppa004704mg [Prunus persica]
Length=495

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 125/163 (77%), Gaps = 17/163 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDRY INPP            AA LN+GV+NP AS++QT    L
Sbjct  316  LKTGSCKYGATCRYNHPDRYAINPPIGAISHPIVAPPAAGLNIGVINPAASIYQT----L  371

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS-LSVTSSMEGEQQNF  424
             Q   G   T+YPQR GQ+ECD+YMKTGEC+FGE+C++HHP+D S ++++++   +QQN 
Sbjct  372  AQPTVGGGQTVYPQRFGQIECDYYMKTGECRFGEQCKYHHPIDRSAVTLSTTKPVQQQNV  431

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            KL+LAGLPRREG   C YY+KTG CK+GATCKFDHPPPGE++G
Sbjct  432  KLTLAGLPRREGVAICVYYLKTGTCKYGATCKFDHPPPGEVMG  474


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 76/165 (46%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP           L   V +  A +F                   
Sbjct  193  IKTQRCKFGMRCKFNHPKE--------KLAAAVASENADVF-----------------AL  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL----------SVTSSMEGEQQNFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +             ++++ E   F + 
Sbjct  228  PERPSEPPCAFYMKTGQCKFGATCKFHHPKDIQIPSAEQENKIGETGTTIQPEGTGFAVK  287

Query  414  L------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            L              LP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  288  LPVSFSPALLYNSKELPVRPGEPDCPFYLKTGSCKYGATCRYNHP  332


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (50%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G  C+++HP             V +V P+ SL                    
Sbjct  141  MLTRTCKFGELCKFDHPIWVPEGGIPDWKEVPLVAPSESL--------------------  180

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG RC+F+HP +   +  +S   +       +  LP R   
Sbjct  181  PERPGEPDCPYFIKTQRCKFGMRCKFNHPKEKLAAAVASENAD-------VFALPERPSE  233

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKF HP
Sbjct  234  PPCAFYMKTGQCKFGATCKFHHP  256


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFGE C+F HP+   +      + ++         LP R 
Sbjct  127  IYPQRPGEKDCAHYMLTRTCKFGELCKFDHPI--WVPEGGIPDWKEVPLVAPSESLPERP  184

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPY++KT  CKFG  CKF+HP
Sbjct  185  GEPDCPYFIKTQRCKFGMRCKFNHP  209



>ref|XP_008791420.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
[Phoenix dactylifera]
Length=538

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 117/164 (71%), Gaps = 14/164 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP-------------AAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYGATCRYNHPDR +INPP             A +L  GV+NP AS  Q  + +
Sbjct  358  LKTGSCKYGATCRYNHPDRNSINPPLASALGQDIIPSPATNLPFGVLNPAASFLQNINLQ  417

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQN  427
              Q   G   TIYPQRPG++ECDFYMKTG+CKFGERC+FHHP D S   ++ + +  QQN
Sbjct  418  SAQASLGGVPTIYPQRPGEIECDFYMKTGQCKFGERCKFHHPFDRSAPPISDAKQSLQQN  477

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
             KL+LAGLPRRE A+ C +YMKTG CKFGATCKFDHPPPGE + 
Sbjct  478  VKLTLAGLPRREDAVICSFYMKTGTCKFGATCKFDHPPPGEAVA  521


 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 81/163 (50%), Gaps = 30/163 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +  F  A+   
Sbjct  176  MLTRTCKFGNSCKFDHP---------------IWVPEGGI-----PDWKEVPFVPASESL  215

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +YMKT +CKFG RC+F+HP D   +    + GE  +  +    LP R   
Sbjct  216  PERPGESDCPYYMKTQKCKFGSRCKFNHPKDMLNASVGEVGGEGADNSV----LPERPSE  271

Query  384  IHCPYYMKTGICKFGATCKFDH------PPPGELIGGTSQVTS  274
              C +YMKTG CKFG  CKF H      PP GE  G T Q+ S
Sbjct  272  PLCSFYMKTGKCKFGPNCKFHHPKDFQIPPNGEDTGNTGQMES  314


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 79/169 (47%), Gaps = 48/169 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G+ C++NHP          + +VG V                   G   ++ 
Sbjct  228  MKTQKCKFGSRCKFNHPKDML------NASVGEVGGE----------------GADNSVL  265

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------SVTSSMEGEQQN-------  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +         T  ME E+ +       
Sbjct  266  PERPSEPLCSFYMKTGKCKFGPNCKFHHPKDFQIPPNGEDTGNTGQMESEKDDGAAGGDP  325

Query  426  ------------FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           +  GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  326  MPAKGHVTITPALLHNSKGLPIRPGETDCPFYLKTGSCKYGATCRYNHP  374


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 82/187 (44%), Gaps = 49/187 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHL-NVGVVNPT------------ASLFQTFDPR  604
            +KTG CK+G  C+++HP  + I P      N G +               A    T  P 
Sbjct  278  MKTGKCKFGPNCKFHHPKDFQIPPNGEDTGNTGQMESEKDDGAAGGDPMPAKGHVTITPA  337

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS------------  460
            L     G      P RPG+ +C FY+KTG CK+G  CR++HP  +S++            
Sbjct  338  LLHNSKGL-----PIRPGETDCPFYLKTGSCKYGATCRYNHPDRNSINPPLASALGQDII  392

Query  459  ----------VTSSMEGEQQNFKL-----SLAGL----PRREGAIHCPYYMKTGICKFGA  337
                      V +      QN  L     SL G+    P+R G I C +YMKTG CKFG 
Sbjct  393  PSPATNLPFGVLNPAASFLQNINLQSAQASLGGVPTIYPQRPGEIECDFYMKTGQCKFGE  452

Query  336  TCKFDHP  316
             CKF HP
Sbjct  453  RCKFHHP  459


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 63/125 (50%), Gaps = 11/125 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++  F  +   LP R 
Sbjct  162  IYPQRPGEKDCTHYMLTRTCKFGNSCKFDHPI--WVPEGGIPDWKEVPFVPASESLPERP  219

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
            G   CPYYMKT  CKFG+ CKF+HP           + + SVGE  G       + ++  
Sbjct  220  GESDCPYYMKTQKCKFGSRCKFNHP---------KDMLNASVGEVGGEGADNSVLPERPS  270

Query  210  *TFCS  196
               CS
Sbjct  271  EPLCS  275



>gb|KEH19318.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=512

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 124/178 (70%), Gaps = 19/178 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPA------------AHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCK+GA+CRYNHPD   INPP             A+LN+G +NP AS +Q FDP L
Sbjct  322  MKTGSCKFGASCRYNHPDMNAINPPVSALGPSVLASSTANLNMGAINPAASFYQAFDPSL  381

Query  600  TQTM--FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
            +  M   G   TIYPQRPGQ+ECDFYMK+G CKFGERC++HHP+D     T+S+   Q N
Sbjct  382  SNPMSQVGVTGTIYPQRPGQIECDFYMKSGICKFGERCKYHHPIDR----TTSLSKLQSN  437

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEE  256
             KL+ AGLPRREG   CPYY+KT  CKFGATCKFDHPPPGE++    SQ  ST+ G E
Sbjct  438  VKLTAAGLPRREGVEICPYYLKTATCKFGATCKFDHPPPGEVMEMAKSQGASTTNGGE  495


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 88/189 (47%), Gaps = 61/189 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G  C++NHP     N P+ + +V  +                          
Sbjct  203  LKTQKCKFGTKCKFNHP-----NVPSENDDVSGL--------------------------  231

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME-----------------GE  436
            P+RP +  C FY+KTG+CK+G  C+FHHP D  + ++  +                  G+
Sbjct  232  PERPQEPPCAFYLKTGKCKYGAACKFHHPKDIQIQLSDDLSRTVEQTQTNSSVFDGAIGD  291

Query  435  QQNFKLSLA-------GLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIG  295
             Q+    ++       GLP R   + CP+YMKTG CKFGA+C+++HP      PP   +G
Sbjct  292  TQSIMPLISPLSHNSKGLPVRPREVDCPFYMKTGSCKFGASCRYNHPDMNAINPPVSALG  351

Query  294  GTSQVTSTS  268
             +   +ST+
Sbjct  352  PSVLASSTA  360


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = -2

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG  406
            G    IYPQRPG+ +C  YM T  CKFGE C+F HP+   +      + ++    +    
Sbjct  132  GSTLPIYPQRPGEKDCAHYMLTRTCKFGESCKFDHPI--WVPAGGIPDWKEVPNIVPSET  189

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            LP R G   CP+++KT  CKFG  CKF+HP
Sbjct  190  LPERPGEPDCPFFLKTQKCKFGTKCKFNHP  219



>ref|XP_010913403.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
isoform X3 [Elaeis guineensis]
Length=544

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 116/163 (71%), Gaps = 13/163 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP-------------AAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYGATCRYNHPDR + NPP             A +L  GV++P AS  Q  + +
Sbjct  359  LKTGSCKYGATCRYNHPDRNSFNPPLASALGQAIMPSPATNLPFGVLDPAASFLQNINLQ  418

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
              Q   G   T+YPQRPG++ECD+YMKTG CKFGERC+FHHP+D S  ++ + +  QQN 
Sbjct  419  SAQASLGVIPTVYPQRPGEIECDYYMKTGLCKFGERCKFHHPIDRSAPMSDAKQAPQQNV  478

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            KL+LAGLPRREGA+ C +Y+KTG CKFG TCKFDHPPPGE I 
Sbjct  479  KLTLAGLPRREGAVICSFYLKTGTCKFGTTCKFDHPPPGEAIA  521


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 82/169 (49%), Gaps = 48/169 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G+ C++NHP +  +N  A+   VG                     G   ++ 
Sbjct  229  MKTQKCKFGSRCKFNHP-KDKLN--ASADEVGGE-------------------GTENSVL  266

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------SVTSSMEGEQQNF------  424
            P+RP +  C FY KTG+CKFG  C+FHHP D  +            ME E+ +       
Sbjct  267  PERPSEPLCSFYAKTGKCKFGPNCKFHHPKDLKIPPDGEDTDKMGEMESEKNDGSAGGDP  326

Query  423  KLSLA-------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            KL+ A             GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  327  KLAKAHVSITPALLHNSKGLPIRPGEADCPFYLKTGSCKYGATCRYNHP  375


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 82/179 (46%), Gaps = 31/179 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +C +G +C+++HP               +  P   +     P   +     A+   
Sbjct  177  MLTRTCTFGNSCKFDHP---------------IWVPEGGI-----PDWKEIPLVPASESL  216

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P++PG+ +C +YMKT +CKFG RC+F+HP D   +    + GE     +    LP R   
Sbjct  217  PEKPGEPDCPYYMKTQKCKFGSRCKFNHPKDKLNASADEVGGEGTENSV----LPERPSE  272

Query  384  IHCPYYMKTGICKFGATCKFDH------PPPGELIGGTSQVTS-TSVGEEEGYAKLVEA  229
              C +Y KTG CKFG  CKF H      PP GE      ++ S  + G   G  KL +A
Sbjct  273  PLCSFYAKTGKCKFGPNCKFHHPKDLKIPPDGEDTDKMGEMESEKNDGSAGGDPKLAKA  331


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLA--GLPR  397
            IYPQRPG+ +C  YM T  C FG  C+F HP    + V      + +   L  A   LP 
Sbjct  163  IYPQRPGEKDCAHYMLTRTCTFGNSCKFDHP----IWVPEGGIPDWKEIPLVPASESLPE  218

Query  396  REGAIHCPYYMKTGICKFGATCKFDHP  316
            + G   CPYYMKT  CKFG+ CKF+HP
Sbjct  219  KPGEPDCPYYMKTQKCKFGSRCKFNHP  245



>ref|XP_002884918.1| enhancer of ag-4 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61177.1| enhancer of ag-4 1 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 119/165 (72%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPA------------AHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P A            A+LN+G+V P  S +QT    L
Sbjct  347  LKTGSCKYGATCRYNHPERTAFIPQATGINYSLVSSNTANLNLGMVTPATSFYQT----L  402

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            TQ   G  +  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  LS TS+   +Q N K
Sbjct  403  TQPTLGALSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LSATSNQASQQPNVK  461

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  462  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  506


 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP                    A   +T D               
Sbjct  232  IKTQRCKYGSRCKFNHPRE----------------EAAVSVETQD-------------AL  262

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGE--------------QQN  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +  +S   G                  
Sbjct  263  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQVPSSSQDNGSSVGLTSEPDATNNPHVT  322

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  323  FTPALYHNSKGLPVRPGEVDCPFYLKTGSCKYGATCRYNHP  363


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 80/161 (50%), Gaps = 33/161 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP    I  P   +      P                       Y
Sbjct  181  MQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEAPV-----------------VPNEEY  219

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP +      +++  E Q+       LP R   
Sbjct  220  PERPGEPDCPYYIKTQRCKYGSRCKFNHPREE-----AAVSVETQD------ALPERPSE  268

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YMKTG CKFG TCKF HP   + +  +SQ   +SVG
Sbjct  269  PMCTFYMKTGKCKFGLTCKFHHPKDIQ-VPSSSQDNGSSVG  308


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQR G+ +C  YM+T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct  167  IYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPI---WVPEGGIPDWKEAPVVPNEEYPERP  223

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G+ CKF+HP
Sbjct  224  GEPDCPYYIKTQRCKYGSRCKFNHP  248



>gb|KFK38615.1| hypothetical protein AALP_AA3G137300 [Arabis alpina]
Length=527

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 120/165 (73%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------INPPAAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R              ++P AA+LN+G+VN  A+L+QT    L
Sbjct  354  LKTGSCKYGATCRYNHPERTAFIPQAAGINYPLVSPTAANLNLGMVNSAAALYQT----L  409

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G  + IYPQRPGQ ECDFYMKTGECKF ERCRFHHP D  LS T     +Q N K
Sbjct  410  AQPTLGTLSAIYPQRPGQPECDFYMKTGECKFVERCRFHHPADR-LSATPKQAAQQPNVK  468

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  469  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVLAKTT  513


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 74/161 (46%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP                             R        +  + 
Sbjct  239  IKTQRCKYGLRCKFNHP-----------------------------RAVAEATVESQDVL  269

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ----------NFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  TS   G  +          N  ++
Sbjct  270  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSTSQDNGSSEALTSDPETTSNPHVT  329

Query  414  LA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             A        GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  330  FAPALYHNSKGLPVRPGEADCPFYLKTGSCKYGATCRYNHP  370


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 32/143 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               V  P   +     P   +      T  Y
Sbjct  188  MQTRTCKFGDSCKFDHP---------------VWVPEGGI-----PDWKEAPI-VPTEEY  226

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP        +    E Q+       LP R   
Sbjct  227  PERPGEPDCPYYIKTQRCKYGLRCKFNHP-----RAVAEATVESQDV------LPERPSE  275

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFG TCKF HP
Sbjct  276  PPCTFYMKTGKCKFGLTCKFHHP  298


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 50/89 (56%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            IYPQR G+ +C  YM+T  CKFG+ C+F HP+          EG   ++K    +     
Sbjct  174  IYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPV-------WVPEGGIPDWKEAPIVPTEEY  226

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPYY+KT  CK+G  CKF+HP
Sbjct  227  PERPGEPDCPYYIKTQRCKYGLRCKFNHP  255



>gb|AAG51026.1|AC069474_25 zinc finger protein, putative, 5' partial; 146-2518 [Arabidopsis 
thaliana]
Length=328

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 117/165 (71%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  S +QT    L
Sbjct  154  LKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLNLGLVTPATSFYQT----L  209

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            TQ   G  +  YPQRPGQ ECD+YMKTGECKFGERC+FHHP D  LS  +    +Q N K
Sbjct  210  TQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHPADR-LSAMTKQAPQQPNVK  268

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  269  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  313


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 78/161 (48%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP                    A   +T D               
Sbjct  39   IKTQRCKYGSKCKFNHPREEA----------------AVSVETQD-------------SL  69

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL---------SVTSSMEGEQQN-----  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L         SV  + E +  N     
Sbjct  70   PERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLTSEPDATNNPHVT  129

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  130  FTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHP  170


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 85/171 (50%), Gaps = 30/171 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG-VVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G +C+++HP    I  P++  ++G  V  T+    T +P +T T   +  + 
Sbjct  82   MKTGKCKFGLSCKFHHPK--DIQLPSSSQDIGSSVGLTSEPDATNNPHVTFTPALYHNSK  139

Query  567  -YPQRPGQVECDFYMKTGECKFGERCRFHHP-----LDHSLSVTSSM-EGEQQNFKLSL-  412
              P R G+V+C FY+KTG CK+G  CR++HP     +  +  V  S+      N  L L 
Sbjct  140  GLPVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLNLGLV  199

Query  411  -------------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                               A  P+R G   C YYMKTG CKFG  CKF HP
Sbjct  200  TPATSFYQTLTQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHP  250


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 12/102 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG+ +C +Y+KT  CK+G +C+F+HP +      +++  E Q+       LP R  
Sbjct  26   YPERPGEPDCPYYIKTQRCKYGSKCKFNHPREE-----AAVSVETQD------SLPERPS  74

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
               C +YMKTG CKFG +CKF HP   +L   +SQ   +SVG
Sbjct  75   EPMCTFYMKTGKCKFGLSCKFHHPKDIQLP-SSSQDIGSSVG  115



>ref|XP_008383223.1| PREDICTED: zinc finger CCCH domain-containing protein 37 [Malus 
domestica]
Length=498

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 133/193 (69%), Gaps = 27/193 (14%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP------------AAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDRY INPP            AA LN+GV++P AS++QT    L
Sbjct  317  LKTGSCKYGATCRYNHPDRYAINPPIAAISHPIVATPAAGLNIGVIDPAASIYQT----L  372

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS---LSVTSSMEGEQQ  430
             Q   G   T+YPQR GQ+ECD+YMKTGECKFGE C+FHHP+D S   LS   ++  +  
Sbjct  373  AQPTVGVXPTVYPQRFGQIECDYYMKTGECKFGELCKFHHPIDRSAVALSAPKAVPVQDA  432

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVGEEE  253
            N KL+LAGLPRREG I C YY+KTG CK+GA+CKFDHPPP E++G G +Q TS       
Sbjct  433  NVKLTLAGLPRREGVI-CVYYLKTGTCKYGASCKFDHPPPVEVMGMGATQGTSG------  485

Query  252  GYAKLVEAIQKQQ  214
            G AK  E  Q+QQ
Sbjct  486  GEAKAGEFPQEQQ  498


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 71/143 (50%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      T + 
Sbjct  142  MLTRTCKFGESCKFDHP---------------IWVPEGGI-----PDWKEVPLVAPTEVL  181

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG  +C +++KT  CKFG RC+F+HP D  ++  +S   +       +  LP R   
Sbjct  182  PERPGAPDCPYFIKTQRCKFGMRCKFNHPKDKVIASDASENAD-------VFTLPERPSE  234

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CKFG TCKF HP
Sbjct  235  PPCAFYLKTGQCKFGVTCKFHHP  257


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 77/165 (47%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP    I   A+          A +F                   
Sbjct  194  IKTQRCKFGMRCKFNHPKDKVIASDASE--------NADVF-----------------TL  228

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT----------SSMEGEQQNFKL-  418
            P+RP +  C FY+KTG+CKFG  C+FHHP D  + +           ++++ +   F + 
Sbjct  229  PERPSEPPCAFYLKTGQCKFGVTCKFHHPKDIQIPLANQENKAGETGTAIKTDGTGFSVK  288

Query  417  -----------SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                       +   LP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  289  APISFTPALLYNTKELPVRPGEPDCPFYLKTGSCKYGATCRYNHP  333


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFGE C+F HP+   +      + ++         LP R 
Sbjct  128  IYPQRPGEKDCAHYMLTRTCKFGESCKFDHPI--WVPEGGIPDWKEVPLVAPTEVLPERP  185

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            GA  CPY++KT  CKFG  CKF+HP
Sbjct  186  GAPDCPYFIKTQRCKFGMRCKFNHP  210



>ref|XP_006297429.1| hypothetical protein CARUB_v10013453mg [Capsella rubella]
 gb|EOA30327.1| hypothetical protein CARUB_v10013453mg [Capsella rubella]
Length=503

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 119/165 (72%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPA------------AHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P A            A+LN+G+V P  SL+QT    L
Sbjct  331  LKTGSCKYGATCRYNHPERTAFIPQATGINYSLLSSNAANLNLGMVTPATSLYQT----L  386

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +Q   G  +  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  LS T+    +Q N K
Sbjct  387  SQPTLGGLSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LSATTKQAPQQPNVK  445

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CKFGATCKFDHPPPGE++  T+
Sbjct  446  LSLAGYPRREGAVNCPYYMKTGTCKFGATCKFDHPPPGEVMAKTT  490


 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 77/164 (47%), Gaps = 50/164 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP         A     V N  A                      
Sbjct  213  IKTQRCKYGSRCKFNHPR--------AEAAATVENQDA---------------------L  243

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +  +S   G  +               
Sbjct  244  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQIPSSSQDNGSSEGLTSDPDATNNPHVT  303

Query  426  FKLSL----AGLPRR---EGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R   +G + CP+Y+KTG CK+GATC+++HP
Sbjct  304  FTPALYHNSKGLPVRPLLQGEVDCPFYLKTGSCKYGATCRYNHP  347


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 77/161 (48%), Gaps = 33/161 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               V  P   +     P   +         Y
Sbjct  162  MQTRTCKFGDSCKFDHP---------------VWVPEGGI-----PDWKEAPV-VPNEEY  200

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP   + +   + +            LP R   
Sbjct  201  PERPGEPDCPYYIKTQRCKYGSRCKFNHPRAEAAATVENQD-----------ALPERPSE  249

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YMKTG CKFG TCKF HP   + I  +SQ   +S G
Sbjct  250  PMCTFYMKTGKCKFGLTCKFHHPKDIQ-IPSSSQDNGSSEG  289


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 6/110 (5%)
 Frame = -2

Query  645  VNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS  466
            V  T+  + T  P+L  T       IYPQR G+ +C  YM+T  CKFG+ C+F HP+   
Sbjct  126  VKRTSEDYFTKRPKLESTSH---LPIYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPV---  179

Query  465  LSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                  +   ++   +     P R G   CPYY+KT  CK+G+ CKF+HP
Sbjct  180  WVPEGGIPDWKEAPVVPNEEYPERPGEPDCPYYIKTQRCKYGSRCKFNHP  229



>ref|XP_010499333.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X3 [Camelina sativa]
Length=523

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 119/165 (72%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  SL+QT    L
Sbjct  350  LKTGSCKYGATCRYNHPERTAFIPQAAGINYSLLSSNAANLNLGMVTPATSLYQT----L  405

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +Q   G  +  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ T+    +Q N K
Sbjct  406  SQPTLGAVSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LNATAKQASQQPNVK  464

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  465  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  509


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 74/161 (46%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKY + C++NHP         A     V N                       + 
Sbjct  235  IKTQRCKYASRCKFNHPR--------AEAAASVEN---------------------QDVL  265

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  266  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQGNGSSEVLTSDPDATNNPHVT  325

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  326  FTPALYHNSKGLPVRPGEADCPFYLKTGSCKYGATCRYNHP  366


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 37/163 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP    I  P   +      P                       Y
Sbjct  184  MQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEAPV-----------------VPNEEY  222

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+  RC+F+HP        ++   E Q+       LP R   
Sbjct  223  PERPGEPDCPYYIKTQRCKYASRCKFNHP-----RAEAAASVENQDV------LPERPSE  271

Query  384  IHCPYYMKTGICKFGATCKFDHP-----PPGELIGGTSQVTST  271
              C +YMKTG CKFG TCKF HP     P      G+S+V ++
Sbjct  272  PMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQGNGSSEVLTS  314


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct  170  VYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPI---WVPEGGIPDWKEAPVVPNEEYPERP  226

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+ + CKF+HP
Sbjct  227  GEPDCPYYIKTQRCKYASRCKFNHP  251



>ref|XP_010499317.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Camelina sativa]
Length=526

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 119/165 (72%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  SL+QT    L
Sbjct  353  LKTGSCKYGATCRYNHPERTAFIPQAAGINYSLLSSNAANLNLGMVTPATSLYQT----L  408

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +Q   G  +  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ T+    +Q N K
Sbjct  409  SQPTLGAVSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LNATAKQASQQPNVK  467

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  468  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  512


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 75/164 (46%), Gaps = 50/164 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKY + C++NHP         A     V N                       + 
Sbjct  235  IKTQRCKYASRCKFNHPR--------AEAAASVEN---------------------QDVL  265

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  266  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQGNGSSEVLTSDPDATNNPHVT  325

Query  426  FKLSL----AGLPRR---EGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R   +G   CP+Y+KTG CK+GATC+++HP
Sbjct  326  FTPALYHNSKGLPVRPLLQGEADCPFYLKTGSCKYGATCRYNHP  369


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 37/163 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP    I  P   +      P                       Y
Sbjct  184  MQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEAPV-----------------VPNEEY  222

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+  RC+F+HP        ++   E Q+       LP R   
Sbjct  223  PERPGEPDCPYYIKTQRCKYASRCKFNHP-----RAEAAASVENQDV------LPERPSE  271

Query  384  IHCPYYMKTGICKFGATCKFDHP-----PPGELIGGTSQVTST  271
              C +YMKTG CKFG TCKF HP     P      G+S+V ++
Sbjct  272  PMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQGNGSSEVLTS  314


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            +YPQR G+ +C  YM+T  CKFG+ C+F HP+          EG   ++K    +     
Sbjct  170  VYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPI-------WVPEGGIPDWKEAPVVPNEEY  222

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPYY+KT  CK+ + CKF+HP
Sbjct  223  PERPGEPDCPYYIKTQRCKYASRCKFNHP  251



>ref|XP_006297430.1| hypothetical protein CARUB_v10013453mg [Capsella rubella]
 gb|EOA30328.1| hypothetical protein CARUB_v10013453mg [Capsella rubella]
Length=523

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 119/165 (72%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPA------------AHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P A            A+LN+G+V P  SL+QT    L
Sbjct  351  LKTGSCKYGATCRYNHPERTAFIPQATGINYSLLSSNAANLNLGMVTPATSLYQT----L  406

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +Q   G  +  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  LS T+    +Q N K
Sbjct  407  SQPTLGGLSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LSATTKQAPQQPNVK  465

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CKFGATCKFDHPPPGE++  T+
Sbjct  466  LSLAGYPRREGAVNCPYYMKTGTCKFGATCKFDHPPPGEVMAKTT  510


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 76/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP         A     V N  A                      
Sbjct  236  IKTQRCKYGSRCKFNHPR--------AEAAATVENQDA---------------------L  266

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  +  +S   G  +               
Sbjct  267  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQIPSSSQDNGSSEGLTSDPDATNNPHVT  326

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  327  FTPALYHNSKGLPVRPGEVDCPFYLKTGSCKYGATCRYNHP  367


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 77/161 (48%), Gaps = 33/161 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               V  P   +     P   +         Y
Sbjct  185  MQTRTCKFGDSCKFDHP---------------VWVPEGGI-----PDWKEAPV-VPNEEY  223

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP   + +   + +            LP R   
Sbjct  224  PERPGEPDCPYYIKTQRCKYGSRCKFNHPRAEAAATVENQD-----------ALPERPSE  272

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YMKTG CKFG TCKF HP   + I  +SQ   +S G
Sbjct  273  PMCTFYMKTGKCKFGLTCKFHHPKDIQ-IPSSSQDNGSSEG  312


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQR G+ +C  YM+T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct  171  IYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPV---WVPEGGIPDWKEAPVVPNEEYPERP  227

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G+ CKF+HP
Sbjct  228  GEPDCPYYIKTQRCKYGSRCKFNHP  252



>ref|XP_004517028.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
isoform X2 [Cicer arietinum]
Length=519

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 126/179 (70%), Gaps = 19/179 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP------------PAAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCK+GATCRYNHP    INP             AA+LN+GV+NP A L+Q FDPRL
Sbjct  327  MKTGSCKFGATCRYNHPAMNAINPTISTLAPSVLASSAANLNIGVINPAACLYQAFDPRL  386

Query  600  TQ--TMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
            +   +  G   T++PQRPGQ+ECD+YMKTG CK+GERC++HHPLD +   T SM   Q  
Sbjct  387  SNPVSQVGTTQTVFPQRPGQIECDYYMKTGICKYGERCKYHHPLDRA---TPSMSKLQST  443

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGEL--IGGTSQVTSTSVGEE  256
             KL+ AGLPRREG   CPYY+KTG CKFG TCKFDHPPPGE+  +  +SQ TST+ G E
Sbjct  444  VKLTPAGLPRREGVEICPYYLKTGTCKFGVTCKFDHPPPGEVMEMAKSSQGTSTNNGGE  502


 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 79/166 (48%), Gaps = 54/166 (33%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP     N P+ + +V  +                          
Sbjct  209  LKTKKCKFGSRCKFNHP-----NVPSENADVSGL--------------------------  237

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM----EGEQQNFKLSLA----  409
            P+RP +  C FY+KTG CK+G  C+FHHP D  + V+  +    E  Q N  L  A    
Sbjct  238  PERPLETPCAFYLKTGLCKYGAACKFHHPKDIQIQVSDELSHTVEQTQTNSVLDGATGDS  297

Query  408  ---------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           GLP R G + CP+YMKTG CKFGATC+++HP
Sbjct  298  QPINPLIPPLLHNSKGLPVRLGEVDCPFYMKTGSCKFGATCRYNHP  343


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 90/209 (43%), Gaps = 46/209 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLF-------QTFDPRLTQTMF  586
            LKTG CKYGA C+++HP    I       +      T S+        Q  +P +   + 
Sbjct  250  LKTGLCKYGAACKFHHPKDIQIQVSDELSHTVEQTQTNSVLDGATGDSQPINPLIPPLLH  309

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT------SSMEGEQQNF  424
               +   P R G+V+C FYMKTG CKFG  CR++HP  ++++ T      S +     N 
Sbjct  310  N--SKGLPVRLGEVDCPFYMKTGSCKFGATCRYNHPAMNAINPTISTLAPSVLASSAANL  367

Query  423  KLSLAG--------------------------LPRREGAIHCPYYMKTGICKFGATCKFD  322
             + +                             P+R G I C YYMKTGICK+G  CK+ 
Sbjct  368  NIGVINPAACLYQAFDPRLSNPVSQVGTTQTVFPQRPGQIECDYYMKTGICKYGERCKYH  427

Query  321  HP-----PPGELIGGTSQVTSTSVGEEEG  250
            HP     P    +  T ++T   +   EG
Sbjct  428  HPLDRATPSMSKLQSTVKLTPAGLPRREG  456


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (52%), Gaps = 33/143 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      + I 
Sbjct  157  MLTRTCKFGESCKFDHP---------------IWVPEGGI-----PDWKEVPNIVPSEIL  196

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG RC+F+HP         ++  E  +    ++GLP R   
Sbjct  197  PERPGEPDCPYFLKTKKCKFGSRCKFNHP---------NVPSENAD----VSGLPERPLE  243

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG+CK+GA CKF HP
Sbjct  244  TPCAFYLKTGLCKYGAACKFHHP  266


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 53/95 (56%), Gaps = 12/95 (13%)
 Frame = -2

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----  421
            G    IYPQRPG+ +C  YM T  CKFGE C+F HP+          EG   ++K     
Sbjct  138  GSTLPIYPQRPGEKDCSHYMLTRTCKFGESCKFDHPI-------WVPEGGIPDWKEVPNI  190

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +    LP R G   CPY++KT  CKFG+ CKF+HP
Sbjct  191  VPSEILPERPGEPDCPYFLKTKKCKFGSRCKFNHP  225



>ref|XP_006407308.1| hypothetical protein EUTSA_v10020494mg [Eutrema salsugineum]
 gb|ESQ48761.1| hypothetical protein EUTSA_v10020494mg [Eutrema salsugineum]
Length=510

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 120/175 (69%), Gaps = 17/175 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA             +N+G+VN  ASL+QT    L
Sbjct  338  LKTGSCKYGATCRYNHPERTAFTPQAAGINYPLVSSTAASVNLGLVNSAASLYQT----L  393

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G  + IYPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ T+    +Q N K
Sbjct  394  AQPTLGALSAIYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LNATTKQASQQPNVK  452

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHP PGE++  TS       G +
Sbjct  453  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPAPGEVMAKTSSEADAGGGAD  507


 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 77/164 (47%), Gaps = 50/164 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP         A   V V N  +                      
Sbjct  220  IKTQRCKYGLRCKFNHPR--------AAAAVSVENQDS---------------------L  250

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  251  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQEMGTSEALTSDPDATNNPHVT  310

Query  426  FKLSL----AGLPRR---EGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R   +G + CP+Y+KTG CK+GATC+++HP
Sbjct  311  FTAALYHNSKGLPVRPLLQGEVDCPFYLKTGSCKYGATCRYNHP  354


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 78/160 (49%), Gaps = 32/160 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               +  P   +    +  L           Y
Sbjct  169  MQTRTCKFGESCKFDHP---------------IWVPEGGIPDWKEAPLV------PNDDY  207

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP        +++  E Q+       LP R   
Sbjct  208  PERPGEPDCPYYIKTQRCKYGLRCKFNHP-----RAAAAVSVENQD------SLPERPSE  256

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
              C +YMKTG CKFG TCKF HP   +L   + ++ ++  
Sbjct  257  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQEMGTSEA  296


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQRPG+ +C  YM+T  CKFGE C+F HP+         +   ++   +     P R 
Sbjct  155  VYPQRPGEKDCTHYMQTRTCKFGESCKFDHPI---WVPEGGIPDWKEAPLVPNDDYPERP  211

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G  CKF+HP
Sbjct  212  GEPDCPYYIKTQRCKYGLRCKFNHP  236



>ref|XP_010465044.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
isoform X2 [Camelina sativa]
Length=532

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 119/169 (70%), Gaps = 21/169 (12%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP----------------AAHLNVGVVNPTASLFQTF  613
            LKTGSCKYGATCRYNHP+R    P                 AA+LN+G+V P  SL+QT 
Sbjct  355  LKTGSCKYGATCRYNHPERTAFIPQVIPQAAGINYSLLSSNAANLNLGMVTPATSLYQT-  413

Query  612  DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ  433
               L+Q   G  +  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  LS T+    +Q
Sbjct  414  ---LSQPTLGAVSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LSATTKQASQQ  469

Query  432  QNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
             N KLSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  470  PNVKLSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  518


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKY + C++NHP         A   V V N                       + 
Sbjct  240  IKTQRCKYASRCKFNHPR--------AEAAVSVEN---------------------QDVL  270

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  271  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSSEVLTSDPDATNNPHVT  330

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  331  FTPALYHNSKGLPVRPGEADCPFYLKTGSCKYGATCRYNHP  371


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 75/160 (47%), Gaps = 32/160 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP    I  P   +      P                       Y
Sbjct  189  MQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEAPV-----------------VPNEEY  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+  RC+F+HP        +++  E Q+       LP R   
Sbjct  228  PERPGEPDCPYYIKTQRCKYASRCKFNHP-----RAEAAVSVENQDV------LPERPSE  276

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
              C +YMKTG CKFG TCKF HP   +L   +    S+ V
Sbjct  277  PMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSSEV  316


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct  175  VYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPI---WVPEGGIPDWKEAPVVPNEEYPERP  231

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+ + CKF+HP
Sbjct  232  GEPDCPYYIKTQRCKYASRCKFNHP  256



>ref|XP_006407307.1| hypothetical protein EUTSA_v10020494mg [Eutrema salsugineum]
 gb|ESQ48760.1| hypothetical protein EUTSA_v10020494mg [Eutrema salsugineum]
Length=507

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 120/175 (69%), Gaps = 17/175 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA             +N+G+VN  ASL+QT    L
Sbjct  335  LKTGSCKYGATCRYNHPERTAFTPQAAGINYPLVSSTAASVNLGLVNSAASLYQT----L  390

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G  + IYPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ T+    +Q N K
Sbjct  391  AQPTLGALSAIYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LNATTKQASQQPNVK  449

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHP PGE++  TS       G +
Sbjct  450  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPAPGEVMAKTSSEADAGGGAD  504


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 76/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP         A   V V N  +                      
Sbjct  220  IKTQRCKYGLRCKFNHPR--------AAAAVSVENQDS---------------------L  250

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  251  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQEMGTSEALTSDPDATNNPHVT  310

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  311  FTAALYHNSKGLPVRPGEVDCPFYLKTGSCKYGATCRYNHP  351


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 78/160 (49%), Gaps = 32/160 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               +  P   +    +  L           Y
Sbjct  169  MQTRTCKFGESCKFDHP---------------IWVPEGGIPDWKEAPLV------PNDDY  207

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP        +++  E Q+       LP R   
Sbjct  208  PERPGEPDCPYYIKTQRCKYGLRCKFNHP-----RAAAAVSVENQD------SLPERPSE  256

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
              C +YMKTG CKFG TCKF HP   +L   + ++ ++  
Sbjct  257  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQEMGTSEA  296


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQRPG+ +C  YM+T  CKFGE C+F HP+         +   ++   +     P R 
Sbjct  155  VYPQRPGEKDCTHYMQTRTCKFGESCKFDHPI---WVPEGGIPDWKEAPLVPNDDYPERP  211

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G  CKF+HP
Sbjct  212  GEPDCPYYIKTQRCKYGLRCKFNHP  236



>ref|XP_010465043.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
isoform X1 [Camelina sativa]
Length=535

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 119/169 (70%), Gaps = 21/169 (12%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP----------------AAHLNVGVVNPTASLFQTF  613
            LKTGSCKYGATCRYNHP+R    P                 AA+LN+G+V P  SL+QT 
Sbjct  358  LKTGSCKYGATCRYNHPERTAFIPQVIPQAAGINYSLLSSNAANLNLGMVTPATSLYQT-  416

Query  612  DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ  433
               L+Q   G  +  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  LS T+    +Q
Sbjct  417  ---LSQPTLGAVSATYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LSATTKQASQQ  472

Query  432  QNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
             N KLSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  473  PNVKLSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  521


 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 76/164 (46%), Gaps = 50/164 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKY + C++NHP         A   V V N                       + 
Sbjct  240  IKTQRCKYASRCKFNHPR--------AEAAVSVEN---------------------QDVL  270

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  271  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSSEVLTSDPDATNNPHVT  330

Query  426  FKLSL----AGLPRR---EGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R   +G   CP+Y+KTG CK+GATC+++HP
Sbjct  331  FTPALYHNSKGLPVRPLLQGEADCPFYLKTGSCKYGATCRYNHP  374


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 75/160 (47%), Gaps = 32/160 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP    I  P   +      P                       Y
Sbjct  189  MQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEAPV-----------------VPNEEY  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+  RC+F+HP        +++  E Q+       LP R   
Sbjct  228  PERPGEPDCPYYIKTQRCKYASRCKFNHP-----RAEAAVSVENQDV------LPERPSE  276

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
              C +YMKTG CKFG TCKF HP   +L   +    S+ V
Sbjct  277  PMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSSEV  316


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct  175  VYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPI---WVPEGGIPDWKEAPVVPNEEYPERP  231

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+ + CKF+HP
Sbjct  232  GEPDCPYYIKTQRCKYASRCKFNHP  256



>ref|XP_006407309.1| hypothetical protein EUTSA_v10020494mg [Eutrema salsugineum]
 gb|ESQ48762.1| hypothetical protein EUTSA_v10020494mg [Eutrema salsugineum]
Length=530

 Score =   209 bits (531),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 120/175 (69%), Gaps = 17/175 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA             +N+G+VN  ASL+QT    L
Sbjct  358  LKTGSCKYGATCRYNHPERTAFTPQAAGINYPLVSSTAASVNLGLVNSAASLYQT----L  413

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G  + IYPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ T+    +Q N K
Sbjct  414  AQPTLGALSAIYPQRPGQSECDYYMKTGECKFGERCRFHHPADR-LNATTKQASQQPNVK  472

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHP PGE++  TS       G +
Sbjct  473  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPAPGEVMAKTSSEADAGGGAD  527


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 76/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP         A   V V N  +                      
Sbjct  243  IKTQRCKYGLRCKFNHPR--------AAAAVSVENQDS---------------------L  273

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  274  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQEMGTSEALTSDPDATNNPHVT  333

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  334  FTAALYHNSKGLPVRPGEVDCPFYLKTGSCKYGATCRYNHP  374


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 78/160 (49%), Gaps = 32/160 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP               +  P   +    +  L           Y
Sbjct  192  MQTRTCKFGESCKFDHP---------------IWVPEGGIPDWKEAPLV------PNDDY  230

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP        +++  E Q+       LP R   
Sbjct  231  PERPGEPDCPYYIKTQRCKYGLRCKFNHP-----RAAAAVSVENQD------SLPERPSE  279

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
              C +YMKTG CKFG TCKF HP   +L   + ++ ++  
Sbjct  280  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQEMGTSEA  319


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            +YPQRPG+ +C  YM+T  CKFGE C+F HP+          EG   ++K    +     
Sbjct  178  VYPQRPGEKDCTHYMQTRTCKFGESCKFDHPI-------WVPEGGIPDWKEAPLVPNDDY  230

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPYY+KT  CK+G  CKF+HP
Sbjct  231  PERPGEPDCPYYIKTQRCKYGLRCKFNHP  259



>dbj|BAF01019.1| floral homeotic protein HUA1 [Arabidopsis thaliana]
Length=522

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 117/165 (71%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  S +QT    L
Sbjct  348  LKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLNLGLVTPATSFYQT----L  403

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            TQ   G  +  YPQRPGQ ECD+YMKTGECKFGERC+FHHP D  LS  +    +Q N K
Sbjct  404  TQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHPADR-LSAMTKQAPQQPNVK  462

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  463  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  507


 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 78/161 (48%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP                    A   +T D               
Sbjct  233  IKTQRCKYGSKCKFNHPRE----------------EAAVSVETQD-------------SL  263

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL---------SVTSSMEGEQQN-----  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L         SV  + E +  N     
Sbjct  264  PERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLTSEPDATNNPHVT  323

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  324  FTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHP  364


 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 85/171 (50%), Gaps = 30/171 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG-VVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G +C+++HP    I  P++  ++G  V  T+    T +P +T T   +  + 
Sbjct  276  MKTGKCKFGLSCKFHHPK--DIQLPSSSQDIGSSVGLTSEPDATNNPHVTFTPALYHNSK  333

Query  567  -YPQRPGQVECDFYMKTGECKFGERCRFHHP-----LDHSLSVTSSM-EGEQQNFKLSL-  412
              P R G+V+C FY+KTG CK+G  CR++HP     +  +  V  S+      N  L L 
Sbjct  334  GLPVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLNLGLV  393

Query  411  -------------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                               A  P+R G   C YYMKTG CKFG  CKF HP
Sbjct  394  TPATSFYQTLTQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHP  444


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 33/161 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +CR++HP    I  P   +      P     +                 Y
Sbjct  182  MQTRTCKFGESCRFDHP----IWVPEGGIPDWKEAPVVPNEE-----------------Y  220

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G +C+F+HP +      +++  E Q+       LP R   
Sbjct  221  PERPGEPDCPYYIKTQRCKYGSKCKFNHPREE-----AAVSVETQD------SLPERPSE  269

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YMKTG CKFG +CKF HP   +L   +SQ   +SVG
Sbjct  270  PMCTFYMKTGKCKFGLSCKFHHPKDIQLP-SSSQDIGSSVG  309


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            IYPQR G+ +C  YM+T  CKFGE CRF HP+          EG   ++K    +     
Sbjct  168  IYPQRAGEKDCTHYMQTRTCKFGESCRFDHPI-------WVPEGGIPDWKEAPVVPNEEY  220

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPYY+KT  CK+G+ CKF+HP
Sbjct  221  PERPGEPDCPYYIKTQRCKYGSKCKFNHP  249



>ref|XP_010499325.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Camelina sativa]
Length=526

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 118/165 (72%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  SL+QT    L
Sbjct  353  LKTGSCKYGATCRYNHPERTAFIPQAAGINYSLLSSNAANLNLGMVTPATSLYQT----L  408

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +Q   G  +  YPQRPGQ ECD+YMKTGEC+FGERCRFHHP D  LS T+    +  N K
Sbjct  409  SQPTLGAVSATYPQRPGQSECDYYMKTGECEFGERCRFHHPADR-LSATTKQASQPPNVK  467

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  468  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  512


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 75/164 (46%), Gaps = 50/164 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKY + C++NHP         A     V N                       + 
Sbjct  235  IKTQRCKYASRCKFNHPR--------AEAAASVEN---------------------QDVL  265

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  266  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQGNGSSEVLTSDPDATNNPHVT  325

Query  426  FKLSL----AGLPRR---EGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R   +G   CP+Y+KTG CK+GATC+++HP
Sbjct  326  FTPALYHNSKGLPVRPLLQGEADCPFYLKTGSCKYGATCRYNHP  369


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 37/163 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP    I  P   +      P                       Y
Sbjct  184  MQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEAPV-----------------VPNEEY  222

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+  RC+F+HP        ++   E Q+       LP R   
Sbjct  223  PERPGEPDCPYYIKTQRCKYASRCKFNHP-----RAEAAASVENQDV------LPERPSE  271

Query  384  IHCPYYMKTGICKFGATCKFDHP-----PPGELIGGTSQVTST  271
              C +YMKTG CKFG TCKF HP     P      G+S+V ++
Sbjct  272  PMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQGNGSSEVLTS  314


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            +YPQR G+ +C  YM+T  CKFG+ C+F HP+          EG   ++K    +     
Sbjct  170  VYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPI-------WVPEGGIPDWKEAPVVPNEEY  222

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPYY+KT  CK+ + CKF+HP
Sbjct  223  PERPGEPDCPYYIKTQRCKYASRCKFNHP  251



>ref|NP_187874.2| floral homeotic protein HUA1 [Arabidopsis thaliana]
 sp|Q941Q3.1|C3H37_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 37; 
Short=AtC3H37; AltName: Full=ENHANCER OF AG-4 protein 1 [Arabidopsis 
thaliana]
 gb|AAK01470.1| floral homeotic protein HUA1 [Arabidopsis thaliana]
 gb|AEE75231.1| floral homeotic protein HUA1 [Arabidopsis thaliana]
Length=524

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 117/165 (71%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  S +QT    L
Sbjct  350  LKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLNLGLVTPATSFYQT----L  405

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            TQ   G  +  YPQRPGQ ECD+YMKTGECKFGERC+FHHP D  LS  +    +Q N K
Sbjct  406  TQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHPADR-LSAMTKQAPQQPNVK  464

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  465  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  509


 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 78/161 (48%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP                    A   +T D               
Sbjct  235  IKTQRCKYGSKCKFNHPRE----------------EAAVSVETQD-------------SL  265

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL---------SVTSSMEGEQQN-----  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L         SV  + E +  N     
Sbjct  266  PERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLTSEPDATNNPHVT  325

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  326  FTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHP  366


 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 82/176 (47%), Gaps = 40/176 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV-------NPTASLFQTFDPRLTQTMF  586
            +KTG CK+G +C+++HP    I  P++  ++G         + T +   TF P L     
Sbjct  278  MKTGKCKFGLSCKFHHPK--DIQLPSSSQDIGSSVGLTSEPDATNNPHVTFTPALYHNSK  335

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----LDHSLSVTSSM-EGEQQNF  424
            G      P R G+V+C FY+KTG CK+G  CR++HP     +  +  V  S+      N 
Sbjct  336  GL-----PVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANL  390

Query  423  KLSL--------------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             L L                    A  P+R G   C YYMKTG CKFG  CKF HP
Sbjct  391  NLGLVTPATSFYQTLTQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHP  446


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 33/161 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +CR++HP    I  P   +      P     +                 Y
Sbjct  184  MQTRTCKFGESCRFDHP----IWVPEGGIPDWKEAPVVPNEE-----------------Y  222

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G +C+F+HP +      +++  E Q+       LP R   
Sbjct  223  PERPGEPDCPYYIKTQRCKYGSKCKFNHPREE-----AAVSVETQD------SLPERPSE  271

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YMKTG CKFG +CKF HP   +L   +SQ   +SVG
Sbjct  272  PMCTFYMKTGKCKFGLSCKFHHPKDIQL-PSSSQDIGSSVG  311


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            IYPQR G+ +C  YM+T  CKFGE CRF HP+          EG   ++K    +     
Sbjct  170  IYPQRAGEKDCTHYMQTRTCKFGESCRFDHPI-------WVPEGGIPDWKEAPVVPNEEY  222

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPYY+KT  CK+G+ CKF+HP
Sbjct  223  PERPGEPDCPYYIKTQRCKYGSKCKFNHP  251



>ref|XP_004517027.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
isoform X1 [Cicer arietinum]
Length=520

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 126/180 (70%), Gaps = 20/180 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP------------PAAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCK+GATCRYNHP    INP             AA+LN+GV+NP A L+Q FDPRL
Sbjct  327  MKTGSCKFGATCRYNHPAMNAINPTISTLAPSVLASSAANLNIGVINPAACLYQAFDPRL  386

Query  600  TQ--TMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN  427
            +   +  G   T++PQRPGQ+ECD+YMKTG CK+GERC++HHPLD +   T SM   Q  
Sbjct  387  SNPVSQVGTTQTVFPQRPGQIECDYYMKTGICKYGERCKYHHPLDRA---TPSMSKLQST  443

Query  426  FKLSLAGLPRREGAIH-CPYYMKTGICKFGATCKFDHPPPGEL--IGGTSQVTSTSVGEE  256
             KL+ AGLPRRE  +  CPYY+KTG CKFG TCKFDHPPPGE+  +  +SQ TST+ G E
Sbjct  444  VKLTPAGLPRREKGVEICPYYLKTGTCKFGVTCKFDHPPPGEVMEMAKSSQGTSTNNGGE  503


 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 79/166 (48%), Gaps = 54/166 (33%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP     N P+ + +V  +                          
Sbjct  209  LKTKKCKFGSRCKFNHP-----NVPSENADVSGL--------------------------  237

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM----EGEQQNFKLSLA----  409
            P+RP +  C FY+KTG CK+G  C+FHHP D  + V+  +    E  Q N  L  A    
Sbjct  238  PERPLETPCAFYLKTGLCKYGAACKFHHPKDIQIQVSDELSHTVEQTQTNSVLDGATGDS  297

Query  408  ---------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           GLP R G + CP+YMKTG CKFGATC+++HP
Sbjct  298  QPINPLIPPLLHNSKGLPVRLGEVDCPFYMKTGSCKFGATCRYNHP  343


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 81/182 (45%), Gaps = 41/182 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLF-------QTFDPRLTQTMF  586
            LKTG CKYGA C+++HP    I       +      T S+        Q  +P +   + 
Sbjct  250  LKTGLCKYGAACKFHHPKDIQIQVSDELSHTVEQTQTNSVLDGATGDSQPINPLIPPLLH  309

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT------SSMEGEQQNF  424
               +   P R G+V+C FYMKTG CKFG  CR++HP  ++++ T      S +     N 
Sbjct  310  N--SKGLPVRLGEVDCPFYMKTGSCKFGATCRYNHPAMNAINPTISTLAPSVLASSAANL  367

Query  423  KLSLAG--------------------------LPRREGAIHCPYYMKTGICKFGATCKFD  322
             + +                             P+R G I C YYMKTGICK+G  CK+ 
Sbjct  368  NIGVINPAACLYQAFDPRLSNPVSQVGTTQTVFPQRPGQIECDYYMKTGICKYGERCKYH  427

Query  321  HP  316
            HP
Sbjct  428  HP  429


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (52%), Gaps = 33/143 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      + I 
Sbjct  157  MLTRTCKFGESCKFDHP---------------IWVPEGGI-----PDWKEVPNIVPSEIL  196

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG RC+F+HP         ++  E  +    ++GLP R   
Sbjct  197  PERPGEPDCPYFLKTKKCKFGSRCKFNHP---------NVPSENAD----VSGLPERPLE  243

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG+CK+GA CKF HP
Sbjct  244  TPCAFYLKTGLCKYGAACKFHHP  266


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 53/95 (56%), Gaps = 12/95 (13%)
 Frame = -2

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----  421
            G    IYPQRPG+ +C  YM T  CKFGE C+F HP+          EG   ++K     
Sbjct  138  GSTLPIYPQRPGEKDCSHYMLTRTCKFGESCKFDHPI-------WVPEGGIPDWKEVPNI  190

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +    LP R G   CPY++KT  CKFG+ CKF+HP
Sbjct  191  VPSEILPERPGEPDCPYFLKTKKCKFGSRCKFNHP  225



>ref|XP_009146600.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X3 [Brassica rapa]
Length=533

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 117/162 (72%), Gaps = 17/162 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------INPPAAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R              ++P +A +N+G++N  ASL+QT    L
Sbjct  355  LKTGSCKYGATCRYNHPERTAFTPQAGGINYPLVSPTSASVNLGLINSAASLYQT----L  410

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G  T  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ TS    +Q N K
Sbjct  411  AQPSLGALTATYPQRPGQPECDYYMKTGECKFGERCRFHHPADR-LNATSKQAPQQPNVK  469

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            LSLAG PRREGA +CPYYMKTG CK+GATCKFDHPPPGE++ 
Sbjct  470  LSLAGYPRREGAQNCPYYMKTGTCKYGATCKFDHPPPGEVMA  511


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP             V V  P A                      
Sbjct  240  IKTQRCKYGLRCKFNHPKTAAA--------VTVETPDA---------------------L  270

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ----------NFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +          N  ++
Sbjct  271  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSEPDVTNNPHVT  330

Query  414  LA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             A        GLP R   + CP+Y+KTG CK+GATC+++HP
Sbjct  331  FAPAAYYNSKGLPARPAEVDCPFYLKTGSCKYGATCRYNHP  371


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 73/164 (45%), Gaps = 32/164 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G  C+++HP               V  P   +     P   +         Y
Sbjct  189  MQTRTCKFGEGCKFDHP---------------VWVPEGGI-----PDWKEAPV-VPNDEY  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP   +     + +            LP R   
Sbjct  228  PERPGEPDCPYYIKTQRCKYGLRCKFNHPKTAAAVTVETPD-----------ALPERPSE  276

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
              C +YMKTG CKFG TCKF HP   +L   +    ST     E
Sbjct  277  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSE  320


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFGE C+F HP+         +   ++   +     P R 
Sbjct  175  VYPQRAGEKDCTHYMQTRTCKFGEGCKFDHPV---WVPEGGIPDWKEAPVVPNDEYPERP  231

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G  CKF+HP
Sbjct  232  GEPDCPYYIKTQRCKYGLRCKFNHP  256



>ref|XP_010489794.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like, 
partial [Camelina sativa]
Length=520

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 117/165 (71%), Gaps = 17/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  SL+Q     L
Sbjct  347  LKTGSCKYGATCRYNHPERTAFIPQAAGINYSLLSSNAANLNLGMVTPATSLYQ----NL  402

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +Q   G  +  YPQRPGQ ECD+YMKTGEC+FGERCRFHHP D  LS T+    +  N K
Sbjct  403  SQPTLGAPSATYPQRPGQSECDYYMKTGECEFGERCRFHHPADR-LSATTKQASQPPNVK  461

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  462  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  506


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKY + C++NHP         A   V V N                       + 
Sbjct  232  IKTQRCKYASRCKFNHPR--------AEAAVSVEN---------------------QEVL  262

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ--------------N  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +               
Sbjct  263  PERPSEPMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSSEVLTSDPDATNNPHVT  322

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  323  FTPALYHNSKGLPVRPGEADCPFYLKTGSCKYGATCRYNHP  363


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 74/160 (46%), Gaps = 32/160 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C+++HP    I  P   +      P                       Y
Sbjct  181  MQTRTCKFGDSCKFDHP----IWVPEGGIPDWKEAPV-----------------VPNEEY  219

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+  RC+F+HP        +++  E Q        LP R   
Sbjct  220  PERPGEPDCPYYIKTQRCKYASRCKFNHP-----RAEAAVSVENQEV------LPERPSE  268

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
              C +YMKTG CKFG TCKF HP   +L   +    S+ V
Sbjct  269  PMCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSSEV  308


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct  167  VYPQRAGEKDCTHYMQTRTCKFGDSCKFDHPI---WVPEGGIPDWKEAPVVPNEEYPERP  223

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+ + CKF+HP
Sbjct  224  GEPDCPYYIKTQRCKYASRCKFNHP  248



>ref|XP_010693153.1| PREDICTED: zinc finger CCCH domain-containing protein 37 [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 116/176 (66%), Gaps = 20/176 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDR------------------YTINPPAAHLNVGVVNPTASLFQ  619
            LKTGSCKYGA CRYNHPDR                  + + P  A ++ G++NP AS+FQ
Sbjct  335  LKTGSCKYGANCRYNHPDRNELSSPFSVINPSSAVVGHAVLPALASVSAGLINPAASIFQ  394

Query  618  TFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG  439
            +  P L QT FG    IYPQRPGQ+ECD+YMK GECKFGERC+FHHP+D S    +  + 
Sbjct  395  SLQPGLPQTTFGQVPVIYPQRPGQIECDYYMKRGECKFGERCKFHHPIDRSAPARN--QT  452

Query  438  EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTST  271
             +QN K +LAGLPRREG  HCP+YMKTG C +   CKFDHPPPGE++    + T T
Sbjct  453  LEQNVKFTLAGLPRREGVQHCPFYMKTGTCSYAVNCKFDHPPPGEVMAAAGKETLT  508


 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 80/188 (43%), Gaps = 56/188 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G  C++NHP    I          +   T++     D               
Sbjct  209  LKTQKCKFGLKCKFNHPKDKLI----------LAQDTSAETDASD--------------L  244

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD----------------------------H  469
            P+RP +  C FY KTG+CKFG  C+FHHP D                            +
Sbjct  245  PERPTEPLCSFYTKTGKCKFGAACKFHHPKDIQVPSDGQEADDEEQTHSIDHLGTTSDGN  304

Query  468  SLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
            SL   +S      N K    GLP R G + CP+Y+KTG CK+GA C+++HP   EL    
Sbjct  305  SLKALTSNPASSYNSK----GLPVRMGEVDCPFYLKTGSCKYGANCRYNHPDRNELSSPF  360

Query  288  SQVTSTSV  265
            S +  +S 
Sbjct  361  SVINPSSA  368


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 73/144 (51%), Gaps = 29/144 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G  C+++HP               +  P   +    +P          + IY
Sbjct  158  MLTRTCKFGDNCKFDHP---------------IWVPAGGIPDWKEPP------AVPSEIY  196

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGLPRREG  388
            P+RPG+ +C +++KT +CKFG +C+F+HP D   L+  +S E +  +       LP R  
Sbjct  197  PERPGEPDCPYFLKTQKCKFGLKCKFNHPKDKLILAQDTSAETDASD-------LPERPT  249

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +Y KTG CKFGA CKF HP
Sbjct  250  EPLCSFYTKTGKCKFGAACKFHHP  273


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQRPG+ +C  YM T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct  144  VYPQRPGEKDCTHYMLTRTCKFGDNCKFDHPI---WVPAGGIPDWKEPPAVPSEIYPERP  200

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPY++KT  CKFG  CKF+HP
Sbjct  201  GEPDCPYFLKTQKCKFGLKCKFNHP  225



>ref|XP_009420696.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=510

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 122/184 (66%), Gaps = 15/184 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP-------------PAAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYG+TCRY HP+R  INP              AA+L+ G +NP A+  Q  D R
Sbjct  328  LKTGSCKYGSTCRYTHPER-IINPSLVAGLGQSFLPSAAANLSFGGLNPAANFLQNIDLR  386

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
              Q       TIYPQRPG++ECDFYMKTG+CKFGERC+FHHP+D S   +   +  QQ  
Sbjct  387  SAQASISVIPTIYPQRPGELECDFYMKTGQCKFGERCKFHHPIDRSAPTSVLKQTPQQTV  446

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYA  244
            KL+LAGLPRREGA+ C +YMKTG CKFGA CKFDHPPPGE I   + +  T+ GEE   A
Sbjct  447  KLTLAGLPRREGAVICSFYMKTGTCKFGAACKFDHPPPGEAI-AMATIQGTAEGEETKDA  505

Query  243  KLVE  232
              V+
Sbjct  506  PEVQ  509


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 81/162 (50%), Gaps = 38/162 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP          + + G +     + +T D            +I 
Sbjct  202  MKTQKCKFGIRCKFNHPKE------NGNASAGELGAELQVSETAD-----------ISIL  244

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS---------MEGEQQNFKLSL  412
            P+RP +  C FYMKTG+C FG  C+FHHP D  L + S+         +E + QN K  +
Sbjct  245  PERPSEPVCTFYMKTGKCSFGTSCKFHHPKD--LQILSNIQDSVRHGQLEPQGQNSKTYV  302

Query  411  ----------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                       GLP R G   CP+Y+KTG CK+G+TC++ HP
Sbjct  303  PFTPALMHNSKGLPIRPGEPDCPFYLKTGSCKYGSTCRYTHP  344


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 74/144 (51%), Gaps = 21/144 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CKYG TC+++HP               +  P   +     P   +      +   
Sbjct  150  MMTRTCKYGDTCKFDHP---------------LWVPEGGI-----PDWKEIPLIPTSESL  189

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLS-LAGLPRREG  388
            P+RPG+ +C +YMKT +CKFG RC+F+HP ++  +    +  E Q  + + ++ LP R  
Sbjct  190  PERPGEPDCPYYMKTQKCKFGIRCKFNHPKENGNASAGELGAELQVSETADISILPERPS  249

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +YMKTG C FG +CKF HP
Sbjct  250  EPVCTFYMKTGKCSFGTSCKFHHP  273


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 70/136 (51%), Gaps = 16/136 (12%)
 Frame = -2

Query  645  VNPTASLFQTFD----PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP  478
            +  T +LF T      PRL     G    IYPQRPG+ +C +YM T  CK+G+ C+F HP
Sbjct  110  IGQTEALFSTNSLIKRPRLET---GSNLPIYPQRPGEKDCAYYMMTRTCKYGDTCKFDHP  166

Query  477  LDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP------  316
            L   +      + ++     +   LP R G   CPYYMKT  CKFG  CKF+HP      
Sbjct  167  L--WVPEGGIPDWKEIPLIPTSESLPERPGEPDCPYYMKTQKCKFGIRCKFNHPKENGNA  224

Query  315  PPGELIGGTSQVTSTS  268
              GEL G   QV+ T+
Sbjct  225  SAGEL-GAELQVSETA  239



>ref|XP_009420703.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=508

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 122/184 (66%), Gaps = 15/184 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP-------------PAAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYG+TCRY HP+R  INP              AA+L+ G +NP A+  Q  D R
Sbjct  326  LKTGSCKYGSTCRYTHPER-IINPSLVAGLGQSFLPSAAANLSFGGLNPAANFLQNIDLR  384

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
              Q       TIYPQRPG++ECDFYMKTG+CKFGERC+FHHP+D S   +   +  QQ  
Sbjct  385  SAQASISVIPTIYPQRPGELECDFYMKTGQCKFGERCKFHHPIDRSAPTSVLKQTPQQTV  444

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYA  244
            KL+LAGLPRREGA+ C +YMKTG CKFGA CKFDHPPPGE I   + +  T+ GEE   A
Sbjct  445  KLTLAGLPRREGAVICSFYMKTGTCKFGAACKFDHPPPGEAI-AMATIQGTAEGEETKDA  503

Query  243  KLVE  232
              V+
Sbjct  504  PEVQ  507


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 82/162 (51%), Gaps = 40/162 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP +   N  A  L        A + +T D            +I 
Sbjct  202  MKTQKCKFGIRCKFNHP-KENGNASAGELG-------AEVSETAD-----------ISIL  242

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS---------MEGEQQNFKLSL  412
            P+RP +  C FYMKTG+C FG  C+FHHP D  L + S+         +E + QN K  +
Sbjct  243  PERPSEPVCTFYMKTGKCSFGTSCKFHHPKD--LQILSNIQDSVRHGQLEPQGQNSKTYV  300

Query  411  ----------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                       GLP R G   CP+Y+KTG CK+G+TC++ HP
Sbjct  301  PFTPALMHNSKGLPIRPGEPDCPFYLKTGSCKYGSTCRYTHP  342


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 69/140 (49%), Gaps = 15/140 (11%)
 Frame = -2

Query  645  VNPTASLFQTFD----PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP  478
            +  T +LF T      PRL     G    IYPQRPG+ +C +YM T  CK+G+ C+F HP
Sbjct  110  IGQTEALFSTNSLIKRPRLET---GSNLPIYPQRPGEKDCAYYMMTRTCKYGDTCKFDHP  166

Query  477  LDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP------  316
            L   +      + ++     +   LP R G   CPYYMKT  CKFG  CKF+HP      
Sbjct  167  L--WVPEGGIPDWKEIPLIPTSESLPERPGEPDCPYYMKTQKCKFGIRCKFNHPKENGNA  224

Query  315  PPGELIGGTSQVTSTSVGEE  256
              GEL    S+    S+  E
Sbjct  225  SAGELGAEVSETADISILPE  244



>ref|XP_009146599.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Brassica rapa]
Length=537

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 115/162 (71%), Gaps = 13/162 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------INPPAAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R              ++P +A +N+G++N  ASL+QT     
Sbjct  355  LKTGSCKYGATCRYNHPERTAFTPQAGGINYPLVSPTSASVNLGLINSAASLYQTLAQPS  414

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
                 G  T  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ TS    +Q N K
Sbjct  415  NLLQLGALTATYPQRPGQPECDYYMKTGECKFGERCRFHHPADR-LNATSKQAPQQPNVK  473

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            LSLAG PRREGA +CPYYMKTG CK+GATCKFDHPPPGE++ 
Sbjct  474  LSLAGYPRREGAQNCPYYMKTGTCKYGATCKFDHPPPGEVMA  515


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP             V V  P A                      
Sbjct  240  IKTQRCKYGLRCKFNHPKTAAA--------VTVETPDA---------------------L  270

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ----------NFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +          N  ++
Sbjct  271  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSEPDVTNNPHVT  330

Query  414  LA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             A        GLP R   + CP+Y+KTG CK+GATC+++HP
Sbjct  331  FAPAAYYNSKGLPARPAEVDCPFYLKTGSCKYGATCRYNHP  371


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 73/164 (45%), Gaps = 32/164 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G  C+++HP               V  P   +     P   +         Y
Sbjct  189  MQTRTCKFGEGCKFDHP---------------VWVPEGGI-----PDWKEAPV-VPNDEY  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP   +     + +            LP R   
Sbjct  228  PERPGEPDCPYYIKTQRCKYGLRCKFNHPKTAAAVTVETPD-----------ALPERPSE  276

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
              C +YMKTG CKFG TCKF HP   +L   +    ST     E
Sbjct  277  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSE  320


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFGE C+F HP+         +   ++   +     P R 
Sbjct  175  VYPQRAGEKDCTHYMQTRTCKFGEGCKFDHPV---WVPEGGIPDWKEAPVVPNDEYPERP  231

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G  CKF+HP
Sbjct  232  GEPDCPYYIKTQRCKYGLRCKFNHP  256



>ref|XP_004295542.1| PREDICTED: zinc finger CCCH domain-containing protein 37 [Fragaria 
vesca subsp. vesca]
Length=500

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 124/175 (71%), Gaps = 18/175 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHL------------NVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHPDRY INPP A +            N+GV NP+A  +QT    L
Sbjct  327  LKTGSCKYGATCRYNHPDRYDINPPVAAISYPLPAPSVAGFNLGVANPSAFTYQT----L  382

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNF  424
             QT  G   T+YPQR GQ EC++YMKTG CK+G +CRFHHP+D  ++ ++++   +Q+N 
Sbjct  383  GQTTMGVNPTVYPQRFGQTECEYYMKTGVCKYGAQCRFHHPIDRPAVPLSTTKPSQQENV  442

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-GTSQVTSTSVG  262
            KL+LAGLPRREGA+ C YY+KTG CK+ A+C+FDHPPPGE++    SQ  S S G
Sbjct  443  KLTLAGLPRREGAVICVYYLKTGTCKYAASCRFDHPPPGEVVAMAASQAKSDSTG  497


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 72/143 (50%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G  C+++HP               +  P   +     P   +      +   
Sbjct  152  MQTRTCKFGEACKFDHP---------------IWVPEGGI-----PDWKEVPLAAPSESL  191

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG  +C +++KT  CKFG RC+F+HP D   +  +S  G+       +  LP R   
Sbjct  192  PERPGAPDCPYFLKTQRCKFGLRCKFNHPKDKLATAGASENGD-------VNALPERPSE  244

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CK+GATCKF+HP
Sbjct  245  PPCAFYLKTGQCKYGATCKFNHP  267


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 75/165 (45%), Gaps = 47/165 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G  C++NHP        A     G VN                         
Sbjct  204  LKTQRCKFGLRCKFNHPKDKLAT--AGASENGDVN-----------------------AL  238

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS----SMEGEQQ-----------  430
            P+RP +  C FY+KTG+CK+G  C+F+HP D  +  T+    S E E             
Sbjct  239  PERPSEPPCAFYLKTGQCKYGATCKFNHPKDIQIPSTTQENKSAETETALKTESSEVAVK  298

Query  429  ---NFKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               +F  +L      LP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  299  PLVSFTPALLYNSKELPVRPGEADCPFYLKTGSCKYGATCRYNHP  343


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 58/101 (57%), Gaps = 12/101 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-LSLAG----  406
            IYPQRPG+ +C  YM+T  CKFGE C+F HP+          EG   ++K + LA     
Sbjct  138  IYPQRPGEKDCAHYMQTRTCKFGEACKFDHPI-------WVPEGGIPDWKEVPLAAPSES  190

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQ  283
            LP R GA  CPY++KT  CKFG  CKF+HP       G S+
Sbjct  191  LPERPGAPDCPYFLKTQRCKFGLRCKFNHPKDKLATAGASE  231



>ref|XP_010557387.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
[Tarenaya hassleriana]
Length=391

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 117/170 (69%), Gaps = 25/170 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LK GSCKYG TCRYNHPDR    PPAA            ++N+GVV P ASL+Q      
Sbjct  230  LKMGSCKYGPTCRYNHPDRTAFVPPAAGITYPLVASTAANVNLGVVTPAASLYQP-----  284

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
                      +YPQRPGQ ECD+YMKTGECKFGERC+FHHP+D S + TS  +  Q++ K
Sbjct  285  -------TIGVYPQRPGQAECDYYMKTGECKFGERCKFHHPIDRSAAATSK-QASQESVK  336

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTST  271
            L+LAG PRREGA+HCPYYMKTG+CK+GA CKFDHPPPGE++  T+    T
Sbjct  337  LTLAGYPRREGAVHCPYYMKTGMCKYGAACKFDHPPPGEVMTRTTTSLET  386


 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 74/152 (49%), Gaps = 38/152 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CKYG+ C++NHP   T          G ++ + +L                    
Sbjct  124  LKTQRCKYGSRCKFNHPKAMT---------AGTLDYSDAL--------------------  154

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKL---------SL  412
            P RP +  C FYMKTG+CKFG  C+FHHP D  +S +    G  +             + 
Sbjct  155  PDRPSEPPCAFYMKTGKCKFGPSCKFHHPKDIQISYSGQETGSSEGLTSLTFTPAPYHNS  214

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             GLP R G + CP+Y+K G CK+G TC+++HP
Sbjct  215  KGLPVRPGEVDCPFYLKMGSCKYGPTCRYNHP  246


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 84/178 (47%), Gaps = 27/178 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+G +C+++HP    I+   +    G      SL  TF P       G      
Sbjct  167  MKTGKCKFGPSCKFHHPKDIQIS--YSGQETGSSEGLTSL--TFTPAPYHNSKGL-----  217

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP-----------LDHSLSVTSS-------MEG  439
            P RPG+V+C FY+K G CK+G  CR++HP           + + L  +++       +  
Sbjct  218  PVRPGEVDCPFYLKMGSCKYGPTCRYNHPDRTAFVPPAAGITYPLVASTAANVNLGVVTP  277

Query  438  EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV  265
                ++ ++   P+R G   C YYMKTG CKFG  CKF HP        + Q +  SV
Sbjct  278  AASLYQPTIGVYPQRPGQAECDYYMKTGECKFGERCKFHHPIDRSAAATSKQASQESV  335


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG----L  403
            IYPQRPG+ +C  YM+T  CKFG+ C+F HP+          EG   ++K +        
Sbjct  59   IYPQRPGEKDCTHYMQTRTCKFGDSCKFDHPI-------WVPEGGIPDWKEAPLAPNEPY  111

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPYY+KT  CK+G+ CKF+HP
Sbjct  112  PVRPGEPDCPYYLKTQRCKYGSRCKFNHP  140



>ref|XP_004517029.1| PREDICTED: zinc finger CCCH domain-containing protein 37-like 
isoform X3 [Cicer arietinum]
Length=503

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 13/168 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQ--TMFGFATT  571
            +KTGSCK+GATCRYNHP    +N  AA+LN+GV+NP A L+Q FDPRL+   +  G   T
Sbjct  327  MKTGSCKFGATCRYNHP---AMN--AANLNIGVINPAACLYQAFDPRLSNPVSQVGTTQT  381

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            ++PQRPGQ+ECD+YMKTG CK+GERC++HHPLD +   T SM   Q   KL+ AGLPRRE
Sbjct  382  VFPQRPGQIECDYYMKTGICKYGERCKYHHPLDRA---TPSMSKLQSTVKLTPAGLPRRE  438

Query  390  GAIH-CPYYMKTGICKFGATCKFDHPPPGEL--IGGTSQVTSTSVGEE  256
              +  CPYY+KTG CKFG TCKFDHPPPGE+  +  +SQ TST+ G E
Sbjct  439  KGVEICPYYLKTGTCKFGVTCKFDHPPPGEVMEMAKSSQGTSTNNGGE  486


 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 79/166 (48%), Gaps = 54/166 (33%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CK+G+ C++NHP     N P+ + +V  +                          
Sbjct  209  LKTKKCKFGSRCKFNHP-----NVPSENADVSGL--------------------------  237

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM----EGEQQNFKLSLA----  409
            P+RP +  C FY+KTG CK+G  C+FHHP D  + V+  +    E  Q N  L  A    
Sbjct  238  PERPLETPCAFYLKTGLCKYGAACKFHHPKDIQIQVSDELSHTVEQTQTNSVLDGATGDS  297

Query  408  ---------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           GLP R G + CP+YMKTG CKFGATC+++HP
Sbjct  298  QPINPLIPPLLHNSKGLPVRLGEVDCPFYMKTGSCKFGATCRYNHP  343


 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 80/165 (48%), Gaps = 24/165 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLF-------QTFDPRLTQTMF  586
            LKTG CKYGA C+++HP    I       +      T S+        Q  +P +   + 
Sbjct  250  LKTGLCKYGAACKFHHPKDIQIQVSDELSHTVEQTQTNSVLDGATGDSQPINPLIPPLLH  309

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP----LDHSLSVTSSMEGEQQNFKL  418
               +   P R G+V+C FYMKTG CKFG  CR++HP     + ++ V +      Q F  
Sbjct  310  N--SKGLPVRLGEVDCPFYMKTGSCKFGATCRYNHPAMNAANLNIGVINPAACLYQAFDP  367

Query  417  SLAG-----------LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             L+             P+R G I C YYMKTGICK+G  CK+ HP
Sbjct  368  RLSNPVSQVGTTQTVFPQRPGQIECDYYMKTGICKYGERCKYHHP  412


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (52%), Gaps = 33/143 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      + I 
Sbjct  157  MLTRTCKFGESCKFDHP---------------IWVPEGGI-----PDWKEVPNIVPSEIL  196

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT +CKFG RC+F+HP         ++  E  +    ++GLP R   
Sbjct  197  PERPGEPDCPYFLKTKKCKFGSRCKFNHP---------NVPSENAD----VSGLPERPLE  243

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG+CK+GA CKF HP
Sbjct  244  TPCAFYLKTGLCKYGAACKFHHP  266


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 53/95 (56%), Gaps = 12/95 (13%)
 Frame = -2

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----  421
            G    IYPQRPG+ +C  YM T  CKFGE C+F HP+          EG   ++K     
Sbjct  138  GSTLPIYPQRPGEKDCSHYMLTRTCKFGESCKFDHPI-------WVPEGGIPDWKEVPNI  190

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +    LP R G   CPY++KT  CKFG+ CKF+HP
Sbjct  191  VPSEILPERPGEPDCPYFLKTKKCKFGSRCKFNHP  225



>emb|CDY42164.1| BnaC05g40550D [Brassica napus]
Length=542

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 117/168 (70%), Gaps = 16/168 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------INPPAAHLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R              ++P +A +N+G++N  ASL+QT     
Sbjct  360  LKTGSCKYGATCRYNHPERTAFTPQAAGINYPLVSPTSASVNLGLINSAASLYQTLAQPT  419

Query  600  TQT---MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
                    G  T  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ TS    +Q 
Sbjct  420  VDVYNHALGALTATYPQRPGQPECDYYMKTGECKFGERCRFHHPADR-LNATSKQAPQQP  478

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            N KLSLAG PRREGA +CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  479  NVKLSLAGYPRREGAQNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTA  526


 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP             V V  P A                      
Sbjct  245  IKTQRCKYGLRCKFNHPKTAAA--------VTVETPDA---------------------L  275

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ----------NFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +          N  ++
Sbjct  276  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSEPDVTNNPHVT  335

Query  414  LA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             A        GLP R   + CP+Y+KTG CK+GATC+++HP
Sbjct  336  FAPAAYYNSKGLPARPAEVDCPFYLKTGSCKYGATCRYNHP  376


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 73/164 (45%), Gaps = 32/164 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G  C+++HP               V  P   +     P   +         Y
Sbjct  194  MQTRTCKFGEGCKFDHP---------------VWVPEGGI-----PDWKEAPV-VPNDEY  232

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP   +     + +            LP R   
Sbjct  233  PERPGEPDCPYYIKTQRCKYGLRCKFNHPKTAAAVTVETPD-----------ALPERPSE  281

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
              C +YMKTG CKFG TCKF HP   +L   +    ST     E
Sbjct  282  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSE  325


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFGE C+F HP+         +   ++   +     P R 
Sbjct  180  VYPQRAGEKDCTHYMQTRTCKFGEGCKFDHPV---WVPEGGIPDWKEAPVVPNDEYPERP  236

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G  CKF+HP
Sbjct  237  GEPDCPYYIKTQRCKYGLRCKFNHP  261



>ref|XP_009146598.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X1 [Brassica rapa]
Length=540

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 117/165 (71%), Gaps = 16/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------INPPAAHLNVGVVNPTASLFQTF-DPR  604
            LKTGSCKYGATCRYNHP+R              ++P +A +N+G++N  ASL+QT   P 
Sbjct  355  LKTGSCKYGATCRYNHPERTAFTPQAGGINYPLVSPTSASVNLGLINSAASLYQTLAQPS  414

Query  603  LT--QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            +       G  T  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ TS    +Q 
Sbjct  415  VDVYNHALGALTATYPQRPGQPECDYYMKTGECKFGERCRFHHPADR-LNATSKQAPQQP  473

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            N KLSLAG PRREGA +CPYYMKTG CK+GATCKFDHPPPGE++ 
Sbjct  474  NVKLSLAGYPRREGAQNCPYYMKTGTCKYGATCKFDHPPPGEVMA  518


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP             V V  P A                      
Sbjct  240  IKTQRCKYGLRCKFNHPKTAAA--------VTVETPDA---------------------L  270

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ----------NFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +          N  ++
Sbjct  271  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSEPDVTNNPHVT  330

Query  414  LA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             A        GLP R   + CP+Y+KTG CK+GATC+++HP
Sbjct  331  FAPAAYYNSKGLPARPAEVDCPFYLKTGSCKYGATCRYNHP  371


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 73/164 (45%), Gaps = 32/164 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G  C+++HP               V  P   +     P   +         Y
Sbjct  189  MQTRTCKFGEGCKFDHP---------------VWVPEGGI-----PDWKEAPV-VPNDEY  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP   +     + +            LP R   
Sbjct  228  PERPGEPDCPYYIKTQRCKYGLRCKFNHPKTAAAVTVETPD-----------ALPERPSE  276

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
              C +YMKTG CKFG TCKF HP   +L   +    ST     E
Sbjct  277  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSE  320


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFGE C+F HP+         +   ++   +     P R 
Sbjct  175  VYPQRAGEKDCTHYMQTRTCKFGEGCKFDHPV---WVPEGGIPDWKEAPVVPNDEYPERP  231

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G  CKF+HP
Sbjct  232  GEPDCPYYIKTQRCKYGLRCKFNHP  256



>emb|CDY08415.1| BnaA05g26510D [Brassica napus]
Length=538

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 117/165 (71%), Gaps = 16/165 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------INPPAAHLNVGVVNPTASLFQTF-DPR  604
            LKTGSCKYGATCRYNHP+R              ++P +A +N+G++N  ASL+QT   P 
Sbjct  355  LKTGSCKYGATCRYNHPERTAFTPQAGGINYPLVSPTSASVNLGLINSAASLYQTLAQPS  414

Query  603  LT--QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            +       G  T  YPQRPGQ ECD+YMKTGECKFGERCRFHHP D  L+ TS    +Q 
Sbjct  415  VDVYNHALGALTATYPQRPGQPECDYYMKTGECKFGERCRFHHPADR-LNATSKQAPQQP  473

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            N KLSLAG PRREGA +CPYYMKTG CK+GATCKFDHPPPGE++ 
Sbjct  474  NVKLSLAGYPRREGAQNCPYYMKTGTCKYGATCKFDHPPPGEVMA  518


 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 75/161 (47%), Gaps = 47/161 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG  C++NHP             V V  P A                      
Sbjct  240  IKTQRCKYGLRCKFNHPKTAAA--------VTVETPDA---------------------L  270

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ----------NFKLS  415
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L  +S   G  +          N  ++
Sbjct  271  PERPSEPPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSEPDVTNNPHVT  330

Query  414  LA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             A        GLP R   + CP+Y+KTG CK+GATC+++HP
Sbjct  331  FAPAAYYNSKGLPARPAEVDCPFYLKTGSCKYGATCRYNHP  371


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 73/164 (45%), Gaps = 32/164 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G  C+++HP               V  P   +     P   +         Y
Sbjct  189  MQTRTCKFGEGCKFDHP---------------VWVPEGGI-----PDWKEAPV-VPNDEY  227

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G RC+F+HP   +     + +            LP R   
Sbjct  228  PERPGEPDCPYYIKTQRCKYGLRCKFNHPKTAAAVTVETPD-----------ALPERPSE  276

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
              C +YMKTG CKFG TCKF HP   +L   +    ST     E
Sbjct  277  PPCTFYMKTGKCKFGLTCKFHHPKDIQLPSSSQDNGSTEAVTSE  320


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQR G+ +C  YM+T  CKFGE C+F HP+         +   ++   +     P R 
Sbjct  175  VYPQRAGEKDCTHYMQTRTCKFGEGCKFDHPV---WVPEGGIPDWKEAPVVPNDEYPERP  231

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CPYY+KT  CK+G  CKF+HP
Sbjct  232  GEPDCPYYIKTQRCKYGLRCKFNHP  256



>ref|XP_008798450.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
[Phoenix dactylifera]
Length=515

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 116/168 (69%), Gaps = 18/168 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTM---FGFAT  574
            LKTGSCKYGATCRYNHPDR + NPP A          +SL Q   P     +    G   
Sbjct  355  LKTGSCKYGATCRYNHPDRNSFNPPLA----------SSLGQAIMPSPATNLPFGLGVIP  404

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            TIYPQRPG++ECD+YMKTG CKFGERC+FHHP+D    V+ + +  QQNFKL+L+GLPRR
Sbjct  405  TIYPQRPGEIECDYYMKTGLCKFGERCKFHHPIDRLAPVSDAKQAPQQNFKLTLSGLPRR  464

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELIG-----GTSQVTSTSV  265
            EGA+ C +YMKTG CKFGA CKFDHPPPGE+I      GT   T+T +
Sbjct  465  EGAVICFFYMKTGTCKFGAKCKFDHPPPGEVIAMAASQGTGSGTATGL  512


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 76/160 (48%), Gaps = 19/160 (12%)
 Frame = -2

Query  738  TGSCKYGATCRYNHPDRYTINPPAAHL-NVGVVN-PTASLFQTFDPRLTQTMFGFATTI-  568
            TG CK+G  C+++HP    I        N G +           DP+L +        + 
Sbjct  277  TGKCKFGPNCKFHHPKDLKIPSHGEDTDNTGQMELEKDDGAAGGDPKLAKAHIPITPALL  336

Query  567  -----YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS--VTSS-----MEGEQQNF  424
                  P R G+ +C FY+KTG CK+G  CR++HP  +S +  + SS     M     N 
Sbjct  337  HNSKGLPIRLGEADCPFYLKTGSCKYGATCRYNHPDRNSFNPPLASSLGQAIMPSPATNL  396

Query  423  KLSLAGL----PRREGAIHCPYYMKTGICKFGATCKFDHP  316
               L  +    P+R G I C YYMKTG+CKFG  CKF HP
Sbjct  397  PFGLGVIPTIYPQRPGEIECDYYMKTGLCKFGERCKFHHP  436


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 76/169 (45%), Gaps = 52/169 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C+++HP          H + G                     G   ++ 
Sbjct  229  MKTQKCKFGYRCKFHHPKD------KLHASAGE--------------------GTENSVL  262

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------SVTSSMEGEQQNF------  424
            P RP +  C FY  TG+CKFG  C+FHHP D  +         T  ME E+ +       
Sbjct  263  PVRPSESSCWFYAMTGKCKFGPNCKFHHPKDLKIPSHGEDTDNTGQMELEKDDGAAGGDP  322

Query  423  KLSLA-------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            KL+ A             GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  323  KLAKAHIPITPALLHNSKGLPIRLGEADCPFYLKTGSCKYGATCRYNHP  371


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (50%), Gaps = 28/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +  F   +   
Sbjct  177  MLTRTCKFGNSCKFDHP---------------IWVPEGGI-----PDWKEIPFVPTSESL  216

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +YMKT +CKFG RC+FHHP D   +  S+ EG + +       LP R   
Sbjct  217  PERPGEPDCSYYMKTQKCKFGYRCKFHHPKDKLHA--SAGEGTENSV------LPVRPSE  268

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y  TG CKFG  CKF HP
Sbjct  269  SSCWFYAMTGKCKFGPNCKFHHP  291


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++  F  +   LP R 
Sbjct  163  IYPQRPGEKDCAHYMLTRTCKFGNSCKFDHPI--WVPEGGIPDWKEIPFVPTSESLPERP  220

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YYMKT  CKFG  CKF HP
Sbjct  221  GEPDCSYYMKTQKCKFGYRCKFHHP  245



>gb|EPS67891.1| hypothetical protein M569_06884, partial [Genlisea aurea]
Length=452

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 110/159 (69%), Gaps = 24/159 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------INPPAAHLNVGVVNPTASLFQTFDPRLTQT---  592
            LKTGSCKYGATC +NHPDRY       +   + H  V    PTASL   FDPRL+QT   
Sbjct  308  LKTGSCKYGATCHFNHPDRYAAIASNLLTSSSTHFGV----PTASLLPNFDPRLSQTTAS  363

Query  591  MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSL  412
            + G  + IYPQRPGQ+ECDFYMKTG CK+G  C +HHP           E   +N KL+L
Sbjct  364  LLGLVSAIYPQRPGQLECDFYMKTGTCKYGSSCIYHHP-----------EHRAENVKLTL  412

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            +GLPRREGAIHCP+YMKTG+CK+G TCKFDHPPPGE+I 
Sbjct  413  SGLPRREGAIHCPFYMKTGLCKYGVTCKFDHPPPGEVIA  451


 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 77/143 (54%), Gaps = 28/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +C ++HP             + V    A  ++       +++        
Sbjct  139  MQTRTCKFGDSCIFHHP-------------IWVPEGGAPNWKEVPAMPIESL--------  177

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPGQ +C ++MKT  CKFG RCRF+HP D       + +G+ +N  LS   LP R   
Sbjct  178  PERPGQPDCPYFMKTRRCKFGSRCRFNHPKD-----LIAQQGDLENGNLS--SLPERPSE  230

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +YMKTG CKFGATCKFDHP
Sbjct  231  PPCAFYMKTGKCKFGATCKFDHP  253


 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            +YPQRPG+ +CD+YM+T  CKFG+ C FHHP+          EG   N+K    + +  L
Sbjct  125  VYPQRPGEKDCDYYMQTRTCKFGDSCIFHHPI-------WVPEGGAPNWKEVPAMPIESL  177

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPY+MKT  CKFG+ C+F+HP
Sbjct  178  PERPGQPDCPYFMKTRRCKFGSRCRFNHP  206


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 73/160 (46%), Gaps = 42/160 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G+ CR+NHP           L  G +                       +  
Sbjct  190  MKTRRCKFGSRCRFNHPKDLIAQ--QGDLENGNL-----------------------SSL  224

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD-HSL------------SVTSSMEGEQQNF  424
            P+RP +  C FYMKTG+CKFG  C+F HP D H L             V    +  QQ  
Sbjct  225  PERPSEPPCAFYMKTGKCKFGATCKFDHPKDVHPLCDGDENGACIPYKVAGDAKPAQQPA  284

Query  423  KLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              +L     GLP R G   CP+Y+KTG CK+GATC F+HP
Sbjct  285  SPALMHNSKGLPVRLGEEDCPFYLKTGSCKYGATCHFNHP  324



>ref|XP_010913397.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
isoform X2 [Elaeis guineensis]
Length=560

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 116/212 (55%), Gaps = 62/212 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP-------------AAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYGATCRYNHPDR + NPP             A +L  GV++P AS  Q  + +
Sbjct  326  LKTGSCKYGATCRYNHPDRNSFNPPLASALGQAIMPSPATNLPFGVLDPAASFLQNINLQ  385

Query  603  LTQTMFGFATTIYPQRPGQVECD-------------------------------------  535
              Q   G   T+YPQRPG++ECD                                     
Sbjct  386  SAQASLGVIPTVYPQRPGEIECDVRIDSILFVLGLLTASRAHLTLGPITRVAKNASLYTV  445

Query  534  ------------FYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
                        +YMKTG CKFGERC+FHHP+D S  ++ + +  QQN KL+LAGLPRRE
Sbjct  446  SLSLMLASFYSHYYMKTGLCKFGERCKFHHPIDRSAPMSDAKQAPQQNVKLTLAGLPRRE  505

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            GA+ C +Y+KTG CKFG TCKFDHPPPGE I 
Sbjct  506  GAVICSFYLKTGTCKFGTTCKFDHPPPGEAIA  537


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 83/170 (49%), Gaps = 31/170 (18%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQT-FDPRLTQTMFGFATTI  568
            + T +C +G +C+++HP             + +V  + SL +   +P       G   ++
Sbjct  177  MLTRTCTFGNSCKFDHPIWVPEGGIPDWKEIPLVPASESLPEKPGEPDCP----GTENSV  232

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------SVTSSMEGEQQNF-----  424
             P+RP +  C FY KTG+CKFG  C+FHHP D  +            ME E+ +      
Sbjct  233  LPERPSEPLCSFYAKTGKCKFGPNCKFHHPKDLKIPPDGEDTDKMGEMESEKNDGSAGGD  292

Query  423  -KLSLA-------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             KL+ A             GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  293  PKLAKAHVSITPALLHNSKGLPIRPGEADCPFYLKTGSCKYGATCRYNHP  342


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 60/136 (44%), Gaps = 22/136 (16%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPL---------DHSLSVTSSME------GE  436
            IYPQRPG+ +C  YM T  C FG  C+F HP+            + +  + E      GE
Sbjct  163  IYPQRPGEKDCAHYMLTRTCTFGNSCKFDHPIWVPEGGIPDWKEIPLVPASESLPEKPGE  222

Query  435  QQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH------PPPGELIGGTSQVTS  274
                    + LP R     C +Y KTG CKFG  CKF H      PP GE      ++ S
Sbjct  223  PDCPGTENSVLPERPSEPLCSFYAKTGKCKFGPNCKFHHPKDLKIPPDGEDTDKMGEMES  282

Query  273  -TSVGEEEGYAKLVEA  229
              + G   G  KL +A
Sbjct  283  EKNDGSAGGDPKLAKA  298



>ref|XP_010913389.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
isoform X1 [Elaeis guineensis]
Length=593

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 116/212 (55%), Gaps = 62/212 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPP-------------AAHLNVGVVNPTASLFQTFDPR  604
            LKTGSCKYGATCRYNHPDR + NPP             A +L  GV++P AS  Q  + +
Sbjct  359  LKTGSCKYGATCRYNHPDRNSFNPPLASALGQAIMPSPATNLPFGVLDPAASFLQNINLQ  418

Query  603  LTQTMFGFATTIYPQRPGQVECD-------------------------------------  535
              Q   G   T+YPQRPG++ECD                                     
Sbjct  419  SAQASLGVIPTVYPQRPGEIECDVRIDSILFVLGLLTASRAHLTLGPITRVAKNASLYTV  478

Query  534  ------------FYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
                        +YMKTG CKFGERC+FHHP+D S  ++ + +  QQN KL+LAGLPRRE
Sbjct  479  SLSLMLASFYSHYYMKTGLCKFGERCKFHHPIDRSAPMSDAKQAPQQNVKLTLAGLPRRE  538

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            GA+ C +Y+KTG CKFG TCKFDHPPPGE I 
Sbjct  539  GAVICSFYLKTGTCKFGTTCKFDHPPPGEAIA  570


 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 80/169 (47%), Gaps = 48/169 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G+ C++NHP +  +N  A  +                        G   ++ 
Sbjct  229  MKTQKCKFGSRCKFNHP-KDKLNASADEVGGE---------------------GTENSVL  266

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------SVTSSMEGEQQNF------  424
            P+RP +  C FY KTG+CKFG  C+FHHP D  +            ME E+ +       
Sbjct  267  PERPSEPLCSFYAKTGKCKFGPNCKFHHPKDLKIPPDGEDTDKMGEMESEKNDGSAGGDP  326

Query  423  KLSLA-------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            KL+ A             GLP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  327  KLAKAHVSITPALLHNSKGLPIRPGEADCPFYLKTGSCKYGATCRYNHP  375


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 82/179 (46%), Gaps = 31/179 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +C +G +C+++HP               +  P   +     P   +     A+   
Sbjct  177  MLTRTCTFGNSCKFDHP---------------IWVPEGGI-----PDWKEIPLVPASESL  216

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P++PG+ +C +YMKT +CKFG RC+F+HP D   +    + GE     +    LP R   
Sbjct  217  PEKPGEPDCPYYMKTQKCKFGSRCKFNHPKDKLNASADEVGGEGTENSV----LPERPSE  272

Query  384  IHCPYYMKTGICKFGATCKFDH------PPPGELIGGTSQVTS-TSVGEEEGYAKLVEA  229
              C +Y KTG CKFG  CKF H      PP GE      ++ S  + G   G  KL +A
Sbjct  273  PLCSFYAKTGKCKFGPNCKFHHPKDLKIPPDGEDTDKMGEMESEKNDGSAGGDPKLAKA  331


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLA--GLPR  397
            IYPQRPG+ +C  YM T  C FG  C+F HP    + V      + +   L  A   LP 
Sbjct  163  IYPQRPGEKDCAHYMLTRTCTFGNSCKFDHP----IWVPEGGIPDWKEIPLVPASESLPE  218

Query  396  REGAIHCPYYMKTGICKFGATCKFDHP  316
            + G   CPYYMKT  CKFG+ CKF+HP
Sbjct  219  KPGEPDCPYYMKTQKCKFGSRCKFNHP  245



>ref|XP_010095999.1| Zinc finger CCCH domain-containing protein 37 [Morus notabilis]
 gb|EXB62692.1| Zinc finger CCCH domain-containing protein 37 [Morus notabilis]
Length=521

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 122/197 (62%), Gaps = 37/197 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT-------INPPAAHLNVGVVNPTASLFQTFDPRLTQTMF  586
            LKTGSCKYGATCRYNHPDR         +  PAA LN+  VN  ASL+QT DPRL Q   
Sbjct  320  LKTGSCKYGATCRYNHPDRLASSIGHAIVASPAAGLNI--VNSVASLYQTIDPRLAQATG  377

Query  585  GF---ATTIYP------------QRPGQV--------ECDFYMKTGECKFGERCRFHHPL  475
             F    TT+ P            +RP +            +YMKTGECKFGERC+FHHP+
Sbjct  378  LFPSSVTTLAPLSRVLLLSDPTLRRPDRCLRQYAAASSVRYYMKTGECKFGERCKFHHPM  437

Query  474  DHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            D   S   + + +QQ  KL+LAGLPRREG+I CPYY+KTG CKFGATCKFDHPPPGE++ 
Sbjct  438  DRLASTQLAGQAQQQIVKLTLAGLPRREGSIICPYYLKTGACKFGATCKFDHPPPGEVMA  497

Query  294  GTSQVTSTSVGEEEGYA  244
             T     TS G  EG A
Sbjct  498  KT-----TSQGIAEGEA  509


 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 72/168 (43%), Gaps = 51/168 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G  C++NHP D+      + + +V                          T 
Sbjct  195  LKTQRCKFGLRCKFNHPKDKLAAEGASENGDV--------------------------TG  228

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG------  406
             P+RP +  C FY+KTG CKFG  C+FHHP D  L       G  Q+      G      
Sbjct  229  LPERPSEAPCAFYLKTGTCKFGSTCKFHHPKDIQLPSAGHDNGSSQHESAKKEGTAGDSN  288

Query  405  ------------------LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                              LP R G   CP+Y+KTG CK+GATC+++HP
Sbjct  289  VLKSCVSFIPAIYYNTKELPIRPGEPDCPFYLKTGSCKYGATCRYNHP  336


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 28/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP             + V       ++   P         A+   
Sbjct  144  MLTRTCKFGDSCKFDHP-------------IWVPEGGIPDWKEIPP--------IASEAL  182

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C +++KT  CKFG RC+F+HP D   +  +S  G+       + GLP R   
Sbjct  183  PERLGQPDCPYFLKTQRCKFGLRCKFNHPKDKLAAEGASENGD-------VTGLPERPSE  235

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CKFG+TCKF HP
Sbjct  236  APCAFYLKTGTCKFGSTCKFHHP  258


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 11/89 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAGL  403
            IYPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   ++K    ++   L
Sbjct  130  IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPI-------WVPEGGIPDWKEIPPIASEAL  182

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   CPY++KT  CKFG  CKF+HP
Sbjct  183  PERLGQPDCPYFLKTQRCKFGLRCKFNHP  211



>ref|XP_006830468.1| hypothetical protein AMTR_s00115p00126760 [Amborella trichopoda]
 gb|ERM97884.1| hypothetical protein AMTR_s00115p00126760 [Amborella trichopoda]
Length=538

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 117/174 (67%), Gaps = 11/174 (6%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT-------INPPAAHLNVGVVN-PTASLFQTFDPRLTQTM  589
            LKTGSCKYGATCR+NHPD  T       INP AA L +GVVN P  +L  + DP + QT 
Sbjct  361  LKTGSCKYGATCRFNHPDWRTTTTPAAVINPLAATLPLGVVNTPPPAL--SHDPWMAQTT  418

Query  588  FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQNFKLSL  412
             G   ++YPQRPGQ+ CD+YMK GECKFGERC+FHHPLD +  +   + +  QQ  KL+L
Sbjct  419  LGLGVSVYPQRPGQIACDYYMKFGECKFGERCKFHHPLDRTAPTAAVAQQVPQQVVKLTL  478

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG  250
            AGLPRREG   CP+YMKT  CK+GA CKFDHPPPGE+        +T     EG
Sbjct  479  AGLPRREGEAVCPFYMKTATCKYGAVCKFDHPPPGEVAAKAVGGAATDSKIAEG  532


 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 83/169 (49%), Gaps = 45/169 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CK+G  C++NHP             V   N + S+  T          G   T  
Sbjct  228  MKTQKCKFGQRCKFNHPKD----------KVEASNVSPSVGNTD---------GAIITAL  268

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHS--LSVTSSMEGEQQ-NFKLSLA-----  409
            P+RP + EC FYMKTG CKFG  C+FHHP D    L+ T S+ GEQ  + K+  A     
Sbjct  269  PERPSEPECTFYMKTGICKFGASCKFHHPKDRPVPLTGTDSVTGEQTGSVKVDGAVVGAD  328

Query  408  ------------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                              GLP R G + CP+Y+KTG CK+GATC+F+HP
Sbjct  329  QQVKPFTPFTPALLHNSKGLPIRPGEVDCPFYLKTGSCKYGATCRFNHP  377


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 89/179 (50%), Gaps = 26/179 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP                  P   +     P   +      + + 
Sbjct  176  MLTRTCKFGDSCKFDHP---------------FWVPEGGI-----PDWKEVPLIPVSDML  215

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C ++MKT +CKFG+RC+F+HP D   +   S      +  + +  LP R   
Sbjct  216  PERPGEPDCPYFMKTQKCKFGQRCKFNHPKDKVEASNVSPSVGNTDGAI-ITALPERPSE  274

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGEL-IGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
              C +YMKTGICKFGA+CKF HP    + + GT  VT    GE+ G  K+  A+    Q
Sbjct  275  PECTFYMKTGICKFGASCKFHHPKDRPVPLTGTDSVT----GEQTGSVKVDGAVVGADQ  329


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 12/90 (13%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK----LSLAG-  406
            +YPQRPG+ +C +YM T  CKFG+ C+F HP           EG   ++K    + ++  
Sbjct  162  VYPQRPGEKDCTYYMLTRTCKFGDSCKFDHPF-------WVPEGGIPDWKEVPLIPVSDM  214

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            LP R G   CPY+MKT  CKFG  CKF+HP
Sbjct  215  LPERPGEPDCPYFMKTQKCKFGQRCKFNHP  244



>ref|XP_006422341.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422342.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422343.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422344.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422345.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 ref|XP_006422346.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35581.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35582.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35583.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35584.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35585.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
 gb|ESR35586.1| hypothetical protein CICLE_v100047901mg, partial [Citrus clementina]
Length=135

 Score =   164 bits (416),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 94/130 (72%), Gaps = 16/130 (12%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYG+TCRYNHP+R  INPPAA             L + VV+P ASL+QT DPRL
Sbjct  9    LKTGSCKYGSTCRYNHPERTAINPPAAAIVHPLITSPAASLGISVVSPAASLYQTIDPRL  68

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
             Q   G + ++YPQRPGQ+ECD+YMKTG CKFGE+C+FHHP+D S + T S    Q+  K
Sbjct  69   AQATLGVSPSLYPQRPGQMECDYYMKTGVCKFGEKCKFHHPIDRSAAKTPS----QETVK  124

Query  420  LSLAGLPRRE  391
            L+LAGLPRRE
Sbjct  125  LTLAGLPRRE  134


 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 55/109 (50%), Gaps = 30/109 (28%)
 Frame = -2

Query  552  GQVECDFYMKTGECKFGERCRFHHP-----------LDHSL----------SVTSSMEGE  436
            G+++C FY+KTG CK+G  CR++HP           + H L          SV S     
Sbjct  1    GELDCPFYLKTGSCKYGSTCRYNHPERTAINPPAAAIVHPLITSPAASLGISVVSPAASL  60

Query  435  QQNF--KLSLAGL-------PRREGAIHCPYYMKTGICKFGATCKFDHP  316
             Q    +L+ A L       P+R G + C YYMKTG+CKFG  CKF HP
Sbjct  61   YQTIDPRLAQATLGVSPSLYPQRPGQMECDYYMKTGVCKFGEKCKFHHP  109



>dbj|BAB02411.1| zinc finger protein-like [Arabidopsis thaliana]
Length=326

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 105/165 (64%), Gaps = 35/165 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R    P AA            +LN+G+V P  S +QT    L
Sbjct  170  LKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLNLGLVTPATSFYQT----L  225

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            TQ  +                  YMKTGECKFGERC+FHHP D  LS  +    +Q N K
Sbjct  226  TQPTY------------------YMKTGECKFGERCKFHHPADR-LSAMTKQAPQQPNVK  266

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            LSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++  T+
Sbjct  267  LSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMAKTT  311


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 79/164 (48%), Gaps = 50/164 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  CKYG+ C++NHP                    A   +T D               
Sbjct  52   IKTQRCKYGSKCKFNHPREEA----------------AVSVETQD-------------SL  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL---------SVTSSMEGEQQN-----  427
            P+RP +  C FYMKTG+CKFG  C+FHHP D  L         SV  + E +  N     
Sbjct  83   PERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLTSEPDATNNPHVT  142

Query  426  FKLSL----AGLPRR---EGAIHCPYYMKTGICKFGATCKFDHP  316
            F  +L     GLP R   +G + CP+Y+KTG CK+GATC+++HP
Sbjct  143  FTPALYHNSKGLPVRSLFQGEVDCPFYLKTGSCKYGATCRYNHP  186


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 80/161 (50%), Gaps = 33/161 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G +CR++HP    I  P   +      P                       Y
Sbjct  1    MQTRTCKFGESCRFDHP----IWVPEGGIPDWKEAPVV-----------------PNEEY  39

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y+KT  CK+G +C+F+HP +      +++  E Q+       LP R   
Sbjct  40   PERPGEPDCPYYIKTQRCKYGSKCKFNHPREE-----AAVSVETQD------SLPERPSE  88

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YMKTG CKFG +CKF HP   +L   +SQ   +SVG
Sbjct  89   PMCTFYMKTGKCKFGLSCKFHHPKDIQL-PSSSQDIGSSVG  128


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 75/158 (47%), Gaps = 19/158 (12%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV-------NPTASLFQTFDPRLTQTMF  586
            +KTG CK+G +C+++HP    I  P++  ++G         + T +   TF P L     
Sbjct  95   MKTGKCKFGLSCKFHHPK--DIQLPSSSQDIGSSVGLTSEPDATNNPHVTFTPALYHNSK  152

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----LDHSLSVTSSMEGEQQ---  430
            G       Q  G+V+C FY+KTG CK+G  CR++HP     +  +  V  S+        
Sbjct  153  GLPVRSLFQ--GEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANL  210

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N  L        +      YYMKTG CKFG  CKF HP
Sbjct  211  NLGLVTPATSFYQTLTQPTYYMKTGECKFGERCKFHHP  248



>ref|XP_006644369.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
[Oryza brachyantha]
Length=453

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 103/163 (63%), Gaps = 6/163 (4%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG-----VVNPTASLFQTFDPRLTQTMFGF  580
            +K GSCK+G++CR+NHPDR  +N P     +      ++NP A+  Q+FD    +   G 
Sbjct  291  MKMGSCKFGSSCRFNHPDRLVLNFPLGQTIIPTPESILLNPAANFMQSFDFHAARLPVGP  350

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS-SMEGEQQNFKLSLAGL  403
                YPQRPG   CDFYMKTG CKF +RC+FHHP+D S    S + E  + + +L+LAGL
Sbjct  351  GPIAYPQRPGATVCDFYMKTGFCKFSDRCKFHHPIDRSAPDRSVNWEPAEDSLQLTLAGL  410

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            PRRE A  C +YMKTG+CKFG  CKFDHPPP E I   S   S
Sbjct  411  PRREDAEVCDFYMKTGVCKFGMQCKFDHPPPQEAIAKVSNSGS  453


 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 80/169 (47%), Gaps = 47/169 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+G+ C++NHP              G VN  AS       +  +      ++I 
Sbjct  160  MKTGKCKFGSKCKFNHPK-------------GRVNALASG------KGNEKHPSADSSIL  200

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP--------------------------LDHSL  463
            P RP +  C FY KTG CKF  +C+F+HP                          +D S+
Sbjct  201  PVRPSEPICSFYAKTGTCKFLAKCKFNHPKDIEVPSDHNESENAATVEGEKDIGAVDDSI  260

Query  462  SVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            SV  S     Q F  +  GLP R G + CP+YMK G CKFG++C+F+HP
Sbjct  261  SVKMSTPIAAQEF--NSKGLPIRPGEVDCPFYMKMGSCKFGSSCRFNHP  307


 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 84/177 (47%), Gaps = 41/177 (23%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTINPPAAH------------LNVGVVNPTASLFQTFDPRLT  598
            KTG+CK+ A C++NHP    I  P+ H             ++G V+ + S+ +   P   
Sbjct  214  KTGTCKFLAKCKFNHPK--DIEVPSDHNESENAATVEGEKDIGAVDDSISV-KMSTPIAA  270

Query  597  QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP----LDHSLSVTSSMEGEQ-  433
            Q    F +   P RPG+V+C FYMK G CKFG  CRF+HP    L+  L  T     E  
Sbjct  271  QE---FNSKGLPIRPGEVDCPFYMKMGSCKFGSSCRFNHPDRLVLNFPLGQTIIPTPESI  327

Query  432  ---------QNFKLSLAGL---------PRREGAIHCPYYMKTGICKFGATCKFDHP  316
                     Q+F    A L         P+R GA  C +YMKTG CKF   CKF HP
Sbjct  328  LLNPAANFMQSFDFHAARLPVGPGPIAYPQRPGATVCDFYMKTGFCKFSDRCKFHHP  384


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 84/166 (51%), Gaps = 25/166 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+  +C+++HP             +      A+L ++                Y
Sbjct  110  MMTRTCKFRDSCKFDHPQW------VPEGGIPDWKEAANLEES----------------Y  147

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C F+MKTG+CKFG +C+F+HP    ++  +S +G +++     + LP R   
Sbjct  148  PERQGEPDCPFFMKTGKCKFGSKCKFNHPKGR-VNALASGKGNEKHPSADSSILPVRPSE  206

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIG--GTSQVTSTSVGEEE  253
              C +Y KTG CKF A CKF+HP   E+      S+  +T  GE++
Sbjct  207  PICSFYAKTGTCKFLAKCKFNHPKDIEVPSDHNESENAATVEGEKD  252


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 56/101 (55%), Gaps = 15/101 (15%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRPG  +C FYM T  CKF + C+F HP           EG   
Sbjct  88   PRLESSL-----PIYPQRPGAKDCAFYMMTRTCKFRDSCKFDHP-------QWVPEGGIP  135

Query  429  NFKLSL---AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            ++K +       P R+G   CP++MKTG CKFG+ CKF+HP
Sbjct  136  DWKEAANLEESYPERQGEPDCPFFMKTGKCKFGSKCKFNHP  176



>gb|EEC71090.1| hypothetical protein OsI_02867 [Oryza sativa Indica Group]
Length=463

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 106/168 (63%), Gaps = 14/168 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG----------VVNPTASLFQTFDPRLTQ  595
            +K GSCK+G+TCR+NHPDR  +N P   L +G          ++N +A+  Q FD     
Sbjct  299  MKMGSCKFGSTCRFNHPDRLVLNFP---LPLGQTILPTPESMLLNSSANFMQGFDFHAAH  355

Query  594  TMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQNFKL  418
               G     YPQRPG   CDFYMKTG CKF +RC+FHHP+D S    +++ E  +++ +L
Sbjct  356  MPVGPGPVTYPQRPGATVCDFYMKTGFCKFADRCKFHHPIDRSAPDPSANWEPAEESVQL  415

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            +LAGLPRRE A+ C +YMKTG+CKFG  CKFDHPPP E I   S   S
Sbjct  416  TLAGLPRREDAVVCAFYMKTGVCKFGMQCKFDHPPPQEAIAKVSNSGS  463


 Score = 94.7 bits (234),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 82/170 (48%), Gaps = 48/170 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+G+ C++NHP                VN  AS  +T D  L        ++I 
Sbjct  167  MKTGKCKFGSKCKFNHPKEK-------------VNALAS-GKTNDKHLIAD-----SSIL  207

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL------------------------SV  457
            P RP +  C FY KTG+CKF   C+F+HP D  +                        SV
Sbjct  208  PVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGSAADSV  267

Query  456  TSSME---GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            ++ M+      Q F  +  GLP R G + CP+YMK G CKFG+TC+F+HP
Sbjct  268  SAKMQTPVAAAQEF--NSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHP  315


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 88/187 (47%), Gaps = 24/187 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP              G+ N   +                    Y
Sbjct  117  MMTRTCKFGGSCKFDHPQWVP--------EGGIPNWKEA--------------ANVEESY  154

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P++ G+ +C F+MKTG+CKFG +C+F+HP +  ++  +S +   ++     + LP R   
Sbjct  155  PEQQGEPDCPFFMKTGKCKFGSKCKFNHPKE-KVNALASGKTNDKHLIADSSILPVRPSE  213

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS-TSVGEEEGYAKLVEAIQKQQQ*  208
              C +Y KTG CKF A CKF+HP   E+    ++  S  +V  E       +++  + Q 
Sbjct  214  PLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGSAADSVSAKMQT  273

Query  207  TFCSVQQ  187
               + Q+
Sbjct  274  PVAAAQE  280


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 57/101 (56%), Gaps = 15/101 (15%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRPG+ +C FYM T  CKFG  C+F HP           EG   
Sbjct  95   PRLESSL-----PIYPQRPGEKDCAFYMMTRTCKFGGSCKFDHP-------QWVPEGGIP  142

Query  429  NFKLSL---AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N+K +       P ++G   CP++MKTG CKFG+ CKF+HP
Sbjct  143  NWKEAANVEESYPEQQGEPDCPFFMKTGKCKFGSKCKFNHP  183



>ref|NP_001043577.1| Os01g0616400 [Oryza sativa Japonica Group]
 dbj|BAD61281.1| zinc finger protein 3-like [Oryza sativa Japonica Group]
 dbj|BAF05491.1| Os01g0616400 [Oryza sativa Japonica Group]
 dbj|BAG99554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54988.1| hypothetical protein OsJ_02611 [Oryza sativa Japonica Group]
Length=461

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 106/168 (63%), Gaps = 14/168 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG----------VVNPTASLFQTFDPRLTQ  595
            +K GSCK+G+TCR+NHPDR  +N P   L +G          ++N +A+  Q FD     
Sbjct  297  MKMGSCKFGSTCRFNHPDRLVLNFP---LPLGQTILPTPESMLLNSSANFMQGFDFHAAH  353

Query  594  TMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQNFKL  418
               G     YPQRPG   CDFYMKTG CKF +RC+FHHP+D S    +++ E  +++ +L
Sbjct  354  MPVGPGPVTYPQRPGATVCDFYMKTGFCKFADRCKFHHPIDRSAPDPSANWEPAEESVQL  413

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            +LAGLPRRE A+ C +YMKTG+CKFG  CKFDHPPP E I   S   S
Sbjct  414  TLAGLPRREDAVVCAFYMKTGVCKFGMQCKFDHPPPQEAIAKVSNSGS  461


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 81/170 (48%), Gaps = 48/170 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+G+ C++NHP                VN  AS   T D  L        ++I 
Sbjct  165  MKTGKCKFGSKCKFNHPKEK-------------VNALAS-GNTNDKHLIAD-----SSIL  205

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL------------------------SV  457
            P RP +  C FY KTG+CKF   C+F+HP D  +                        SV
Sbjct  206  PVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGSAADSV  265

Query  456  TSSME---GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            ++ M+      Q F  +  GLP R G + CP+YMK G CKFG+TC+F+HP
Sbjct  266  SAKMQTPVAAAQEF--NSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHP  313


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 57/101 (56%), Gaps = 15/101 (15%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRPG+ +C FYM T  CKFG  C+F HP           EG   
Sbjct  93   PRLESSL-----PIYPQRPGEKDCAFYMMTRTCKFGGSCKFDHP-------QWVPEGGIP  140

Query  429  NFKLSL---AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N+K +       P +EG   CP++MKTG CKFG+ CKF+HP
Sbjct  141  NWKEAANVEESYPEQEGEPDCPFFMKTGKCKFGSKCKFNHP  181


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 87/187 (47%), Gaps = 24/187 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP              G+ N   +                    Y
Sbjct  115  MMTRTCKFGGSCKFDHPQWVP--------EGGIPNWKEA--------------ANVEESY  152

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P++ G+ +C F+MKTG+CKFG +C+F+HP +  ++  +S     ++     + LP R   
Sbjct  153  PEQEGEPDCPFFMKTGKCKFGSKCKFNHPKE-KVNALASGNTNDKHLIADSSILPVRPSE  211

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS-TSVGEEEGYAKLVEAIQKQQQ*  208
              C +Y KTG CKF A CKF+HP   E+    ++  S  +V  E       +++  + Q 
Sbjct  212  PLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGSAADSVSAKMQT  271

Query  207  TFCSVQQ  187
               + Q+
Sbjct  272  PVAAAQE  278



>sp|Q5ZDJ6.2|C3H8_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 8; Short=OsC3H8 
[Oryza sativa Japonica Group]
 dbj|BAD61280.1| zinc finger protein 3-like [Oryza sativa Japonica Group]
 dbj|BAG99366.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 106/168 (63%), Gaps = 14/168 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG----------VVNPTASLFQTFDPRLTQ  595
            +K GSCK+G+TCR+NHPDR  +N P   L +G          ++N +A+  Q FD     
Sbjct  298  MKMGSCKFGSTCRFNHPDRLVLNFP---LPLGQTILPTPESMLLNSSANFMQGFDFHAAH  354

Query  594  TMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQNFKL  418
               G     YPQRPG   CDFYMKTG CKF +RC+FHHP+D S    +++ E  +++ +L
Sbjct  355  MPVGPGPVTYPQRPGATVCDFYMKTGFCKFADRCKFHHPIDRSAPDPSANWEPAEESVQL  414

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            +LAGLPRRE A+ C +YMKTG+CKFG  CKFDHPPP E I   S   S
Sbjct  415  TLAGLPRREDAVVCAFYMKTGVCKFGMQCKFDHPPPQEAIAKVSNSGS  462


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 81/170 (48%), Gaps = 48/170 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+G+ C++NHP                VN  AS   T D  L        ++I 
Sbjct  166  MKTGKCKFGSKCKFNHPKEK-------------VNALAS-GNTNDKHLIAD-----SSIL  206

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL------------------------SV  457
            P RP +  C FY KTG+CKF   C+F+HP D  +                        SV
Sbjct  207  PVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGSAADSV  266

Query  456  TSSME---GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            ++ M+      Q F  +  GLP R G + CP+YMK G CKFG+TC+F+HP
Sbjct  267  SAKMQTPVAAAQEF--NSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHP  314


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRPG+ +C FYM T  CKFG  C+F HP           EG   
Sbjct  93   PRLESSL-----PIYPQRPGEKDCAFYMMTRTCKFGGSCKFDHP-------QWVPEGGIP  140

Query  429  NFKLSLAGL----PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N+K   A +    P +EG   CP++MKTG CKFG+ CKF+HP
Sbjct  141  NWKEQAANVEESYPEQEGEPDCPFFMKTGKCKFGSKCKFNHP  182


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 87/187 (47%), Gaps = 23/187 (12%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP              G+ N              +         Y
Sbjct  115  MMTRTCKFGGSCKFDHPQWVP--------EGGIPN-------------WKEQAANVEESY  153

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P++ G+ +C F+MKTG+CKFG +C+F+HP +  ++  +S     ++     + LP R   
Sbjct  154  PEQEGEPDCPFFMKTGKCKFGSKCKFNHPKE-KVNALASGNTNDKHLIADSSILPVRPSE  212

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS-TSVGEEEGYAKLVEAIQKQQQ*  208
              C +Y KTG CKF A CKF+HP   E+    ++  S  +V  E       +++  + Q 
Sbjct  213  PLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGSAADSVSAKMQT  272

Query  207  TFCSVQQ  187
               + Q+
Sbjct  273  PVAAAQE  279



>ref|XP_010232025.1| PREDICTED: zinc finger CCCH domain-containing protein 8 isoform 
X2 [Brachypodium distachyon]
Length=348

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 110/183 (60%), Gaps = 18/183 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRY--------------TINPPAAHLNVGVVNPTASLFQTFDP  607
            +KTGSC YG+TCR+NHP+R+              +I P ++ + V ++N   +    FD 
Sbjct  158  IKTGSCMYGSTCRFNHPERHHPVLDFPLVAPLGQSILPTSSVVPVEMLNRATNFLPNFDF  217

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQ  430
              T          YPQRPG+  CDFYMKTG CKF E+C+FHHP+D S S   +S E  Q+
Sbjct  218  HATHVPIEPEPIAYPQRPGETVCDFYMKTGFCKFSEKCKFHHPVDRSASAPVASTEPRQK  277

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG  250
            +  L+LAGLPRRE A  C +YMKTG CKFG  CKFDHPPP E I   ++V+     EE+G
Sbjct  278  SVTLTLAGLPRREDAEVCSFYMKTGTCKFGVQCKFDHPPPEEAI---AKVSKQGAAEEKG  334

Query  249  YAK  241
              K
Sbjct  335  GKK  337


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 73/178 (41%), Gaps = 39/178 (22%)
 Frame = -2

Query  735  GSCKYGATCRYNHPDRYTINPPAAH--LNVGVVNPTASLFQTFDP----RLTQTMFGFAT  574
            G CK+G  C+++H     + P + H   +   V          D     +LT       +
Sbjct  84   GKCKFGTNCKFSHAKDIEV-PSSGHESKSTATVEAAGHNIAASDSVSAKKLTPVAQEHNS  142

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDH--------------SLSVTSS----  448
               P RPG+V+C FY+KTG C +G  CRF+HP  H              S+  TSS    
Sbjct  143  KGMPIRPGEVDCSFYIKTGSCMYGSTCRFNHPERHHPVLDFPLVAPLGQSILPTSSVVPV  202

Query  447  -MEGEQQNFKLSL-------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             M     NF  +                 P+R G   C +YMKTG CKF   CKF HP
Sbjct  203  EMLNRATNFLPNFDFHATHVPIEPEPIAYPQRPGETVCDFYMKTGFCKFSEKCKFHHP  260


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 73/166 (44%), Gaps = 44/166 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  C + + C++NHP           +NV V        Q  +           ++I 
Sbjct  30   MKTRRCGFASKCKFNHPKE--------KVNVTVAGTGNKGSQISE-----------SSIS  70

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD-------HSLSVTSSMEGEQQNFKLSLA-  409
            P +P +  C F+ K G+CKFG  C+F H  D       H    T+++E    N   S + 
Sbjct  71   PVKPSE-PCPFFPK-GKCKFGTNCKFSHAKDIEVPSSGHESKSTATVEAAGHNIAASDSV  128

Query  408  ---------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           G+P R G + C +Y+KTG C +G+TC+F+HP
Sbjct  129  SAKKLTPVAQEHNSKGMPIRPGEVDCSFYIKTGSCMYGSTCRFNHP  174


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 62/107 (58%), Gaps = 3/107 (3%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG+ +C F+MKT  C F  +C+F+HP +  ++VT +  G + + ++S + +   + 
Sbjct  17   YPERPGEPDCPFFMKTRRCGFASKCKFNHPKE-KVNVTVAGTGNKGS-QISESSISPVKP  74

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
            +  CP++ K G CKFG  CKF H    E+     +  ST+  E  G+
Sbjct  75   SEPCPFFPK-GKCKFGTNCKFSHAKDIEVPSSGHESKSTATVEAAGH  120



>tpg|DAA58980.2| TPA: hypothetical protein ZEAMMB73_531605 [Zea mays]
Length=276

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 95/156 (61%), Gaps = 12/156 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP------------PAAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCKYG+ CR+NHPDR  ++             PA  +    +NP A+  Q+FD   
Sbjct  116  MKTGSCKYGSICRFNHPDRSVVDIAFMAPVQATLPFPAPIVPAVALNPAANFLQSFDFHA  175

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            T         IYPQRPG++ CDFYMKTG CK+ + C+FHHP D S   +   E  QQ   
Sbjct  176  THVPVEPMPMIYPQRPGEIVCDFYMKTGSCKYAQNCKFHHPFDRSAPHSKENEDTQQPVA  235

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPP  313
            L+LAGLPRRE A  C +YM++G C FGA CKFDHPP
Sbjct  236  LTLAGLPRREDAEACAFYMRSGTCGFGARCKFDHPP  271


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 78/188 (41%), Gaps = 52/188 (28%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTINPP---------------AAHLNVGVVNPTASLFQTFDP  607
            KTG CK+GA C++NHP    I  P               AAH+     +  A       P
Sbjct  35   KTGKCKFGAVCKFNHPKLEDIKTPSLIAKETIYRATTDAAAHIGGTDDSVPAKTHAPIAP  94

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ--  433
                   G      P RPG+V+C FYMKTG CK+G  CRF+HP D S+   + M   Q  
Sbjct  95   AEAHNAKGL-----PIRPGEVDCSFYMKTGSCKYGSICRFNHP-DRSVVDIAFMAPVQAT  148

Query  432  --------------------QNFKLSLAGL---------PRREGAIHCPYYMKTGICKFG  340
                                Q+F      +         P+R G I C +YMKTG CK+ 
Sbjct  149  LPFPAPIVPAVALNPAANFLQSFDFHATHVPVEPMPMIYPQRPGEIVCDFYMKTGSCKYA  208

Query  339  ATCKFDHP  316
              CKF HP
Sbjct  209  QNCKFHHP  216


 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 54/115 (47%), Gaps = 28/115 (24%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLA----  409
            TTI P RP +  C FY KTG+CKFG  C+F+HP    +   S +  E      + A    
Sbjct  18   TTILPVRPSEPVCSFYAKTGKCKFGAVCKFNHPKLEDIKTPSLIAKETIYRATTDAAAHI  77

Query  408  ------------------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                                    GLP R G + C +YMKTG CK+G+ C+F+HP
Sbjct  78   GGTDDSVPAKTHAPIAPAEAHNAKGLPIRPGEVDCSFYMKTGSCKYGSICRFNHP  132



>gb|KGN44308.1| hypothetical protein Csa_7G252650 [Cucumis sativus]
Length=482

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 15/132 (11%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP-------PA----AHLNVGVVNPTASLFQTFDPRLT  598
            LKTGSCKYG TCRYNHPDR  INP       PA    A++N G VNP+ +++Q  DPRL 
Sbjct  347  LKTGSCKYGTTCRYNHPDRNAINPSTPAMVHPAMVSTANMNTGFVNPSNAIYQAVDPRLI  406

Query  597  QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKL  418
            Q + G  ++IYPQRPGQ+ECDFYMKTG+CKFGERC+FHHP+D S    +  +G   N KL
Sbjct  407  QPLLGSGSSIYPQRPGQIECDFYMKTGDCKFGERCKFHHPIDRS----APKQGALHNVKL  462

Query  417  SLAGLPRREGAI  382
            +LAGLPRRE  I
Sbjct  463  TLAGLPRREVYI  474


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 80/168 (48%), Gaps = 52/168 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G+ C++NHP DR          +VG     AS                    
Sbjct  223  LKTQRCKFGSRCKFNHPKDRSD--------SVGAEKSDASSL------------------  256

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-----------SVTSSMEGEQQNFK  421
             P+RP +  C FY+KTG CKFG  C+FHHP D  +           ++    E    +FK
Sbjct  257  -PERPSEPLCAFYVKTGNCKFGINCKFHHPKDIQILSGEEYGNSEQTLMVKTEERAGDFK  315

Query  420  L-----SLA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            L     SL+        GLP R G + CP+Y+KTG CK+G TC+++HP
Sbjct  316  LVKPPISLSPAIMHNSKGLPIRPGEVDCPFYLKTGSCKYGTTCRYNHP  363


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 79/176 (45%), Gaps = 33/176 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  171  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PDWKEVPQIANSEDL  210

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G  +C +++KT  CKFG RC+F+HP D S SV +         K   + LP R   
Sbjct  211  PERLGDPDCPYFLKTQRCKFGSRCKFNHPKDRSDSVGAE--------KSDASSLPERPSE  262

Query  384  IHCPYYMKTGICKFGATCKFDHPP-----PGELIGGTSQVTSTSVGEEEGYAKLVE  232
              C +Y+KTG CKFG  CKF HP       GE  G + Q       E  G  KLV+
Sbjct  263  PLCAFYVKTGNCKFGINCKFHHPKDIQILSGEEYGNSEQTLMVKTEERAGDFKLVK  318


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 82/178 (46%), Gaps = 35/178 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI-  568
            +KTG+CK+G  C+++HP    I     + N        +  +  D +L +     +  I 
Sbjct  269  VKTGNCKFGINCKFHHPKDIQILSGEEYGNSEQTLMVKTEERAGDFKLVKPPISLSPAIM  328

Query  567  -----YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS------------VTSSM--  445
                  P RPG+V+C FY+KTG CK+G  CR++HP  ++++             T++M  
Sbjct  329  HNSKGLPIRPGEVDCPFYLKTGSCKYGTTCRYNHPDRNAINPSTPAMVHPAMVSTANMNT  388

Query  444  ----------EGEQQNFKLSLAG-----LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                      +         L G      P+R G I C +YMKTG CKFG  CKF HP
Sbjct  389  GFVNPSNAIYQAVDPRLIQPLLGSGSSIYPQRPGQIECDFYMKTGDCKFGERCKFHHP  446


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            +YPQRPG+ +C  YM T  CKFG+ C+F HP+          EG   ++K      +   
Sbjct  157  VYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPI-------WVPEGGIPDWKEVPQIANSED  209

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGE  259
            LP R G   CPY++KT  CKFG+ CKF+HP       G  +  ++S+ E
Sbjct  210  LPERLGDPDCPYFLKTQRCKFGSRCKFNHPKDRSDSVGAEKSDASSLPE  258



>ref|XP_007022803.1| Floral homeotic protein isoform 4 [Theobroma cacao]
 gb|EOY14328.1| Floral homeotic protein isoform 4 [Theobroma cacao]
Length=366

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 22/138 (16%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA-----------HLNVGVVNPTASLFQTFDPRLT  598
            LKTGSCKYG++CRYNHPDR   NPPAA           +LN+GVV P AS++QT DPRL 
Sbjct  200  LKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVASASNLNIGVVTPAASIYQTIDPRLG  259

Query  597  QTMF---------GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            Q+           G A T+YPQRPGQ EC++YMKTG+CKFG+RC+FHHP+D S+S T   
Sbjct  260  QSTLLAQPTFPTLGVAPTVYPQRPGQTECEYYMKTGDCKFGDRCKFHHPIDRSVSKTK--  317

Query  444  EGEQQNFKLSLAGLPRRE  391
            +  +Q  KL+LAGLPRRE
Sbjct  318  QTSEQAVKLTLAGLPRRE  335


 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 94/185 (51%), Gaps = 50/185 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G+ C++NHP D+  I+    ++ V V+                         
Sbjct  82   LKTQRCKFGSKCKFNHPKDKLAISGAFENIQVAVL-------------------------  116

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT--SSMEGEQ-----------QN  427
             P+RP +  C FY+KTG+CKFG  C+FHHP D  ++ +   +  GEQ            +
Sbjct  117  -PERPSEPSCSFYVKTGKCKFGATCKFHHPKDIQIASSGQDNARGEQPEIVTKTGGATAD  175

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIGGTSQVT  277
             K +L     GLP R   + CP+Y+KTG CK+G++C+++HP      PP  ++G +   +
Sbjct  176  VKPALFHNSKGLPIRPDEVDCPFYLKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVAS  235

Query  276  STSVG  262
            ++++ 
Sbjct  236  ASNLN  240


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 80/185 (43%), Gaps = 47/185 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG----VVNPTASLFQTFDPRLTQTMFGFA  577
            +KTG CK+GATC+++HP    I         G    +V  T        P L     G  
Sbjct  129  VKTGKCKFGATCKFHHPKDIQIASSGQDNARGEQPEIVTKTGGATADVKPALFHNSKGL-  187

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----------LDHSLSVTSSMEG---  439
                P RP +V+C FY+KTG CK+G  CR++HP           L HSL  ++S      
Sbjct  188  ----PIRPDEVDCPFYLKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVASASNLNIGV  243

Query  438  --------EQQNFKLSLAGL----------------PRREGAIHCPYYMKTGICKFGATC  331
                    +  + +L  + L                P+R G   C YYMKTG CKFG  C
Sbjct  244  VTPAASIYQTIDPRLGQSTLLAQPTFPTLGVAPTVYPQRPGQTECEYYMKTGDCKFGDRC  303

Query  330  KFDHP  316
            KF HP
Sbjct  304  KFHHP  308


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 7/83 (8%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C +++KT  CKFG +C+F+HP D  L+++ + E  Q      +A LP R   
Sbjct  70   PERAGEPDCPYFLKTQRCKFGSKCKFNHPKD-KLAISGAFENIQ------VAVLPERPSE  122

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CKFGATCKF HP
Sbjct  123  PSCSFYVKTGKCKFGATCKFHHP  145



>ref|XP_002312214.1| enhancer of AG-4 1 family protein [Populus trichocarpa]
 gb|EEE89581.1| enhancer of AG-4 1 family protein [Populus trichocarpa]
Length=474

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 95/133 (71%), Gaps = 16/133 (12%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA------------HLNVGVVNPTASLFQTFDPRL  601
            LKTGSCKYGATCRYNHP+R  INPPAA            +LN+GV +P AS++QT DPRL
Sbjct  342  LKTGSCKYGATCRYNHPERTAINPPAAAIGHPIIAPSMANLNLGVFSPAASIYQTIDPRL  401

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            +    G   T+YPQRPGQ ECDFYMKTGECKFGE C+FHHP+D   S  ++ + E Q  K
Sbjct  402  S--TLGVGPTVYPQRPGQAECDFYMKTGECKFGETCKFHHPIDR--SAPTAKQTEPQTVK  457

Query  420  LSLAGLPRREGAI  382
            L+LAGLPRRE  I
Sbjct  458  LTLAGLPRREVWI  470


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 84/182 (46%), Gaps = 58/182 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT  CKYG  C++NHP           +++GV   T+                   +  
Sbjct  216  LKTQRCKYGLNCKFNHPKE--------KMSLGVSENTS------------------ISAL  249

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT--SSMEGEQQNFKL---------  418
            P+RP +  C FYMKTG CKFG  C+FHHP D  +S+    + +G Q N  +         
Sbjct  250  PERPSEPPCAFYMKTGICKFGATCKFHHPKDIQISLAGQGNDDGVQTNSVVDNGGITGDV  309

Query  417  ---------------SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGEL  301
                           +  GLP R G + CP+Y+KTG CK+GATC+++HP      PP   
Sbjct  310  NVIKALVSVTPALLHNSKGLPMRPGEVDCPFYLKTGSCKYGATCRYNHPERTAINPPAAA  369

Query  300  IG  295
            IG
Sbjct  370  IG  371


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 82/185 (44%), Gaps = 48/185 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTI------NPPAAHLN--------VGVVNPTASLFQTFDP  607
            +KTG CK+GATC+++HP    I      N      N         G VN   +L  +  P
Sbjct  262  MKTGICKFGATCKFHHPKDIQISLAGQGNDDGVQTNSVVDNGGITGDVNVIKALV-SVTP  320

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----------------  478
             L     G      P RPG+V+C FY+KTG CK+G  CR++HP                 
Sbjct  321  ALLHNSKGL-----PMRPGEVDCPFYLKTGSCKYGATCRYNHPERTAINPPAAAIGHPII  375

Query  477  ----LDHSLSVTSSMEGEQQNFKLSLAGL-------PRREGAIHCPYYMKTGICKFGATC  331
                 + +L V S      Q     L+ L       P+R G   C +YMKTG CKFG TC
Sbjct  376  APSMANLNLGVFSPAASIYQTIDPRLSTLGVGPTVYPQRPGQAECDFYMKTGECKFGETC  435

Query  330  KFDHP  316
            KF HP
Sbjct  436  KFHHP  440


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 85/179 (47%), Gaps = 34/179 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G TC+++HP             V V       ++   P  T   F       
Sbjct  164  MLTRTCKFGDTCKFDHP-------------VWVPEGGIPDWKEVPPIATSETF-------  203

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGLPRREG  388
            P RPG  +C +++KT  CK+G  C+F+HP +  SL V+ +          S++ LP R  
Sbjct  204  PDRPGVPDCPYFLKTQRCKYGLNCKFNHPKEKMSLGVSENT---------SISALPERPS  254

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELI----GGTSQVTSTSVGEEEGYAKLVEAIQ  223
               C +YMKTGICKFGATCKF HP   ++     G    V + SV +  G    V  I+
Sbjct  255  EPPCAFYMKTGICKFGATCKFHHPKDIQISLAGQGNDDGVQTNSVVDNGGITGDVNVIK  313


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 60/111 (54%), Gaps = 13/111 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            IYPQRPG+ +C +YM T  CKFG+ C+F HP+          EG   ++K      +   
Sbjct  150  IYPQRPGEKDCAYYMLTRTCKFGDTCKFDHPV-------WVPEGGIPDWKEVPPIATSET  202

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE  253
             P R G   CPY++KT  CK+G  CKF+H P  ++  G S+ TS S   E 
Sbjct  203  FPDRPGVPDCPYFLKTQRCKYGLNCKFNH-PKEKMSLGVSENTSISALPER  252



>ref|XP_003569363.1| PREDICTED: zinc finger CCCH domain-containing protein 8 isoform 
X1 [Brachypodium distachyon]
Length=479

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 110/183 (60%), Gaps = 18/183 (10%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRY--------------TINPPAAHLNVGVVNPTASLFQTFDP  607
            +KTGSC YG+TCR+NHP+R+              +I P ++ + V ++N   +    FD 
Sbjct  289  IKTGSCMYGSTCRFNHPERHHPVLDFPLVAPLGQSILPTSSVVPVEMLNRATNFLPNFDF  348

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQ  430
              T          YPQRPG+  CDFYMKTG CKF E+C+FHHP+D S S   +S E  Q+
Sbjct  349  HATHVPIEPEPIAYPQRPGETVCDFYMKTGFCKFSEKCKFHHPVDRSASAPVASTEPRQK  408

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG  250
            +  L+LAGLPRRE A  C +YMKTG CKFG  CKFDHPPP E I   ++V+     EE+G
Sbjct  409  SVTLTLAGLPRREDAEVCSFYMKTGTCKFGVQCKFDHPPPEEAI---AKVSKQGAAEEKG  465

Query  249  YAK  241
              K
Sbjct  466  GKK  468


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 73/178 (41%), Gaps = 39/178 (22%)
 Frame = -2

Query  735  GSCKYGATCRYNHPDRYTINPPAAH--LNVGVVNPTASLFQTFDP----RLTQTMFGFAT  574
            G CK+G  C+++H     + P + H   +   V          D     +LT       +
Sbjct  215  GKCKFGTNCKFSHAKDIEV-PSSGHESKSTATVEAAGHNIAASDSVSAKKLTPVAQEHNS  273

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDH--------------SLSVTSS----  448
               P RPG+V+C FY+KTG C +G  CRF+HP  H              S+  TSS    
Sbjct  274  KGMPIRPGEVDCSFYIKTGSCMYGSTCRFNHPERHHPVLDFPLVAPLGQSILPTSSVVPV  333

Query  447  -MEGEQQNFKLSL-------------AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             M     NF  +                 P+R G   C +YMKTG CKF   CKF HP
Sbjct  334  EMLNRATNFLPNFDFHATHVPIEPEPIAYPQRPGETVCDFYMKTGFCKFSEKCKFHHP  391


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 59/111 (53%), Gaps = 16/111 (14%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLS---LAGLP  400
            IYPQRPG+ +C FYM+T  C +GE C+F HP           EG   N+K +       P
Sbjct  97   IYPQRPGEKDCAFYMRTRTCMYGEGCKFDHP-------QWVPEGGIPNWKEAPKDEESYP  149

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPP--GELIGGT----SQVTSTSV  265
             R G   CP++MKT  C F + CKF+HP       + GT    SQ++ +S+
Sbjct  150  ERPGEPDCPFFMKTRRCGFASKCKFNHPKEKVNVTVAGTGNKGSQISESSI  200


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 83/166 (50%), Gaps = 25/166 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +C YG  C+++HP              G+ N   +      P+  ++        Y
Sbjct  111  MRTRTCMYGEGCKFDHPQWVPEG--------GIPNWKEA------PKDEES--------Y  148

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C F+MKT  C F  +C+F+HP +  ++VT +  G + + ++S + +   + +
Sbjct  149  PERPGEPDCPFFMKTRRCGFASKCKFNHPKE-KVNVTVAGTGNKGS-QISESSISPVKPS  206

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
              CP++ K G CKFG  CKF H    E+     +  ST+  E  G+
Sbjct  207  EPCPFFPK-GKCKFGTNCKFSHAKDIEVPSSGHESKSTATVEAAGH  251


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 73/166 (44%), Gaps = 44/166 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KT  C + + C++NHP           +NV V        Q  +           ++I 
Sbjct  161  MKTRRCGFASKCKFNHPKE--------KVNVTVAGTGNKGSQISE-----------SSIS  201

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD-------HSLSVTSSMEGEQQNFKLSLA-  409
            P +P +  C F+ K G+CKFG  C+F H  D       H    T+++E    N   S + 
Sbjct  202  PVKPSE-PCPFFPK-GKCKFGTNCKFSHAKDIEVPSSGHESKSTATVEAAGHNIAASDSV  259

Query  408  ---------------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                           G+P R G + C +Y+KTG C +G+TC+F+HP
Sbjct  260  SAKKLTPVAQEHNSKGMPIRPGEVDCSFYIKTGSCMYGSTCRFNHP  305



>ref|XP_007022801.1| Floral homeotic protein isoform 2 [Theobroma cacao]
 gb|EOY14326.1| Floral homeotic protein isoform 2 [Theobroma cacao]
Length=454

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 22/138 (16%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAA-----------HLNVGVVNPTASLFQTFDPRLT  598
            LKTGSCKYG++CRYNHPDR   NPPAA           +LN+GVV P AS++QT DPRL 
Sbjct  288  LKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVASASNLNIGVVTPAASIYQTIDPRLG  347

Query  597  QTMF---------GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            Q+           G A T+YPQRPGQ EC++YMKTG+CKFG+RC+FHHP+D S+S T   
Sbjct  348  QSTLLAQPTFPTLGVAPTVYPQRPGQTECEYYMKTGDCKFGDRCKFHHPIDRSVSKTK--  405

Query  444  EGEQQNFKLSLAGLPRRE  391
            +  +Q  KL+LAGLPRRE
Sbjct  406  QTSEQAVKLTLAGLPRRE  423


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 94/185 (51%), Gaps = 50/185 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKT  CK+G+ C++NHP D+  I+    ++ V V+                         
Sbjct  170  LKTQRCKFGSKCKFNHPKDKLAISGAFENIQVAVL-------------------------  204

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT--SSMEGEQ-----------QN  427
             P+RP +  C FY+KTG+CKFG  C+FHHP D  ++ +   +  GEQ            +
Sbjct  205  -PERPSEPSCSFYVKTGKCKFGATCKFHHPKDIQIASSGQDNARGEQPEIVTKTGGATAD  263

Query  426  FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP------PPGELIGGTSQVT  277
             K +L     GLP R   + CP+Y+KTG CK+G++C+++HP      PP  ++G +   +
Sbjct  264  VKPALFHNSKGLPIRPDEVDCPFYLKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVAS  323

Query  276  STSVG  262
            ++++ 
Sbjct  324  ASNLN  328


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 80/185 (43%), Gaps = 47/185 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVG----VVNPTASLFQTFDPRLTQTMFGFA  577
            +KTG CK+GATC+++HP    I         G    +V  T        P L     G  
Sbjct  217  VKTGKCKFGATCKFHHPKDIQIASSGQDNARGEQPEIVTKTGGATADVKPALFHNSKGL-  275

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----------LDHSLSVTSSMEG---  439
                P RP +V+C FY+KTG CK+G  CR++HP           L HSL  ++S      
Sbjct  276  ----PIRPDEVDCPFYLKTGSCKYGSSCRYNHPDRNAFNPPAAVLGHSLVASASNLNIGV  331

Query  438  --------EQQNFKLSLAGL----------------PRREGAIHCPYYMKTGICKFGATC  331
                    +  + +L  + L                P+R G   C YYMKTG CKFG  C
Sbjct  332  VTPAASIYQTIDPRLGQSTLLAQPTFPTLGVAPTVYPQRPGQTECEYYMKTGDCKFGDRC  391

Query  330  KFDHP  316
            KF HP
Sbjct  392  KFHHP  396


 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 74/143 (52%), Gaps = 27/143 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +CK+G +C+++HP               +  P   +     P   +      +   
Sbjct  118  MLTRTCKFGDSCKFDHP---------------IWVPEGGI-----PDWKEVPLATTSESL  157

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C +++KT  CKFG +C+F+HP D  L+++ + E  Q      +A LP R   
Sbjct  158  PERAGEPDCPYFLKTQRCKFGSKCKFNHPKD-KLAISGAFENIQ------VAVLPERPSE  210

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y+KTG CKFGATCKF HP
Sbjct  211  PSCSFYVKTGKCKFGATCKFHHP  233


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 2/105 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG+ C+F HP+   +      + ++     +   LP R 
Sbjct  104  IYPQRPGEKDCAHYMLTRTCKFGDSCKFDHPI--WVPEGGIPDWKEVPLATTSESLPERA  161

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEE  256
            G   CPY++KT  CKFG+ CKF+HP     I G  +    +V  E
Sbjct  162  GEPDCPYFLKTQRCKFGSKCKFNHPKDKLAISGAFENIQVAVLPE  206



>ref|NP_001169053.1| uncharacterized protein LOC100382893 [Zea mays]
 gb|ACN31532.1| unknown [Zea mays]
Length=462

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 95/156 (61%), Gaps = 12/156 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINP------------PAAHLNVGVVNPTASLFQTFDPRL  601
            +KTGSCKYG+ CR+NHPDR  ++             PA  +    +NP A+  Q+FD   
Sbjct  302  MKTGSCKYGSICRFNHPDRSVVDIAFMAPVQATLPFPAPIVPAVALNPAANFLQSFDFHA  361

Query  600  TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK  421
            T         IYPQRPG++ CDFYMKTG CK+ + C+FHHP D S   +   E  QQ   
Sbjct  362  THVPVEPMPMIYPQRPGEIVCDFYMKTGSCKYAQNCKFHHPFDRSAPHSKENEDTQQPVA  421

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPP  313
            L+LAGLPRRE A  C +YM++G C FGA CKFDHPP
Sbjct  422  LTLAGLPRREDAEACAFYMRSGTCGFGARCKFDHPP  457


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 78/188 (41%), Gaps = 52/188 (28%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTINPP---------------AAHLNVGVVNPTASLFQTFDP  607
            KTG CK+GA C++NHP    I  P               AAH+     +  A       P
Sbjct  221  KTGKCKFGAVCKFNHPKLEDIKTPSLIAKETIYRATTDAAAHIGGTDDSVPAKTHAPIAP  280

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ--  433
                   G      P RPG+V+C FYMKTG CK+G  CRF+HP D S+   + M   Q  
Sbjct  281  AEAHNAKGL-----PIRPGEVDCSFYMKTGSCKYGSICRFNHP-DRSVVDIAFMAPVQAT  334

Query  432  --------------------QNFKLSLAGL---------PRREGAIHCPYYMKTGICKFG  340
                                Q+F      +         P+R G I C +YMKTG CK+ 
Sbjct  335  LPFPAPIVPAVALNPAANFLQSFDFHATHVPVEPMPMIYPQRPGEIVCDFYMKTGSCKYA  394

Query  339  ATCKFDHP  316
              CKF HP
Sbjct  395  QNCKFHHP  402


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (49%), Gaps = 25/143 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + TG+CKYG TC+++HP           +  G V     +    D              Y
Sbjct  119  MSTGTCKYGETCKFDHPQ---------WVPEGGVPNWKEVLNDED-------------YY  156

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C  Y+ +  CKF  +C+F+HP +   ++ +  + E      ++  LP R   
Sbjct  157  PERPGEPDCP-YLLSSRCKFKSKCKFNHPKEMVNALGTRTDNESLIADTTI--LPVRPSE  213

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y KTG CKFGA CKF+HP
Sbjct  214  PVCSFYAKTGKCKFGAVCKFNHP  236


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 16/109 (15%)
 Frame = -2

Query  633  ASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            +S+     PRL  ++      IYPQRPGQ +C FYM TG CK+GE C+F HP        
Sbjct  89   SSITMAKRPRLESSL-----PIYPQRPGQKDCAFYMSTGTCKYGETCKFDHP-------Q  136

Query  453  SSMEGEQQNFKLSLAG---LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               EG   N+K  L      P R G   CPY + +  CKF + CKF+HP
Sbjct  137  WVPEGGVPNWKEVLNDEDYYPERPGEPDCPYLLSSR-CKFKSKCKFNHP  184



>emb|CDM83363.1| unnamed protein product [Triticum aestivum]
 emb|CDM83397.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 96/155 (62%), Gaps = 4/155 (3%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTGSC YG TCR+NHP R+     A+ +   ++NP A    +FD R+T          Y
Sbjct  331  IKTGSCMYGRTCRFNHPGRHIQ---ASVVPGEMLNPAAKFLPSFDFRVTHVPIEPEPITY  387

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQNFKLSLAGLPRREG  388
            PQRPG+  CDFY KTG CKF ERC+FHHP+D S     +  E  QQ   L++AG PRRE 
Sbjct  388  PQRPGETVCDFYKKTGFCKFSERCKFHHPVDRSAPDSIAKWEPSQQPVTLTVAGFPRRED  447

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQ  283
            A  C YYMKTG CKFG  CKFDHPP GE I   S+
Sbjct  448  AEACAYYMKTGACKFGVQCKFDHPPLGEAIAKVSK  482


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 56/100 (56%), Gaps = 15/100 (15%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRPG+ EC FYM+T  CK+ E C+F HP           EG   
Sbjct  111  PRLESSL-----PIYPQRPGEKECAFYMRTRTCKYEETCKFDHP-------QWVPEGGIP  158

Query  429  NFKLSLAG---LPRREGAIHCPYYMKTGICKFGATCKFDH  319
            N+K         P R G  +CP+++KTG CKFG+ CKF+H
Sbjct  159  NWKEGTKAGESYPERPGEPNCPFFVKTGDCKFGSKCKFNH  198


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 19/100 (19%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN----------FKLS  415
            P RPG+V+C FY+KTG C +G  CRF+HP  H  +  S + GE  N          F+++
Sbjct  319  PIRPGEVDCSFYIKTGSCMYGRTCRFNHPGRHIQA--SVVPGEMLNPAAKFLPSFDFRVT  376

Query  414  LAGL-------PRREGAIHCPYYMKTGICKFGATCKFDHP  316
               +       P+R G   C +Y KTG CKF   CKF HP
Sbjct  377  HVPIEPEPITYPQRPGETVCDFYKKTGFCKFSERCKFHHP  416



>ref|XP_004986449.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
[Setaria italica]
Length=335

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 102/162 (63%), Gaps = 14/162 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDR-------------YTINPPAAHLNVGVVNPTASLFQTFDPR  604
            +KTGSCKYG+ CR+NHP R              T+  PA  ++  ++NP A++ Q+FD  
Sbjct  150  MKTGSCKYGSICRFNHPYRPVVDIALMAPLVQTTLPTPAPIMSAPMLNPAANILQSFDFH  209

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
            +T         IYPQRPG+  CDFYMKTG CK+ ++C+FHHP++ S    +     +Q  
Sbjct  210  VTHVPVE-PVPIYPQRPGETVCDFYMKTGFCKYSQKCKFHHPMNRSEPGANGNWDPEQPV  268

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELI  298
             L+LAGLPRRE A  C +YM++G C++GA CKFDHPPP E I
Sbjct  269  TLTLAGLPRRESAEACAFYMRSGTCRYGAHCKFDHPPPQEAI  310


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 73/179 (41%), Gaps = 40/179 (22%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI--  568
            KTG CK+GA C++NHP    I   A           A+     D  +   M     +   
Sbjct  75   KTGKCKFGANCKFNHPMPSVI---AKETIYTATTDAAAHIGAADDLVPAKMHAPTASSEA  131

Query  567  -----YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ----------  433
                  P RPG+V+C FYMKTG CK+G  CRF+HP    + +       Q          
Sbjct  132  HNPKGLPIRPGEVDCSFYMKTGSCKYGSICRFNHPYRPVVDIALMAPLVQTTLPTPAPIM  191

Query  432  ------------QNFKLSLAGL--------PRREGAIHCPYYMKTGICKFGATCKFDHP  316
                        Q+F   +  +        P+R G   C +YMKTG CK+   CKF HP
Sbjct  192  SAPMLNPAANILQSFDFHVTHVPVEPVPIYPQRPGETVCDFYMKTGFCKYSQKCKFHHP  250


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 56/109 (51%), Gaps = 22/109 (20%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS---------------------  460
            + I P RP +  C FY KTG+CKFG  C+F+HP+   ++                     
Sbjct  58   SAILPVRPSEPVCSFYAKTGKCKFGANCKFNHPMPSVIAKETIYTATTDAAAHIGAADDL  117

Query  459  VTSSMEGEQQNFKL-SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            V + M     + +  +  GLP R G + C +YMKTG CK+G+ C+F+HP
Sbjct  118  VPAKMHAPTASSEAHNPKGLPIRPGEVDCSFYMKTGSCKYGSICRFNHP  166



>gb|EMS62698.1| Zinc finger CCCH domain-containing protein 8 [Triticum urartu]
Length=627

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 95/154 (62%), Gaps = 4/154 (3%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTGSC YG TCR+NHP+R+     A+ +   ++NP      +FD R+T          Y
Sbjct  455  IKTGSCMYGRTCRFNHPERHIQ---ASVVPGEMLNPAVKFLPSFDFRVTHVPIEPEPITY  511

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQNFKLSLAGLPRREG  388
            PQRPG+  CDFY KTG CKF E+C+FHHP+D S     +  E  QQ   L++AG PRRE 
Sbjct  512  PQRPGETVCDFYKKTGFCKFSEKCKFHHPVDRSAPDSIAKWEPSQQPVTLTVAGFPRRED  571

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            A  C YYMKTG CKFG  CKFDHPP GE I   S
Sbjct  572  AEACAYYMKTGACKFGVQCKFDHPPLGEAIAKVS  605


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 72/165 (44%), Gaps = 29/165 (18%)
 Frame = -2

Query  735  GSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLF--------QTFDPRLTQTMFGF  580
            G CK G  C++ H     + PP++  N      TA                +L       
Sbjct  380  GKCKLGTNCKFIHAK--DMEPPSSGGNESENTATAEAAGHHGAVHDSVSAKKLAPVALEH  437

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN---------  427
             +   P RPG+V+C FY+KTG C +G  CRF+HP  H  +  S + GE  N         
Sbjct  438  NSKGMPIRPGEVDCSFYIKTGSCMYGRTCRFNHPERHIQA--SVVPGEMLNPAVKFLPSF  495

Query  426  -FKLSLAGL-------PRREGAIHCPYYMKTGICKFGATCKFDHP  316
             F+++   +       P+R G   C +Y KTG CKF   CKF HP
Sbjct  496  DFRVTHVPIEPEPITYPQRPGETVCDFYKKTGFCKFSEKCKFHHP  540


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 84/187 (45%), Gaps = 46/187 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP---DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFAT  574
            +KTG CK+G+ C++NHP   D  T+  P    ++   N T  + +  +P     + G +T
Sbjct  307  VKTGECKFGSKCKFNHPKKKDDRTVAGPGDKESLFSANSTLPV-KPSEPCPESLISGNST  365

Query  573  T-IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLA----  409
              + P +P    C  Y K G+CK G  C+F H  D  +   SS   E +N   + A    
Sbjct  366  LPVKPSKP----CPHYAK-GKCKLGTNCKFIHAKD--MEPPSSGGNESENTATAEAAGHH  418

Query  408  ----------------------GLPRREGAIHCPYYMKTGICKFGATCKFDHPP------  313
                                  G+P R G + C +Y+KTG C +G TC+F+HP       
Sbjct  419  GAVHDSVSAKKLAPVALEHNSKGMPIRPGEVDCSFYIKTGSCMYGRTCRFNHPERHIQAS  478

Query  312  --PGELI  298
              PGE++
Sbjct  479  VVPGEML  485


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 64/129 (50%), Gaps = 27/129 (21%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR--  394
            YP+RPG+  C F++KTGECKFG +C+F+HP       T +  G++++   + + LP +  
Sbjct  294  YPERPGEPNCPFFVKTGECKFGSKCKFNHPKKKD-DRTVAGPGDKESLFSANSTLPVKPS  352

Query  393  ----EGAIH------------CPYYMKTGICKFGATCKFDHP----PPGELIGGTSQVTS  274
                E  I             CP+Y K G CK G  CKF H     PP     G ++  +
Sbjct  353  EPCPESLISGNSTLPVKPSKPCPHYAK-GKCKLGTNCKFIHAKDMEPPSS---GGNESEN  408

Query  273  TSVGEEEGY  247
            T+  E  G+
Sbjct  409  TATAEAAGH  417



>ref|XP_004969171.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
isoform X2 [Setaria italica]
Length=536

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 102/163 (63%), Gaps = 14/163 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTIN-------------PPAAHLNVGVVNPTASLFQTFDPR  604
            +KTGSCKYG+ CR+NHP R  ++              PA  ++  ++NP  ++ Q+FD  
Sbjct  351  MKTGSCKYGSICRFNHPYRPVVDIALIAPLVQTTLPTPAPIISAPMLNPATNVLQSFDFH  410

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
            +T         IYPQRPG+  CDFYMKTG CK+ ++C+FHHP++ S    +     +Q  
Sbjct  411  VTHVPIE-PVPIYPQRPGETVCDFYMKTGFCKYSQKCKFHHPMNRSEPGANGNWDPEQPV  469

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
             L+LAGLPRREGA  C +YM++G C++GA CKFDHPPP E I 
Sbjct  470  TLTLAGLPRREGAEACAFYMRSGTCRYGAHCKFDHPPPQEAIA  512


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 76/181 (42%), Gaps = 44/181 (24%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTI---------NPPAAHLNVGVVNPTASLFQTFDPRLTQTM  589
            KTG CK+GA C++NHP    I            AAH+        A +     P      
Sbjct  276  KTGKCKFGANCKFNHPMPSVIAKETIYTATTDAAAHIGAADDLVPAKMHAPTAPSEAHNP  335

Query  588  FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----------------------  478
             G      P RPG+V+C FYMKTG CK+G  CRF+HP                       
Sbjct  336  KGL-----PIRPGEVDCSFYMKTGSCKYGSICRFNHPYRPVVDIALIAPLVQTTLPTPAP  390

Query  477  ------LDHSLSVTSSMEGEQQNFKLSLAGL-PRREGAIHCPYYMKTGICKFGATCKFDH  319
                  L+ + +V  S +    +  +    + P+R G   C +YMKTG CK+   CKF H
Sbjct  391  IISAPMLNPATNVLQSFDFHVTHVPIEPVPIYPQRPGETVCDFYMKTGFCKYSQKCKFHH  450

Query  318  P  316
            P
Sbjct  451  P  451


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 78/173 (45%), Gaps = 24/173 (14%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CKYG  C+++HP              GV N                        Y
Sbjct  172  MRTRTCKYGEACKFDHPQWVPEG--------GVPN--------------WKEVPNVEDYY  209

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C + +K+  C+F  RC+F+HP +   ++ +  + E      S A LP R   
Sbjct  210  PERPGEPDCPYLVKSNTCRFKSRCKFNHPKEKVNALEAGTDNEHSLIADS-AILPVRPSE  268

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYA-KLVEA  229
              C +Y KTG CKFGA CKF+HP P  +   T    +T      G A  LV A
Sbjct  269  PVCSFYAKTGKCKFGANCKFNHPMPSVIAKETIYTATTDAAAHIGAADDLVPA  321


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (54%), Gaps = 17/102 (17%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRP + +C FYM+T  CK+GE C+F HP           EG   
Sbjct  150  PRLESSL-----PIYPQRPREKDCAFYMRTRTCKYGEACKFDHP-------QWVPEGGVP  197

Query  429  NFKLSLAGL----PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N+K  +  +    P R G   CPY +K+  C+F + CKF+HP
Sbjct  198  NWK-EVPNVEDYYPERPGEPDCPYLVKSNTCRFKSRCKFNHP  238



>ref|XP_004969170.1| PREDICTED: zinc finger CCCH domain-containing protein 8-like 
isoform X1 [Setaria italica]
Length=564

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 102/163 (63%), Gaps = 14/163 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTIN-------------PPAAHLNVGVVNPTASLFQTFDPR  604
            +KTGSCKYG+ CR+NHP R  ++              PA  ++  ++NP  ++ Q+FD  
Sbjct  379  MKTGSCKYGSICRFNHPYRPVVDIALIAPLVQTTLPTPAPIISAPMLNPATNVLQSFDFH  438

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
            +T         IYPQRPG+  CDFYMKTG CK+ ++C+FHHP++ S    +     +Q  
Sbjct  439  VTHVPIE-PVPIYPQRPGETVCDFYMKTGFCKYSQKCKFHHPMNRSEPGANGNWDPEQPV  497

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
             L+LAGLPRREGA  C +YM++G C++GA CKFDHPPP E I 
Sbjct  498  TLTLAGLPRREGAEACAFYMRSGTCRYGAHCKFDHPPPQEAIA  540


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 76/181 (42%), Gaps = 44/181 (24%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTI---------NPPAAHLNVGVVNPTASLFQTFDPRLTQTM  589
            KTG CK+GA C++NHP    I            AAH+        A +     P      
Sbjct  304  KTGKCKFGANCKFNHPMPSVIAKETIYTATTDAAAHIGAADDLVPAKMHAPTAPSEAHNP  363

Query  588  FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----------------------  478
             G      P RPG+V+C FYMKTG CK+G  CRF+HP                       
Sbjct  364  KGL-----PIRPGEVDCSFYMKTGSCKYGSICRFNHPYRPVVDIALIAPLVQTTLPTPAP  418

Query  477  ------LDHSLSVTSSMEGEQQNFKLSLAGL-PRREGAIHCPYYMKTGICKFGATCKFDH  319
                  L+ + +V  S +    +  +    + P+R G   C +YMKTG CK+   CKF H
Sbjct  419  IISAPMLNPATNVLQSFDFHVTHVPIEPVPIYPQRPGETVCDFYMKTGFCKYSQKCKFHH  478

Query  318  P  316
            P
Sbjct  479  P  479


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (54%), Gaps = 17/102 (17%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRP + +C FYM+T  CK+GE C+F HP           EG   
Sbjct  150  PRLESSL-----PIYPQRPREKDCAFYMRTRTCKYGEACKFDHP-------QWVPEGGVP  197

Query  429  NFKLSLAGL----PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N+K  +  +    P R G   CPY +K+  C+F + CKF+HP
Sbjct  198  NWK-EVPNVEDYYPERPGEPDCPYLVKSNTCRFKSRCKFNHP  238


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 80/201 (40%), Gaps = 52/201 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CKYG  C+++HP              GV N                        Y
Sbjct  172  MRTRTCKYGEACKFDHPQWVP--------EGGVPN--------------WKEVPNVEDYY  209

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE--  391
            P+RPG+ +C + +K+  C+F  RC+F+HP +   ++ +  + E      S A LP R   
Sbjct  210  PERPGEPDCPYLVKSNTCRFKSRCKFNHPKEKVNALEAGTDNEHSLIADS-AILPVRPSE  268

Query  390  -----------------------GAIHCP---YYMKTGICKFGATCKFDHPPPGELIGGT  289
                                     + CP   +Y KTG CKFGA CKF+HP P  +   T
Sbjct  269  PVCSVRSTFASFIIINYLYCFHCAMLKCPSFQFYAKTGKCKFGANCKFNHPMPSVIAKET  328

Query  288  SQVTSTSVGEEEGYA-KLVEA  229
                +T      G A  LV A
Sbjct  329  IYTATTDAAAHIGAADDLVPA  349



>gb|KCW71429.1| hypothetical protein EUGRSUZ_F04489 [Eucalyptus grandis]
Length=479

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 91/138 (66%), Gaps = 20/138 (14%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV---------NPT------ASLFQTFD  610
            LKTGSCKYGATCRYNHP+R  I+     L+VG+V         NP       AS++Q  D
Sbjct  345  LKTGSCKYGATCRYNHPERNAID-----LHVGIVPIVGASPARNPNFAAGSAASIYQAVD  399

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            P L+Q M G   TIYPQRPGQ+ECD+YMKTG CKFGERC+FHHP+D S    +     QQ
Sbjct  400  PILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPIDRSAPTQAMANQSQQ  459

Query  429  NFKLSLAGLPRREGAIHC  376
              +L+LAGLPRR+  I C
Sbjct  460  TVELTLAGLPRRKVCIEC  477


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 90/196 (46%), Gaps = 40/196 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF--DPRLTQTMFGFA--  577
            LKTG+CK+GATC+++HP    +       + G +  + +       + +L + +   +  
Sbjct  265  LKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREVKLVKPLISLSPA  324

Query  576  ----TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS-------VTSSMEGEQQ  430
                T   P RPG+V+C FY+KTG CK+G  CR++HP  +++        +  +      
Sbjct  325  SSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHPERNAIDLHVGIVPIVGASPARNP  384

Query  429  NFKLSLAG---------------------LPRREGAIHCPYYMKTGICKFGATCKFDHP-  316
            NF    A                       P+R G I C YYMKTG+CKFG  CKF HP 
Sbjct  385  NFAAGSAASIYQAVDPILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPI  444

Query  315  ---PPGELIGGTSQVT  277
                P + +   SQ T
Sbjct  445  DRSAPTQAMANQSQQT  460


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 80/169 (47%), Gaps = 53/169 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT +CK+G  C++NHP    I             P+ +L  T +               
Sbjct  220  LKTQTCKFGLRCKFNHPRDKII-------------PSGTLDDTLN--------------L  252

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD----------------HSLSVTSSMEGEQ  433
            P+R  +  C FY+KTG CKFG  C+FHHP D                 SL+    M  E 
Sbjct  253  PERLTEPPCAFYLKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREV  312

Query  432  QNFK--LSLA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +  K  +SL+        GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  313  KLVKPLISLSPASSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHP  361


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++     ++  LP+R 
Sbjct  154  IYPQRPGEKDCAHYMLTRTCKFGLNCKFDHPI--WVPEGGIPDWKEAPLVTTVESLPQRA  211

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
            G   CP+++KT  CKFG  CKF+HP    +  GT
Sbjct  212  GEPDCPFFLKTQTCKFGLRCKFNHPRDKIIPSGT  245



>ref|XP_010064114.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X4 [Eucalyptus grandis]
Length=474

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 90/135 (67%), Gaps = 20/135 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV---------NPT------ASLFQTFD  610
            LKTGSCKYGATCRYNHP+R  I+     L+VG+V         NP       AS++Q  D
Sbjct  345  LKTGSCKYGATCRYNHPERNAID-----LHVGIVPIVGASPARNPNFAAGSAASIYQAVD  399

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            P L+Q M G   TIYPQRPGQ+ECD+YMKTG CKFGERC+FHHP+D S    +     QQ
Sbjct  400  PILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPIDRSAPTQAMANQSQQ  459

Query  429  NFKLSLAGLPRREGA  385
              +L+LAGLPRR+ A
Sbjct  460  TVELTLAGLPRRKAA  474


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 90/196 (46%), Gaps = 40/196 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF--DPRLTQTMFGFA--  577
            LKTG+CK+GATC+++HP    +       + G +  + +       + +L + +   +  
Sbjct  265  LKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREVKLVKPLISLSPA  324

Query  576  ----TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS-------VTSSMEGEQQ  430
                T   P RPG+V+C FY+KTG CK+G  CR++HP  +++        +  +      
Sbjct  325  SSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHPERNAIDLHVGIVPIVGASPARNP  384

Query  429  NFKLSLAG---------------------LPRREGAIHCPYYMKTGICKFGATCKFDHP-  316
            NF    A                       P+R G I C YYMKTG+CKFG  CKF HP 
Sbjct  385  NFAAGSAASIYQAVDPILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPI  444

Query  315  ---PPGELIGGTSQVT  277
                P + +   SQ T
Sbjct  445  DRSAPTQAMANQSQQT  460


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 80/169 (47%), Gaps = 53/169 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT +CK+G  C++NHP    I             P+ +L  T +               
Sbjct  220  LKTQTCKFGLRCKFNHPRDKII-------------PSGTLDDTLN--------------L  252

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD----------------HSLSVTSSMEGEQ  433
            P+R  +  C FY+KTG CKFG  C+FHHP D                 SL+    M  E 
Sbjct  253  PERLTEPPCAFYLKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREV  312

Query  432  QNFK--LSLA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +  K  +SL+        GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  313  KLVKPLISLSPASSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHP  361


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++     ++  LP+R 
Sbjct  154  IYPQRPGEKDCAHYMLTRTCKFGLNCKFDHPI--WVPEGGIPDWKEAPLVTTVESLPQRA  211

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CP+++KT  CKFG  CKF+HP
Sbjct  212  GEPDCPFFLKTQTCKFGLRCKFNHP  236



>ref|XP_010064113.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X3 [Eucalyptus grandis]
Length=478

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 89/133 (67%), Gaps = 20/133 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV---------NPT------ASLFQTFD  610
            LKTGSCKYGATCRYNHP+R  I+     L+VG+V         NP       AS++Q  D
Sbjct  345  LKTGSCKYGATCRYNHPERNAID-----LHVGIVPIVGASPARNPNFAAGSAASIYQAVD  399

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            P L+Q M G   TIYPQRPGQ+ECD+YMKTG CKFGERC+FHHP+D S    +     QQ
Sbjct  400  PILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPIDRSAPTQAMANQSQQ  459

Query  429  NFKLSLAGLPRRE  391
              +L+LAGLPRR+
Sbjct  460  TVELTLAGLPRRK  472


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 90/196 (46%), Gaps = 40/196 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF--DPRLTQTMFGFA--  577
            LKTG+CK+GATC+++HP    +       + G +  + +       + +L + +   +  
Sbjct  265  LKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREVKLVKPLISLSPA  324

Query  576  ----TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS-------VTSSMEGEQQ  430
                T   P RPG+V+C FY+KTG CK+G  CR++HP  +++        +  +      
Sbjct  325  SSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHPERNAIDLHVGIVPIVGASPARNP  384

Query  429  NFKLSLAG---------------------LPRREGAIHCPYYMKTGICKFGATCKFDHP-  316
            NF    A                       P+R G I C YYMKTG+CKFG  CKF HP 
Sbjct  385  NFAAGSAASIYQAVDPILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPI  444

Query  315  ---PPGELIGGTSQVT  277
                P + +   SQ T
Sbjct  445  DRSAPTQAMANQSQQT  460


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 80/169 (47%), Gaps = 53/169 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT +CK+G  C++NHP    I             P+ +L  T +               
Sbjct  220  LKTQTCKFGLRCKFNHPRDKII-------------PSGTLDDTLN--------------L  252

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD----------------HSLSVTSSMEGEQ  433
            P+R  +  C FY+KTG CKFG  C+FHHP D                 SL+    M  E 
Sbjct  253  PERLTEPPCAFYLKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREV  312

Query  432  QNFK--LSLA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +  K  +SL+        GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  313  KLVKPLISLSPASSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHP  361


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++     ++  LP+R 
Sbjct  154  IYPQRPGEKDCAHYMLTRTCKFGLNCKFDHPI--WVPEGGIPDWKEAPLVTTVESLPQRA  211

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   CP+++KT  CKFG  CKF+HP
Sbjct  212  GEPDCPFFLKTQTCKFGLRCKFNHP  236



>ref|XP_010064112.1| PREDICTED: zinc finger CCCH domain-containing protein 37 isoform 
X2 [Eucalyptus grandis]
Length=494

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 90/135 (67%), Gaps = 20/135 (15%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV---------NPT------ASLFQTFD  610
            LKTGSCKYGATCRYNHP+R  I+     L+VG+V         NP       AS++Q  D
Sbjct  345  LKTGSCKYGATCRYNHPERNAID-----LHVGIVPIVGASPARNPNFAAGSAASIYQAVD  399

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            P L+Q M G   TIYPQRPGQ+ECD+YMKTG CKFGERC+FHHP+D S    +     QQ
Sbjct  400  PILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPIDRSAPTQAMANQSQQ  459

Query  429  NFKLSLAGLPRREGA  385
              +L+LAGLPRR+ +
Sbjct  460  TVELTLAGLPRRKDS  474


 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 90/196 (46%), Gaps = 40/196 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF--DPRLTQTMFGFA--  577
            LKTG+CK+GATC+++HP    +       + G +  + +       + +L + +   +  
Sbjct  265  LKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREVKLVKPLISLSPA  324

Query  576  ----TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS-------VTSSMEGEQQ  430
                T   P RPG+V+C FY+KTG CK+G  CR++HP  +++        +  +      
Sbjct  325  SSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHPERNAIDLHVGIVPIVGASPARNP  384

Query  429  NFKLSLAG---------------------LPRREGAIHCPYYMKTGICKFGATCKFDHP-  316
            NF    A                       P+R G I C YYMKTG+CKFG  CKF HP 
Sbjct  385  NFAAGSAASIYQAVDPILSQLMLGAGPTIYPQRPGQIECDYYMKTGVCKFGERCKFHHPI  444

Query  315  ---PPGELIGGTSQVT  277
                P + +   SQ T
Sbjct  445  DRSAPTQAMANQSQQT  460


 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 80/169 (47%), Gaps = 53/169 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKT +CK+G  C++NHP    I             P+ +L  T +               
Sbjct  220  LKTQTCKFGLRCKFNHPRDKII-------------PSGTLDDTLN--------------L  252

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD----------------HSLSVTSSMEGEQ  433
            P+R  +  C FY+KTG CKFG  C+FHHP D                 SL+    M  E 
Sbjct  253  PERLTEPPCAFYLKTGNCKFGATCKFHHPKDIKVAQVLQDTDAGELRDSLAENDRMVREV  312

Query  432  QNFK--LSLA--------GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            +  K  +SL+        GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct  313  KLVKPLISLSPASSHNTKGLPIRPGEVDCPFYLKTGSCKYGATCRYNHP  361


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+ +C  YM T  CKFG  C+F HP+   +      + ++     ++  LP+R 
Sbjct  154  IYPQRPGEKDCAHYMLTRTCKFGLNCKFDHPI--WVPEGGIPDWKEAPLVTTVESLPQRA  211

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
            G   CP+++KT  CKFG  CKF+HP    +  GT
Sbjct  212  GEPDCPFFLKTQTCKFGLRCKFNHPRDKIIPSGT  245



>ref|NP_001136594.1| uncharacterized protein LOC100216717 [Zea mays]
 gb|ACF82237.1| unknown [Zea mays]
 gb|AFW83265.1| hypothetical protein ZEAMMB73_943527 [Zea mays]
Length=165

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 94/151 (62%), Gaps = 11/151 (7%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN--VGVVNPTASLFQTFDPRLTQTMFGFATT  571
            +KTGSCKYG+ CR+NHPDR     PAA +   V +V  T        P + + +      
Sbjct  1    MKTGSCKYGSICRFNHPDRPG---PAADIAFMVPLVQATLPSSAPIVPAVVEPL----PM  53

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+  CDFYMKTG CK+ ++C+FHHP+    +  S   G+ Q    +LA LPRRE
Sbjct  54   IYPQRPGETVCDFYMKTGSCKYSQKCKFHHPISR-FAPHSKENGDPQQ-PATLASLPRRE  111

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELI  298
             A  C +YM++G+C+FGA CKFDHPP  E I
Sbjct  112  DAEACAFYMRSGMCRFGAHCKFDHPPREEAI  142



>gb|AFW83269.1| hypothetical protein ZEAMMB73_943527 [Zea mays]
Length=308

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 89/150 (59%), Gaps = 7/150 (5%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTGSCKYG+ CR+NHPDR     P    ++  + P           +   +      IY
Sbjct  144  MKTGSCKYGSICRFNHPDR-----PGPAADIAFMVPLVQATLPSSAPIVPAVVEPLPMIY  198

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            PQRPG+  CDFYMKTG CK+ ++C+FHHP+    +  S   G+ Q    +LA LPRRE A
Sbjct  199  PQRPGETVCDFYMKTGSCKYSQKCKFHHPISR-FAPHSKENGDPQQ-PATLASLPRREDA  256

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIG  295
              C +YM++G+C+FGA CKFDHPP  E I 
Sbjct  257  EACAFYMRSGMCRFGAHCKFDHPPREEAIS  286


 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 29/152 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L    CK+ + C++NHP +  +N     L  G  N   SL                + + 
Sbjct  29   LLNNRCKFKSKCKFNHP-KDMVN----ALGTGTNN--ESLIAD-------------SAVL  68

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD---------HSLSVTSSMEGEQQNFKLSL  412
            P RP +  C FY KTG+CKFG  C+F+HP D          ++   ++   +      + 
Sbjct  69   PVRPSEPICVFYAKTGKCKFGAICKFNHPKDIKTSPLIAKETIYTATTDAADAPTEACNA  128

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             GLP R+G + C +YMKTG CK+G+ C+F+HP
Sbjct  129  KGLPIRQGEVDCSFYMKTGSCKYGSICRFNHP  160


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG+ +C  Y+    CKF  +C+F+HP D   ++ +    E  +     A LP R  
Sbjct  17   YPERPGEPDCP-YLLNNRCKFKSKCKFNHPKDMVNALGTGTNNE--SLIADSAVLPVRPS  73

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +Y KTG CKFGA CKF+HP
Sbjct  74   EPICVFYAKTGKCKFGAICKFNHP  97



>gb|AFW83266.1| hypothetical protein ZEAMMB73_943527 [Zea mays]
Length=333

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 94/152 (62%), Gaps = 11/152 (7%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN--VGVVNPTASLFQTFDPRLTQTMFGFATT  571
            +KTGSCKYG+ CR+NHPDR     PAA +   V +V  T        P + + +      
Sbjct  169  MKTGSCKYGSICRFNHPDRPG---PAADIAFMVPLVQATLPSSAPIVPAVVEPL----PM  221

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG+  CDFYMKTG CK+ ++C+FHHP+    +  S   G+ Q    +LA LPRRE
Sbjct  222  IYPQRPGETVCDFYMKTGSCKYSQKCKFHHPISR-FAPHSKENGDPQQ-PATLASLPRRE  279

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
             A  C +YM++G+C+FGA CKFDHPP  E I 
Sbjct  280  DAEACAFYMRSGMCRFGAHCKFDHPPREEAIS  311


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 74/157 (47%), Gaps = 14/157 (9%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASL-FQTFDP----RLTQTMFGF  580
            L    CK+ + C++NHP            N  ++  +A L  +  +P    R    +  F
Sbjct  29   LLNNRCKFKSKCKFNHPKDMVNALGTGTNNESLIADSAVLPVRPSEPICVVRSYIAVIFF  88

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLD---------HSLSVTSSMEGEQQN  427
             +   P   G     FY KTG+CKFG  C+F+HP D          ++   ++   +   
Sbjct  89   FSWHSPSFLGCPVFQFYAKTGKCKFGAICKFNHPKDIKTSPLIAKETIYTATTDAADAPT  148

Query  426  FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               +  GLP R+G + C +YMKTG CK+G+ C+F+HP
Sbjct  149  EACNAKGLPIRQGEVDCSFYMKTGSCKYGSICRFNHP  185



>ref|XP_001766711.1| predicted protein [Physcomitrella patens]
 gb|EDQ68564.1| predicted protein, partial [Physcomitrella patens]
Length=323

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 84/157 (54%), Gaps = 8/157 (5%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY-  565
            KTGSCKYG  CRYNHP+    +             +    Q +     Q      T +Y 
Sbjct  121  KTGSCKYGTACRYNHPEILLPDVSGQATTADYAYTSTQNSQEYAYAAAQAYHQNVTPMYV  180

Query  564  -------PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG  406
                   PQRPG+ +C FY+KTGEC FG  C+FHHP D   S        Q   KLSLAG
Sbjct  181  ASMGLPHPQRPGEPDCTFYIKTGECSFGATCKFHHPPDRIPSGIPKPAKNQATVKLSLAG  240

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
            LPRRE    C YYMKTG CKFG TCK+DHPPP E+I 
Sbjct  241  LPRRETETPCAYYMKTGACKFGQTCKYDHPPPQEIIA  277


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 83/170 (49%), Gaps = 36/170 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG C+YG+ CR+NHP +  +          VVN  A +    +P  T     F +   
Sbjct  58   MKTGECRYGSKCRFNHP-KEKLESSNTDEQSSVVNQAAPI----NPATT-----FNSKGL  107

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP-------------LDHSLSVTSSME------  442
            P RPG+  C FY KTG CK+G  CR++HP              D++ + T + +      
Sbjct  108  PLRPGEGNCVFYGKTGSCKYGTACRYNHPEILLPDVSGQATTADYAYTSTQNSQEYAYAA  167

Query  441  --GEQQNFK---LSLAGL--PRREGAIHCPYYMKTGICKFGATCKFDHPP  313
                 QN     ++  GL  P+R G   C +Y+KTG C FGATCKF HPP
Sbjct  168  AQAYHQNVTPMYVASMGLPHPQRPGEPDCTFYIKTGECSFGATCKFHHPP  217


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 71/151 (47%), Gaps = 36/151 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +C +G TCRY+HP   T         VG     +SL                    
Sbjct  14   MITRTCSFGVTCRYDHPAWVTA--------VGTPVDPSSL--------------------  45

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP--------LDHSLSVTSSMEGEQQNFKLSLA  409
            PQRP + +C ++MKTGEC++G +CRF+HP         D   SV +           +  
Sbjct  46   PQRPTEPDCAYFMKTGECRYGSKCRFNHPKEKLESSNTDEQSSVVNQAAPINPATTFNSK  105

Query  408  GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            GLP R G  +C +Y KTG CK+G  C+++HP
Sbjct  106  GLPLRPGEGNCVFYGKTGSCKYGTACRYNHP  136


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 10/84 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YPQRPG+  C +YM T  C FG  CR+ HP   +   T           +  + LP+R  
Sbjct  1    YPQRPGEKVCAYYMITRTCSFGVTCRYDHPAWVTAVGT----------PVDPSSLPQRPT  50

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C Y+MKTG C++G+ C+F+HP
Sbjct  51   EPDCAYFMKTGECRYGSKCRFNHP  74



>ref|XP_008654463.1| PREDICTED: uncharacterized protein LOC100216717 isoform X1 [Zea 
mays]
Length=444

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 89/149 (60%), Gaps = 7/149 (5%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTGSCKYG+ CR+NHPDR     P    ++  + P           +   +      IY
Sbjct  280  MKTGSCKYGSICRFNHPDR-----PGPAADIAFMVPLVQATLPSSAPIVPAVVEPLPMIY  334

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            PQRPG+  CDFYMKTG CK+ ++C+FHHP+    +  S   G+ Q    +LA LPRRE A
Sbjct  335  PQRPGETVCDFYMKTGSCKYSQKCKFHHPISR-FAPHSKENGDPQQ-PATLASLPRREDA  392

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C +YM++G+C+FGA CKFDHPP  E I
Sbjct  393  EACAFYMRSGMCRFGAHCKFDHPPREEAI  421


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 74/152 (49%), Gaps = 29/152 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L    CK+ + C++NHP +  +N     L  G  N   SL                + + 
Sbjct  165  LLNNRCKFKSKCKFNHP-KDMVN----ALGTGTNN--ESLIAD-------------SAVL  204

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD---------HSLSVTSSMEGEQQNFKLSL  412
            P RP +  C FY KTG+CKFG  C+F+HP D          ++   ++   +      + 
Sbjct  205  PVRPSEPICVFYAKTGKCKFGAICKFNHPKDIKTSPLIAKETIYTATTDAADAPTEACNA  264

Query  411  AGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             GLP R+G + C +YMKTG CK+G+ C+F+HP
Sbjct  265  KGLPIRQGEVDCSFYMKTGSCKYGSICRFNHP  296


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 71/143 (50%), Gaps = 25/143 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + TG+CKYG TC+++HP R            GV N   +      P +  +        Y
Sbjct  116  MSTGTCKYGETCKFDHPQRVPEG--------GVPNWKEA------PNVEDS--------Y  153

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C  Y+    CKF  +C+F+HP D   ++ +    E  +     A LP R   
Sbjct  154  PERPGEPDCP-YLLNNRCKFKSKCKFNHPKDMVNALGTGTNNE--SLIADSAVLPVRPSE  210

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C +Y KTG CKFGA CKF+HP
Sbjct  211  PICVFYAKTGKCKFGAICKFNHP  233


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 53/101 (52%), Gaps = 16/101 (16%)
 Frame = -2

Query  609  PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ  430
            PRL  ++      IYPQRPGQ +C FYM TG CK+GE C+F HP           EG   
Sbjct  94   PRLESSL-----PIYPQRPGQKDCAFYMSTGTCKYGETCKFDHP-------QRVPEGGVP  141

Query  429  NFKLS---LAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            N+K +       P R G   CPY +    CKF + CKF+HP
Sbjct  142  NWKEAPNVEDSYPERPGEPDCPYLLNNR-CKFKSKCKFNHP  181



>ref|XP_008791419.1| PREDICTED: zinc finger CCCH domain-containing protein 8 [Phoenix 
dactylifera]
Length=96

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = -2

Query  528  MKTGECKFGERCRFHHPLDHSLS-VTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGI  352
            MKTG+CKFGERC+FHHP D S   ++ + +  QQN KL+LAGLPRRE A+ C +YMKTG 
Sbjct  1    MKTGQCKFGERCKFHHPFDRSAPPISDAKQSLQQNVKLTLAGLPRREDAVICSFYMKTGT  60

Query  351  CKFGATCKFDHPPPGELI  298
            CKFGATCKFDHPPPGE +
Sbjct  61   CKFGATCKFDHPPPGEAV  78


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 44/90 (49%), Gaps = 19/90 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G  C+++HP DR                P +   Q+    +  T+ G     
Sbjct  1    MKTGQCKFGERCKFHHPFDRS-------------APPISDAKQSLQQNVKLTLAGL----  43

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHP  478
             P+R   V C FYMKTG CKFG  C+F HP
Sbjct  44   -PRREDAVICSFYMKTGTCKFGATCKFDHP  72



>gb|AIB05645.1| C3H transcription factor, partial [Zea mays]
Length=94

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            IYPQRPG++ CDFYMKTG CK+ + C+FHHP D S   +   E  QQ   L+LAGLPRRE
Sbjct  4    IYPQRPGEIVCDFYMKTGSCKYAQNCKFHHPFDRSAPHSKENEDTQQPVALTLAGLPRRE  63

Query  390  GAIHCPYYMKTGICKFGATCKFDHPP  313
             A  C +YM++G C FGA CKFDHPP
Sbjct  64   DAEACAFYMRSGTCGFGARCKFDHPP  89


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 43/89 (48%), Gaps = 18/89 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTGSCKY   C+++HP  +  + P +  N     P A            T+ G      
Sbjct  18   MKTGSCKYAQNCKFHHP--FDRSAPHSKENEDTQQPVAL-----------TLAGL-----  59

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP  478
            P+R     C FYM++G C FG RC+F HP
Sbjct  60   PRREDAEACAFYMRSGTCGFGARCKFDHP  88



>ref|XP_001771210.1| predicted protein [Physcomitrella patens]
 gb|EDQ63921.1| predicted protein, partial [Physcomitrella patens]
Length=278

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 85/149 (57%), Gaps = 10/149 (7%)
 Frame = -2

Query  741  KTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYP  562
            KTGSCK+G  CRYNHP+          + + + N   S+ +    +L++++    +T   
Sbjct  134  KTGSCKHGPACRYNHPEILL------SMRMQLDN-NLSVKKIIPMQLSRSLETGQSTCTQ  186

Query  561  QRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAI  382
            Q     +  FY+KTGEC FG  C+FHHP D   +        Q   KLSLAGLPRRE   
Sbjct  187  Q---SNQDKFYIKTGECSFGATCKFHHPPDRIPTGIPKPAKNQGLVKLSLAGLPRRETEA  243

Query  381  HCPYYMKTGICKFGATCKFDHPPPGELIG  295
             C YYMKTG CKFG TCK+DHPPP E+I 
Sbjct  244  PCAYYMKTGACKFGQTCKYDHPPPQEIIA  272


 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 71/159 (45%), Gaps = 39/159 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            + T +C +G TCRY+HP              G      ++    DP            + 
Sbjct  14   MATRTCSFGVTCRYDHP------------ACGTGGQVTAVGTPVDP-----------CLL  50

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP--------LDHSLSVTSSMEGEQQNFKLSLA  409
            PQRP + +C ++MKTGEC++G +CRF+HP         D   S  SS          +  
Sbjct  51   PQRPAEPDCAYFMKTGECRYGPQCRFNHPKEKLEPSNTDDQYSAASSAAFGNPATAYNTN  110

Query  408  GLPRR--------EGAIHCPYYMKTGICKFGATCKFDHP  316
            GLP R        +G  +C +Y KTG CK G  C+++HP
Sbjct  111  GLPLRPVTCARDVQGEGNCVFYGKTGSCKHGPACRYNHP  149


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 5/84 (6%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YPQRPGQ  C +YM T  C FG  CR+ HP   +    +++        +    LP+R  
Sbjct  1    YPQRPGQKVCAYYMATRTCSFGVTCRYDHPACGTGGQVTAV-----GTPVDPCLLPQRPA  55

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C Y+MKTG C++G  C+F+HP
Sbjct  56   EPDCAYFMKTGECRYGPQCRFNHP  79


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 44/90 (49%), Gaps = 20/90 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNH-PDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG C +GATC+++H PDR     P    N G+V                     +   
Sbjct  195  IKTGECSFGATCKFHHPPDRIPTGIPKPAKNQGLVK-------------------LSLAG  235

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHP  478
             P+R  +  C +YMKTG CKFG+ C++ HP
Sbjct  236  LPRRETEAPCAYYMKTGACKFGQTCKYDHP  265



>ref|XP_009382899.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C++G TCRYNHP    +   AA +  G                           Y
Sbjct  72   LRTGLCRFGITCRYNHPPNRQMAIAAARIKGG---------------------------Y  104

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC+FY++TG CKFG  C+FHHP D +        G     +L++ G P R   
Sbjct  105  PERVGQPECEFYLRTGTCKFGATCKFHHPRDKA--------GIAGRVQLNVLGYPLRPDE  156

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYMK G CKFG TCKF HP P  ++
Sbjct  157  AECAYYMKNGECKFGNTCKFHHPQPNTMV  185


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 8/85 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            ++P RPGQ EC+FY+KTG+CK+G  C+FHHP +  + +   +        LS  GLP R 
Sbjct  309  VFPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIPIPDCV--------LSPLGLPLRP  360

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
                C +Y + GICKFG  CKFDHP
Sbjct  361  EEPICIFYSRYGICKFGTHCKFDHP  385


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 11/97 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            +P+RP + +C +Y++TG C+FG  CR++HP +  +++ ++ ++G          G P R 
Sbjct  59   FPERPREPDCTYYLRTGLCRFGITCRYNHPPNRQMAIAAARIKG----------GYPERV  108

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            G   C +Y++TG CKFGATCKF HP     I G  Q+
Sbjct  109  GQPECEFYLRTGTCKFGATCKFHHPRDKAGIAGRVQL  145


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 42/96 (44%), Gaps = 26/96 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG CKYGA C+++HP    I  P       V++P                        
Sbjct  323  LKTGDCKYGAACKFHHPRERLIPIPDC-----VLSPLG---------------------L  356

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            P RP +  C FY + G CKFG  C+F HP+   + +
Sbjct  357  PLRPEEPICIFYSRYGICKFGTHCKFDHPMAAPMGI  392



>ref|XP_011085488.1| PREDICTED: zinc finger CCCH domain-containing protein 3 isoform 
X1 [Sesamum indicum]
Length=414

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 77/147 (52%), Gaps = 37/147 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA-TTI  568
            L+TGSC YG +CR+NHP            N G VN                ++G   T+ 
Sbjct  55   LRTGSCGYGTSCRFNHPS-----------NAGQVN--------------TIVYGVKNTSE  89

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
             P+R GQ +C +Y+KTG CK+G  C++HHP D            Q +  ++L GLP R+ 
Sbjct  90   LPERAGQPDCGYYLKTGTCKYGSTCKYHHPKD-----------RQADVLMNLVGLPMRQN  138

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPG  307
               CPYYM+TG+CK+G  CKF HP P 
Sbjct  139  TRSCPYYMRTGLCKYGYACKFHHPQPA  165


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP RPG+ +C +Y++TG C +G  CRF+HP  ++  V + + G +   +     LP R G
Sbjct  42   YPDRPGEPDCIYYLRTGSCGYGTSCRFNHP-SNAGQVNTIVYGVKNTSE-----LPERAG  95

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY+KTG CK+G+TCK+ HP
Sbjct  96   QPDCGYYLKTGTCKYGSTCKYHHP  119


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 8/89 (9%)
 Frame = -2

Query  582  FATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGL  403
             + +  P+RP Q EC ++M  G CK+G  C++HHP +    V SS         L   GL
Sbjct  255  LSASYLPERPDQPECRYFMIHGSCKYGLDCKYHHPKEKISQVASS--------SLGPLGL  306

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   C YY   G+CK+G TCKFDHP
Sbjct  307  PLRPGQPICSYYSLYGLCKYGPTCKFDHP  335


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 73/184 (40%), Gaps = 50/184 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV------------NPTASLFQTFDPRL  601
            ++TG CKYG  C+++HP       PA   NV  V             P+       DP  
Sbjct  146  MRTGLCKYGYACKFHHPQ------PATTTNVLPVIGPVYGSGGSTGAPSPGAPSIGDPST  199

Query  600  T----QTMFGFATTIYPQR-------PGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            T     T F  +    PQ        P Q   + YM +                  LSVT
Sbjct  200  TPLSKATYFSNSLLQLPQNYIPLFLSPSQ-GWNTYMGSVA---------------PLSVT  243

Query  453  SSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            S +     N +LS + LP R     C Y+M  G CK+G  CK+ H  P E I   SQV S
Sbjct  244  SVLTTPASNGQLSASYLPERPDQPECRYFMIHGSCKYGLDCKYHH--PKEKI---SQVAS  298

Query  273  TSVG  262
            +S+G
Sbjct  299  SSLG  302



>ref|XP_002993272.1| hypothetical protein SELMODRAFT_45667, partial [Selaginella moellendorffii]
 gb|EFJ05693.1| hypothetical protein SELMODRAFT_45667, partial [Selaginella moellendorffii]
Length=294

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 86/176 (49%), Gaps = 43/176 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTI-------------------NPPAA-----HLNVGVVNP  637
            ++TGSCKYG TC+++HP    +                    P AA     H   G  +P
Sbjct  110  MRTGSCKYGVTCKFHHPQPAVVPSIYAAAAAAAAAGASQPGTPNAATGTPQHFQPG--SP  167

Query  636  TASLFQTFDPR---------LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFH  484
            T + +  F P          L +   G     +P+RPG  EC +Y+KTG+CK+G  CRFH
Sbjct  168  TTADYSPFVPGSPTMGLPAGLREHKGGGGGDAFPERPGVAECQYYLKTGDCKYGASCRFH  227

Query  483  HPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            HP D   +   +M        LS  GLP R G   C YY++ GICKFG TCKFDHP
Sbjct  228  HPRDRISASAPTM--------LSPMGLPLRTGVQPCSYYIRFGICKFGPTCKFDHP  275


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C +G +C++NHP    +   AA +  G                           Y
Sbjct  19   MRTGLCAFGMSCKFNHPPNRKL---AAAIARGKGE------------------------Y  51

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPGQ EC +++KTG CKFG  C++ HP D +        G Q   +L++ GLP R G 
Sbjct  52   PERPGQPECQYFLKTGTCKFGSTCKYDHPRDKA--------GIQSRVQLNIVGLPYRPGE  103

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
              C YYM+TG CK+G TCKF HP P
Sbjct  104  KECAYYMRTGSCKYGVTCKFHHPQP  128


 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT-SSMEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +YM+TG C FG  C+F+HP +  L+   +  +GE           P R 
Sbjct  6    YPERPGEQDCVYYMRTGLCAFGMSCKFNHPPNRKLAAAIARGKGE----------YPERP  55

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C Y++KTG CKFG+TCK+DHP
Sbjct  56   GQPECQYFLKTGTCKFGSTCKYDHP  80


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 43/91 (47%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG CKYGA+CR++HP DR + + P     +G+                          
Sbjct  213  LKTGDCKYGASCRFHHPRDRISASAPTMLSPMGL--------------------------  246

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P R G   C +Y++ G CKFG  C+F HPL
Sbjct  247  -PLRTGVQPCSYYIRFGICKFGPTCKFDHPL  276



>gb|KDO47609.1| hypothetical protein CISIN_1g0472481mg, partial [Citrus sinensis]
Length=238

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                            Y
Sbjct  59   IRTGLCRFGATCRFNHP-------PNRKLAIATARIKGD--------------------Y  91

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  92   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNVLGYPLRPNE  143

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  144  IECAYYLRTGQCKFGSTCKFHHPQPNNMM  172


 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 11/84 (13%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRREG  388
            P+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ ++G+           P R G
Sbjct  47   PERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKGD----------YPERVG  96

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY+KTG CKFGATCKF HP
Sbjct  97   QPECQYYLKTGTCKFGATCKFHHP  120


 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 56/98 (57%), Gaps = 28/98 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I   A  +++ V+                         
Sbjct  104  LKTGTCKFGATCKFHHPRDKAGI---AGRVSLNVLG------------------------  136

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            YP RP ++EC +Y++TG+CKFG  C+FHHP  +++ V+
Sbjct  137  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVS  174


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            N  +    LP R G   C YY++TG+C+FGATC+F+HPP  +L   T+++
Sbjct  38   NEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARI  87



>ref|XP_011085490.1| PREDICTED: zinc finger CCCH domain-containing protein 3 isoform 
X3 [Sesamum indicum]
Length=394

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 77/147 (52%), Gaps = 37/147 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA-TTI  568
            L+TGSC YG +CR+NHP            N G VN                ++G   T+ 
Sbjct  55   LRTGSCGYGTSCRFNHPS-----------NAGQVN--------------TIVYGVKNTSE  89

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
             P+R GQ +C +Y+KTG CK+G  C++HHP D            Q +  ++L GLP R+ 
Sbjct  90   LPERAGQPDCGYYLKTGTCKYGSTCKYHHPKD-----------RQADVLMNLVGLPMRQN  138

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPG  307
               CPYYM+TG+CK+G  CKF HP P 
Sbjct  139  TRSCPYYMRTGLCKYGYACKFHHPQPA  165


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 76/184 (41%), Gaps = 55/184 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNV--------------GVVNPTA--------  631
            ++TG CKYG  C+++HP       PA   NV              G  +P A        
Sbjct  146  MRTGLCKYGYACKFHHPQ------PATTTNVLPVIGPVYGSGGSTGAPSPGAPSIGDPST  199

Query  630  -----------SLFQT--------FDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECK  508
                       SL Q           P      +  + +  P+RP Q EC ++M  G CK
Sbjct  200  TPLSKATYFSNSLLQLPQNYIPLFLSPSQGWNTYMLSASYLPERPDQPECRYFMIHGSCK  259

Query  507  FGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCK  328
            +G  C++HHP +    V SS         L   GLP R G   C YY   G+CK+G TCK
Sbjct  260  YGLDCKYHHPKEKISQVASS--------SLGPLGLPLRPGQPICSYYSLYGLCKYGPTCK  311

Query  327  FDHP  316
            FDHP
Sbjct  312  FDHP  315


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP RPG+ +C +Y++TG C +G  CRF+HP  ++  V + + G +   +     LP R G
Sbjct  42   YPDRPGEPDCIYYLRTGSCGYGTSCRFNHP-SNAGQVNTIVYGVKNTSE-----LPERAG  95

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY+KTG CK+G+TCK+ HP
Sbjct  96   QPDCGYYLKTGTCKYGSTCKYHHP  119



>ref|XP_002993790.1| hypothetical protein SELMODRAFT_45658, partial [Selaginella moellendorffii]
 gb|EFJ05156.1| hypothetical protein SELMODRAFT_45658, partial [Selaginella moellendorffii]
Length=295

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 86/177 (49%), Gaps = 44/177 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTI--------------------NPPAA-----HLNVGVVN  640
            ++TGSCKYG TC+++HP    +                     P AA     H   G  +
Sbjct  110  MRTGSCKYGVTCKFHHPQPAVVPSIYAAAAAAAAAAGASQPGTPNAATGTPQHFQPG--S  167

Query  639  PTASLFQTFDPR---------LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRF  487
            PT + +  F P          L +   G     +P+RPG  EC +Y+KTG+CK+G  CRF
Sbjct  168  PTTADYSPFVPGSPTMGLPAGLREHKGGGGGDAFPERPGVAECQYYLKTGDCKYGASCRF  227

Query  486  HHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            HHP D   +   +M        LS  GLP R G   C YY++ GICKFG TCKFDHP
Sbjct  228  HHPRDRISASAPTM--------LSPMGLPLRTGVQPCSYYIRFGICKFGPTCKFDHP  276


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C +G +C++NHP    +   AA +  G                           Y
Sbjct  19   MRTGLCAFGMSCKFNHPPNRKL---AAAIARGKGE------------------------Y  51

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPGQ EC +++KTG CKFG  C++ HP D +        G Q   +L++ GLP R G 
Sbjct  52   PERPGQPECQYFLKTGTCKFGSTCKYDHPRDKA--------GIQSRVQLNIVGLPYRPGE  103

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
              C YYM+TG CK+G TCKF HP P
Sbjct  104  KECAYYMRTGSCKYGVTCKFHHPQP  128


 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT-SSMEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +YM+TG C FG  C+F+HP +  L+   +  +GE           P R 
Sbjct  6    YPERPGEQDCVYYMRTGLCAFGMSCKFNHPPNRKLAAAIARGKGE----------YPERP  55

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C Y++KTG CKFG+TCK+DHP
Sbjct  56   GQPECQYFLKTGTCKFGSTCKYDHP  80


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 43/91 (47%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG CKYGA+CR++HP DR + + P     +G+                          
Sbjct  214  LKTGDCKYGASCRFHHPRDRISASAPTMLSPMGL--------------------------  247

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P R G   C +Y++ G CKFG  C+F HPL
Sbjct  248  -PLRTGVQPCSYYIRFGICKFGPTCKFDHPL  277



>ref|XP_010558591.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
[Tarenaya hassleriana]
Length=397

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 89/170 (52%), Gaps = 43/170 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR          N+ +               T  M G     
Sbjct  55   IRTGLCRFGSTCRFNHPRDR----------NLAIA--------------TARMKG----E  86

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC +Y+KTG CKFG  C+FHHP +          G   N  L+  G P R  
Sbjct  87   YPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKV--------GIAGNVSLNALGYPIRPN  138

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIG---GTS---QVTSTSVGEE  256
             + C YY++TG CKFG+TCKF+HPPP  L+    G+S    V S S G++
Sbjct  139  EVDCAYYLRTGHCKFGSTCKFNHPPPTNLMAPLRGSSVYPAVQSPSAGQQ  188


 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P++PGQ EC FYMKTG+CKFG  C+FHHP +         +    +  LS  GLP R
Sbjct  272  NVFPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNR--------QNPAPDCVLSPIGLPLR  323

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  324  PGEPLCGFYSRYGICKFGPSCKFDHP  349



>ref|XP_003566542.1| PREDICTED: zinc finger CCCH domain-containing protein 5-like 
[Brachypodium distachyon]
Length=472

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 82/158 (52%), Gaps = 34/158 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TGSC YG +CRYNHP DR      AA  N G              R T  M       
Sbjct  65   LRTGSCSYGESCRYNHPRDR------AAAFNGGA-------------RTTIAM----GVE  101

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPGQ  C++YMK G CKFG  C+++HP +          G  Q   L+ +G P R G
Sbjct  102  YPERPGQPLCEYYMKNGTCKFGSNCKYNHPRE---------GGPVQPVALNTSGYPLRPG  152

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
               C YY+KTG CKFG+TCKF H P G  +G  S+  S
Sbjct  153  EKECSYYIKTGHCKFGSTCKFHH-PDGPELGVVSETPS  189


 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 48/84 (57%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPGQ EC  YMKTG CKFG  C++ HP          +     N  LS  GLP R G
Sbjct  302  FPERPGQPECHHYMKTGTCKFGATCKYSHP--------QYLSAPNSNCMLSPLGLPIRPG  353

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
            A  C YY + G CKFG  CKFDHP
Sbjct  354  AQQCVYYSQHGFCKFGPRCKFDHP  377


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+  C +Y++TG C +GE CR++HP D + +      G +    + +   P R G 
Sbjct  53   PERPGEANCIYYLRTGSCSYGESCRYNHPRDRAAAFNG---GARTTIAMGVE-YPERPGQ  108

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C YYMK G CKFG+ CK++HP
Sbjct  109  PLCEYYMKNGTCKFGSNCKYNHP  131



>ref|XP_010525081.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 77/149 (52%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP    +   AA +                              Y
Sbjct  56   IRTGLCRFGSTCRFNHPRDRNLAIAAARMK---------------------------GEY  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP + +        G      L++ G P R   
Sbjct  89   PERIGQPECQYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRVSLNVLGYPIRPNE  140

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF+HPPP  L+
Sbjct  141  VECSYYLRTGHCKFGSTCKFNHPPPTNLM  169


 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  C+FHHP D  +     +        LS  GLP R
Sbjct  287  NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQIPPPDCV--------LSPIGLPLR  338

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  339  PGEPLCVFYSRYGICKFGPSCKFDHP  364


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D +L++ ++ M+GE           P R 
Sbjct  43   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAIAAARMKGE----------YPERI  92

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFG TCKF HP
Sbjct  93   GQPECQYYLKTGTCKFGVTCKFHHP  117


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 26/96 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP              G+             R++  + G     Y
Sbjct  101  LKTGTCKFGVTCKFHHPRN----------KAGIAG-----------RVSLNVLG-----Y  134

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            P RP +VEC +Y++TG CKFG  C+F+HP   +L V
Sbjct  135  PIRPNEVECSYYLRTGHCKFGSTCKFNHPPPTNLMV  170


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 31/108 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    I PP       V++P                        
Sbjct  302  MKTGDCKFGAVCKFHHPRDRQIPPPDC-----VLSPIG---------------------L  335

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL-----DHSLSVTSSMEGE  436
            P RPG+  C FY + G CKFG  C+F HP+     ++  + +SSM  E
Sbjct  336  PLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNINNASSSMNQE  383



>ref|XP_006587810.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Glycine max]
Length=437

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 77/149 (52%), Gaps = 24/149 (16%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    + P             +  F+ +       M G     +
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLLP------------DSFFFENYQAIAAARMKG----EF  91

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      +++ G P R   
Sbjct  92   PERIGQPECQYYLKTGTCKFGATCRFHHPRDKA--------GIAGRVAMNILGYPLRPNE  143

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  144  PECAYYLRTGQCKFGNTCKFHHPQPNNMV  172


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  292  NIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCV--------LSPIGLPLR  343

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  344  PGEPLCVFYSRYGICKFGPSCKFDHP  369


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 64/110 (58%), Gaps = 6/110 (5%)
 Frame = -2

Query  639  PTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS  460
            P  +++Q  + R ++TM    +  YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L 
Sbjct  15   PPDAMWQ-INLRSSETM---ESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLL  70

Query  459  VTS-SMEGEQQNFKLSLAG-LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              S   E  Q      + G  P R G   C YY+KTG CKFGATC+F HP
Sbjct  71   PDSFFFENYQAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHP  120


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (46%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP    I  P       V++P                        
Sbjct  307  MKTGDCKFGAVCRFHHPRERMIPAPDC-----VLSPIG---------------------L  340

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  C FY + G CKFG  C+F HP+
Sbjct  341  PLRPGEPLCVFYSRYGICKFGPSCKFDHPM  370



>ref|XP_010525082.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 77/149 (52%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP    +   AA +                              Y
Sbjct  45   IRTGLCRFGSTCRFNHPRDRNLAIAAARMK---------------------------GEY  77

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP + +        G      L++ G P R   
Sbjct  78   PERIGQPECQYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRVSLNVLGYPIRPNE  129

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF+HPPP  L+
Sbjct  130  VECSYYLRTGHCKFGSTCKFNHPPPTNLM  158


 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  C+FHHP D  +     +        LS  GLP R
Sbjct  276  NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQIPPPDCV--------LSPIGLPLR  327

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  328  PGEPLCVFYSRYGICKFGPSCKFDHP  353


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D +L++ ++ M+GE           P R 
Sbjct  32   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAIAAARMKGE----------YPERI  81

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFG TCKF HP
Sbjct  82   GQPECQYYLKTGTCKFGVTCKFHHP  106


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 26/96 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP              G+             R++  + G     Y
Sbjct  90   LKTGTCKFGVTCKFHHPRN----------KAGIAG-----------RVSLNVLG-----Y  123

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            P RP +VEC +Y++TG CKFG  C+F+HP   +L V
Sbjct  124  PIRPNEVECSYYLRTGHCKFGSTCKFNHPPPTNLMV  159


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 31/108 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    I PP       V++P                        
Sbjct  291  MKTGDCKFGAVCKFHHPRDRQIPPPDC-----VLSPIG---------------------L  324

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL-----DHSLSVTSSMEGE  436
            P RPG+  C FY + G CKFG  C+F HP+     ++  + +SSM  E
Sbjct  325  PLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNINNASSSMNQE  372



>ref|XP_010248777.1| PREDICTED: zinc finger CCCH domain-containing protein 67 isoform 
X1 [Nelumbo nucifera]
Length=450

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 87/156 (56%), Gaps = 22/156 (14%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG+C+YG+ CR+NHP R+       +   G  +P  S+ Q    R  +          
Sbjct  100  LRTGTCRYGSNCRFNHPIRW------KNQASGSSDPPESV-QVSKEREKENEGS------  146

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P++ GQ EC +Y++TG CKFG+ CR+ HP + S+ V S +E       L+  GLP R G 
Sbjct  147  PEKTGQTECKYYLRTGGCKFGKACRYSHPREKSV-VGSPLE-------LNFLGLPIRPGE  198

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
              CPYYM+TG CK+   C+F HP P   +GG+  ++
Sbjct  199  KECPYYMRTGSCKYATNCRFHHPDP-TAVGGSDPLS  233


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 18/128 (14%)
 Frame = -2

Query  699  HPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKT  520
            +P    I+PP+A +   + NPT    +  +P   Q   G     +P+RPGQ EC ++MKT
Sbjct  300  YPPERCIHPPSAMI---LNNPT----KMVNPTTQQQTHGEE---FPERPGQPECSYFMKT  349

Query  519  GECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFG  340
            G+CK+   C++HHP + +   +           LS  GLP R     C +Y + GICKFG
Sbjct  350  GDCKYRSACKYHHPKNRAPKSSVCT--------LSPMGLPLRPDQSICTHYNRYGICKFG  401

Query  339  ATCKFDHP  316
              CKFDHP
Sbjct  402  PACKFDHP  409


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 15/101 (15%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL----------DHSLSVTSSMEGEQQNFKL  418
            YPQR  + +C +Y++TG C++G  CRF+HP+          D   SV  S E E++N   
Sbjct  87   YPQRSDEPDCSYYLRTGTCRYGSNCRFNHPIRWKNQASGSSDPPESVQVSKEREKEN---  143

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
               G P + G   C YY++TG CKFG  C++ HP    ++G
Sbjct  144  --EGSPEKTGQTECKYYLRTGGCKFGKACRYSHPREKSVVG  182



>ref|XP_006428579.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428580.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480413.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Citrus sinensis]
 gb|ESR41819.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41820.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=439

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                            Y
Sbjct  59   IRTGLCRFGATCRFNHP-------PNRKLAIATARIKGD--------------------Y  91

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  92   PERLGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNVLGYPLRPNE  143

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  144  IECAYYLRTGQCKFGSTCKFHHPQPNNMM  172


 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L V   +        LS  GLP R
Sbjct  296  SVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCV--------LSPIGLPLR  347

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  348  PGEPLCIFYSRYGICKFGPSCKFDHP  373


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 11/84 (13%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRREG  388
            P+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ ++G+           P R G
Sbjct  47   PERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKGD----------YPERLG  96

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY+KTG CKFGATCKF HP
Sbjct  97   QPECQYYLKTGTCKFGATCKFHHP  120


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 56/98 (57%), Gaps = 28/98 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I   A  +++ V+                         
Sbjct  104  LKTGTCKFGATCKFHHPRDKAGI---AGRVSLNVLG------------------------  136

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            YP RP ++EC +Y++TG+CKFG  C+FHHP  +++ V+
Sbjct  137  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVS  174


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            N  +    LP R G   C YY++TG+C+FGATC+F+HPP  +L   T+++
Sbjct  38   NEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARI  87



>ref|XP_006428577.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428578.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480418.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X6 [Citrus sinensis]
 ref|XP_006480419.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X7 [Citrus sinensis]
 ref|XP_006480420.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X8 [Citrus sinensis]
 gb|ESR41817.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41818.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=407

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                            Y
Sbjct  27   IRTGLCRFGATCRFNHP-------PNRKLAIATARIKGD--------------------Y  59

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  60   PERLGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNVLGYPLRPNE  111

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  112  IECAYYLRTGQCKFGSTCKFHHPQPNNMM  140


 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 56/86 (65%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L V   +        LS  GLP R
Sbjct  264  SVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCV--------LSPIGLPLR  315

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  316  PGEPLCIFYSRYGICKFGPSCKFDHP  341


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 11/84 (13%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRREG  388
            P+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ ++G+           P R G
Sbjct  15   PERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKGD----------YPERLG  64

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY+KTG CKFGATCKF HP
Sbjct  65   QPECQYYLKTGTCKFGATCKFHHP  88


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 56/98 (57%), Gaps = 28/98 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I   A  +++ V+                         
Sbjct  72   LKTGTCKFGATCKFHHPRDKAGI---AGRVSLNVLG------------------------  104

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            YP RP ++EC +Y++TG+CKFG  C+FHHP  +++ V+
Sbjct  105  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVS  142


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = -2

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            N  +    LP R G   C YY++TG+C+FGATC+F+HPP  +L   T+++
Sbjct  6    NEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARI  55



>ref|XP_009626542.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=427

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP    +   AA +N                             Y
Sbjct  50   IRTGLCRFGSTCRFNHPPNRKLALAAASMN---------------------------GEY  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ+EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  83   PERIGQLECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVTLNVLGYPLRPNE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYM+T  CKFG+TCKF HP P  ++
Sbjct  135  NECTYYMRTAQCKFGSTCKFHHPEPSNMM  163


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+R GQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  281  NVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCL--------LSPIGLPLR  332

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  333  PGEPMCIFYSRYGICKFGPSCKFDHP  358


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 65/113 (58%), Gaps = 13/113 (12%)
 Frame = -2

Query  597  QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFK  421
            ++M    +  YP R G+ +C +Y++TG C+FG  CRF+HP +  L++  +SM GE     
Sbjct  27   RSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLALAAASMNGE-----  81

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
                  P R G + C YY+KTG CKFGATCKF HP     I G  +VT   +G
Sbjct  82   -----YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAG--RVTLNVLG  127


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 52/98 (53%), Gaps = 26/98 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T  + G     Y
Sbjct  95   LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVTLNVLG-----Y  128

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS  451
            P RP + EC +YM+T +CKFG  C+FHHP   ++ V+S
Sbjct  129  PLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSS  166


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 31/105 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    + PP   L+ +G+                          
Sbjct  296  MKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL--------------------------  329

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL---DHSLSVTSSME  442
             P RPG+  C FY + G CKFG  C+F HP+    +++S +SS +
Sbjct  330  -PLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTD  373



>ref|XP_006376056.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
 gb|ERP53853.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
Length=255

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  63   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  95

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P +   
Sbjct  96   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GISGRVSLNILGYPLQPNE  147

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  148  IECAYYLRTGQCKFGSTCKFHHPQPTNMM  176


 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  99

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  100  GQPECQYYLKTGTCKFGATCKFHHP  124


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 39/138 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I+                       R++  + G     
Sbjct  108  LKTGTCKFGATCKFHHPRDKAGISG----------------------RVSLNILG-----  140

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-----------SVTSSMEGEQQNFK  421
            YP +P ++EC +Y++TG+CKFG  C+FHHP   ++           +V+S     QQ++ 
Sbjct  141  YPLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQQSYP  200

Query  420  LSLAGLPRREGAIHCPYY  367
              LA    R   I  P +
Sbjct  201  GGLATTWSRASFITSPRW  218



>dbj|BAJ86598.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92501.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 79/144 (55%), Gaps = 35/144 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG+C YG TCRYNHP DR      AA  + G+             R T+T+       
Sbjct  61   LRTGACGYGETCRYNHPRDR------AAAFDGGI-------------RTTRTV------E  95

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPGQ  C++YMK G CKFG  C+++HP +          G  Q   L+ +G P R G
Sbjct  96   YPERPGQPPCEYYMKNGTCKFGSNCKYNHPRE---------GGSVQPVVLNSSGYPLRLG  146

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY+KTG CKFG+TCKF HP
Sbjct  147  EKECSYYIKTGHCKFGSTCKFHHP  170


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC  YMKTG CKFG  C+++HP    LS   S      N+ LS  GLP R
Sbjct  295  VVFPERPGQPECHHYMKTGTCKFGSTCKYNHP--QYLSTPRS------NYMLSPLGLPIR  346

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             GA  C YY + G CKFG  CKFDHP
Sbjct  347  PGAQPCLYYSQHGFCKFGPGCKFDHP  372


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+  C +Y++TG C +GE CR++HP D + +    +   +          P R G 
Sbjct  49   PERPGEANCVYYLRTGACGYGETCRYNHPRDRAAAFDGGIRTTR------TVEYPERPGQ  102

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C YYMK G CKFG+ CK++HP
Sbjct  103  PPCEYYMKNGTCKFGSNCKYNHP  125


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 46/98 (47%), Gaps = 27/98 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +K G+CK+G+ C+YNHP              G V P                    ++ Y
Sbjct  109  MKNGTCKFGSNCKYNHPRE-----------GGSVQPVV----------------LNSSGY  141

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS  451
            P R G+ EC +Y+KTG CKFG  C+FHHP    L V S
Sbjct  142  PLRLGEKECSYYIKTGHCKFGSTCKFHHPEGPELGVVS  179



>ref|XP_008792910.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792911.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792912.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C+YG TCRYNHP    +   AA L  G                           Y
Sbjct  66   LRTGHCRYGVTCRYNHPPNRKLAIAAARLKGG---------------------------Y  98

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+  GQ EC +Y+KTG CKFG  C+FHHP D +        G     +L++ G P R   
Sbjct  99   PEIVGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GILGRAELNILGYPIRPNE  150

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  151  EECAYYLRTGQCKFGNTCKFHHPQPSNVM  179


 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+R  Q EC FYMKTG+CKFG  C+FHHP +  ++          N  LS +GLP R
Sbjct  303  NVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAP--------NCLLSPSGLPLR  354

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  355  PGEPLCVFYSRYGICKFGPNCKFDHP  380


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YPQR G+ +C +Y++TG C++G  CR++HP +  L++ ++ ++G          G P   
Sbjct  53   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKG----------GYPEIV  102

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
            G   C YY+KTG CKFGATCKF HP     I G +++ 
Sbjct  103  GQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELN  140


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (47%), Gaps = 26/96 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    I  P       +++P+                       
Sbjct  318  MKTGDCKFGAACKFHHPKERLITAPNC-----LLSPSG---------------------L  351

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            P RPG+  C FY + G CKFG  C+F HP+  S+ +
Sbjct  352  PLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGI  387



>gb|EEC70342.1| hypothetical protein OsI_01241 [Oryza sativa Indica Group]
Length=385

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 80/156 (51%), Gaps = 38/156 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG+C YG  CRYNHP DR      AA LN G              + T +        
Sbjct  32   LRTGACGYGENCRYNHPRDRAA----AAVLNGGG-------------KTTHS------AE  68

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPGQ  C++YMK G CKFG  C++ HP           EG  Q   L+ +G P R G
Sbjct  69   YPERPGQPVCEYYMKNGTCKFGSNCKYDHP----------REGSVQAVMLNSSGYPLRSG  118

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
               C YY+KTG CKFG+TCKF HP     IGG S+ 
Sbjct  119  EKDCTYYVKTGHCKFGSTCKFHHP----EIGGVSET  150


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y++TG C +GE CR++HP D + +   +  G+  +     A  P R G 
Sbjct  20   PERPGEADCVYYLRTGACGYGENCRYNHPRDRAAAAVLNGGGKTTHS----AEYPERPGQ  75

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGEL  301
              C YYMK G CKFG+ CK+DHP  G +
Sbjct  76   PVCEYYMKNGTCKFGSNCKYDHPREGSV  103


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 28/100 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +K G+CK+G+ C+Y+HP   ++   A  LN                          ++ Y
Sbjct  82   MKNGTCKFGSNCKYDHPREGSVQ--AVMLN--------------------------SSGY  113

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            P R G+ +C +Y+KTG CKFG  C+FHHP    +S T +M
Sbjct  114  PLRSGEKDCTYYVKTGHCKFGSTCKFHHPEIGGVSETPNM  153


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 73/165 (44%), Gaps = 22/165 (13%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTIN------PPAAHLNVGVVNPTASL--FQTFDPRLTQTM  589
            +KTG CK+G+TC+++HP+   ++      PP     +   +P   L  +Q   P +    
Sbjct  126  VKTGHCKFGSTCKFHHPEIGGVSETPNMYPPVQPQPISSSHPYQHLAGWQMGRPPVLPGS  185

Query  588  F--------GFATTIYPQR---PGQVECDFYMKTGECKFGERCRFHHPLDHSL---SVTS  451
            F           +T+ P +   P     +     G  +  +  RF       L   S+ +
Sbjct  186  FLSGSYPPMMLPSTVVPMQGWNPYISPVNQVASAGGHQTVQAGRFMAYRTKGLLLQSLMA  245

Query  450  SMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             +   + N  LS  GLP R G+  C YY + G CKFG TCKFDHP
Sbjct  246  YLNTPKSNCMLSPLGLPLRPGSQPCAYYTQHGFCKFGPTCKFDHP  290



>ref|XP_008355849.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=442

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 86/173 (50%), Gaps = 41/173 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  93   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGXVALNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGEL---IGGTS---QVTSTSVGEEEGYA  244
            + C YY++TG CKFG+TCKF HP P  +   +GG++    V S +   ++ YA
Sbjct  145  VECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGGSTVYPTVQSPTTPGQQSYA  197


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  297  NVFPERPGQPECQFYMKTGDCKFGGVCRFHHPRERLIPAPDCV--------LSPMGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKF+HP
Sbjct  349  PGEPLCIFYSRYGICKFGPSCKFNHP  374


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  47   YPERAGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  96

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  97   GQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (58%), Gaps = 7/71 (10%)
 Frame = -2

Query  492  RFHHPLDHSLSVTSSMEGE---QQNFK----LSLAGLPRREGAIHCPYYMKTGICKFGAT  334
            R   P+  + S+++S+  +   Q N +    +     P R G   C YY++TG+C+FGAT
Sbjct  11   RAAAPVTDARSLSASLTQDAMWQMNMRSSETMEAGPYPERAGEPDCSYYIRTGLCRFGAT  70

Query  333  CKFDHPPPGEL  301
            C+F+HPP  +L
Sbjct  71   CRFNHPPNRKL  81



>ref|XP_008792915.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Phoenix dactylifera]
Length=434

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C+YG TCRYNHP    +   AA L  G                           Y
Sbjct  27   LRTGHCRYGVTCRYNHPPNRKLAIAAARLKGG---------------------------Y  59

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+  GQ EC +Y+KTG CKFG  C+FHHP D +        G     +L++ G P R   
Sbjct  60   PEIVGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GILGRAELNILGYPIRPNE  111

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  112  EECAYYLRTGQCKFGNTCKFHHPQPSNVM  140


 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+R  Q EC FYMKTG+CKFG  C+FHHP +  ++          N  LS +GLP R
Sbjct  264  NVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLITAP--------NCLLSPSGLPLR  315

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  316  PGEPLCVFYSRYGICKFGPNCKFDHP  341


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 59/98 (60%), Gaps = 11/98 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YPQR G+ +C +Y++TG C++G  CR++HP +  L++ ++ ++G          G P   
Sbjct  14   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKG----------GYPEIV  63

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
            G   C YY+KTG CKFGATCKF HP     I G +++ 
Sbjct  64   GQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELN  101


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (47%), Gaps = 26/96 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    I  P       +++P+                       
Sbjct  279  MKTGDCKFGAACKFHHPKERLITAPNC-----LLSPSG---------------------L  312

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            P RPG+  C FY + G CKFG  C+F HP+  S+ +
Sbjct  313  PLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGI  348



>ref|XP_009338000.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  93   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GMAGRVALNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF HP P  ++
Sbjct  145  VECAYYLRTGQCKFGSTCKFHHPQPTNMM  173


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  297  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPMGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKF+HP
Sbjct  349  PGEPLCIFYSRYGICKFGPSCKFNHP  374


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 14/108 (13%)
 Frame = -2

Query  636  TASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            T       + R ++TM   A   YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++
Sbjct  27   TQDAMWQMNLRSSETMEAGA---YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAI  83

Query  456  TSS-MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             ++ M+GE           P R G   C YY+KTG CKFGATCKF HP
Sbjct  84   AAARMKGE----------FPERIGQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 7/71 (10%)
 Frame = -2

Query  492  RFHHPLDHSLSVTSSMEGE---QQNFK----LSLAGLPRREGAIHCPYYMKTGICKFGAT  334
            R   P+  + S++ S+  +   Q N +    +     P R G   C YY++TG+C+FGAT
Sbjct  11   RAAAPVTDARSLSPSLTQDAMWQMNLRSSETMEAGAYPERTGEPDCSYYIRTGLCRFGAT  70

Query  333  CKFDHPPPGEL  301
            C+F+HPP  +L
Sbjct  71   CRFNHPPNRKL  81



>ref|XP_011084651.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Sesamum indicum]
Length=425

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 76/149 (51%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  54   IRTGLCRFGSTCRFNHP-------PNRKLAIA----------------TARMKG----EY  86

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  87   PERIGQSECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNVLGYPLRPNE  138

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YYM+ G CKFG+TCKF HP P  ++
Sbjct  139  IECAYYMRNGQCKFGSTCKFHHPQPSNMM  167


 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  C+FHHP +  + V   +        LS  GLP R
Sbjct  280  NVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLIPVPDCI--------LSPIGLPLR  331

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  332  PGEPLCVFYSRYGICKFGPSCKFDHP  357


 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 11/93 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  41   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKGE----------YPERI  90

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            G   C YY+KTG CKFGATCKF HP     I G
Sbjct  91   GQSECQYYLKTGTCKFGATCKFHHPRDKAGIAG  123


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  99   LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVALNVLG-----Y  132

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP ++EC +YM+ G+CKFG  C+FHHP   ++ V+
Sbjct  133  PLRPNEIECAYYMRNGQCKFGSTCKFHHPQPSNMMVS  169


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P REG   C YY++TG+C+FG+TC+F+HPP  +L   T+++
Sbjct  42   PVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  82



>ref|XP_011085489.1| PREDICTED: zinc finger CCCH domain-containing protein 33 isoform 
X2 [Sesamum indicum]
Length=410

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 74/146 (51%), Gaps = 39/146 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TGSC YG +CR+NHP         A    GV N                     T+  
Sbjct  55   LRTGSCGYGTSCRFNHPSN-------AGQVYGVKN---------------------TSEL  86

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C +Y+KTG CK+G  C++HHP D            Q +  ++L GLP R+  
Sbjct  87   PERAGQPDCGYYLKTGTCKYGSTCKYHHPKD-----------RQADVLMNLVGLPMRQNT  135

Query  384  IHCPYYMKTGICKFGATCKFDHPPPG  307
              CPYYM+TG+CK+G  CKF HP P 
Sbjct  136  RSCPYYMRTGLCKYGYACKFHHPQPA  161


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 49/89 (55%), Gaps = 8/89 (9%)
 Frame = -2

Query  582  FATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGL  403
             + +  P+RP Q EC ++M  G CK+G  C++HHP +    V SS         L   GL
Sbjct  251  LSASYLPERPDQPECRYFMIHGSCKYGLDCKYHHPKEKISQVASS--------SLGPLGL  302

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P R G   C YY   G+CK+G TCKFDHP
Sbjct  303  PLRPGQPICSYYSLYGLCKYGPTCKFDHP  331


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 73/184 (40%), Gaps = 50/184 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVV------------NPTASLFQTFDPRL  601
            ++TG CKYG  C+++HP       PA   NV  V             P+       DP  
Sbjct  142  MRTGLCKYGYACKFHHPQ------PATTTNVLPVIGPVYGSGGSTGAPSPGAPSIGDPST  195

Query  600  T----QTMFGFATTIYPQR-------PGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            T     T F  +    PQ        P Q   + YM +                  LSVT
Sbjct  196  TPLSKATYFSNSLLQLPQNYIPLFLSPSQ-GWNTYMGSVA---------------PLSVT  239

Query  453  SSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            S +     N +LS + LP R     C Y+M  G CK+G  CK+ H  P E I   SQV S
Sbjct  240  SVLTTPASNGQLSASYLPERPDQPECRYFMIHGSCKYGLDCKYHH--PKEKI---SQVAS  294

Query  273  TSVG  262
            +S+G
Sbjct  295  SSLG  298



>ref|XP_002512627.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50079.1| nucleic acid binding protein, putative [Ricinus communis]
Length=448

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  67   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  99

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  100  PERIGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVSLNILGYPLRPNE  151

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  152  IECAYYLRTGQCKFGSTCKFHHPQPTNVM  180


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  303  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPIGLPLR  354

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + G+CKFG +CKFDHP
Sbjct  355  PGEPLCIFYSRYGVCKFGPSCKFDHP  380


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 11/93 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  54   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  103

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            G   C YY+KTG CKFGATCKF HP     I G
Sbjct  104  GQPECQYYLKTGTCKFGATCKFHHPKDKAGIAG  136



>ref|NP_974790.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAM61197.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92307.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=354

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 84/181 (46%), Gaps = 46/181 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTIN--------PPAAHLNVGVVNPTASLFQT---FDPRLT  598
            L+ G CK+G TC++NHP   + N        P  + L      P+ S  +T    +P   
Sbjct  122  LRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQPSYSWSRTSFVANPPRL  181

Query  597  QTMFGFAT---------------------------TIYPQRPGQVECDFYMKTGECKFGE  499
            Q   GFA+                            ++P+RPGQ EC FYMKTG+CKFG 
Sbjct  182  QDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGT  241

Query  498  RCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH  319
             C+FHHP D        +        LS  GLP R G   C +Y + GICKFG +CKFDH
Sbjct  242  VCKFHHPRDRQTPPPDCV--------LSSVGLPLRPGEPLCVFYSRYGICKFGPSCKFDH  293

Query  318  P  316
            P
Sbjct  294  P  294


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 74/144 (51%), Gaps = 37/144 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR             +V  TA +                   
Sbjct  31   IRTGLCRFGSTCRFNHPHDR------------KLVIATARI----------------KGE  62

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC+FY+KTG CKFG  C+FHHP + +        G   +  +++   P R  
Sbjct  63   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKA--------GIDGSVSVNVLSYPLRPN  114

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C Y+++ G CKFG TCKF+HP
Sbjct  115  EDDCSYFLRIGQCKFGGTCKFNHP  138


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 58/101 (57%), Gaps = 11/101 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP D  L + T+ ++GE           P R 
Sbjct  18   YPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIKGE----------YPERI  67

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTS  268
            G   C +Y+KTG CKFG TCKF HP     I G+  V   S
Sbjct  68   GQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLS  108


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 78/200 (39%), Gaps = 84/200 (42%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+G TC+++HP ++  I+     ++V V++                        
Sbjct  76   LKTGTCKFGVTCKFHHPRNKAGID---GSVSVNVLS------------------------  108

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ---------------  433
            YP RP + +C ++++ G+CKFG  C+F+HP   S ++  S+ G                 
Sbjct  109  YPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQPSYS  168

Query  432  -----------------------------------QNFKLSLAGLPR------REGAIHC  376
                                                +  L    LPR      R G   C
Sbjct  169  WSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPEC  228

Query  375  PYYMKTGICKFGATCKFDHP  316
             +YMKTG CKFG  CKF HP
Sbjct  229  QFYMKTGDCKFGTVCKFHHP  248


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 42/91 (46%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G  C+++HP DR T  P     +VG+                          
Sbjct  232  MKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGL--------------------------  265

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG+  C FY + G CKFG  C+F HP+
Sbjct  266  -PLRPGEPLCVFYSRYGICKFGPSCKFDHPM  295



>ref|NP_851041.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 sp|Q8L7N8.2|C3H57_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 57; 
Short=AtC3H57; AltName: Full=Zinc finger type domain-containing 
protein ZFN3 [Arabidopsis thaliana]
 gb|AED92308.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=375

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 84/181 (46%), Gaps = 46/181 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTIN--------PPAAHLNVGVVNPTASLFQT---FDPRLT  598
            L+ G CK+G TC++NHP   + N        P  + L      P+ S  +T    +P   
Sbjct  143  LRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQPSYSWSRTSFVANPPRL  202

Query  597  QTMFGFAT---------------------------TIYPQRPGQVECDFYMKTGECKFGE  499
            Q   GFA+                            ++P+RPGQ EC FYMKTG+CKFG 
Sbjct  203  QDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGT  262

Query  498  RCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH  319
             C+FHHP D        +        LS  GLP R G   C +Y + GICKFG +CKFDH
Sbjct  263  VCKFHHPRDRQTPPPDCV--------LSSVGLPLRPGEPLCVFYSRYGICKFGPSCKFDH  314

Query  318  P  316
            P
Sbjct  315  P  315


 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 74/144 (51%), Gaps = 37/144 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR             +V  TA +                   
Sbjct  52   IRTGLCRFGSTCRFNHPHDR------------KLVIATARI----------------KGE  83

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC+FY+KTG CKFG  C+FHHP + +        G   +  +++   P R  
Sbjct  84   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKA--------GIDGSVSVNVLSYPLRPN  135

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C Y+++ G CKFG TCKF+HP
Sbjct  136  EDDCSYFLRIGQCKFGGTCKFNHP  159


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 58/101 (57%), Gaps = 11/101 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP D  L + T+ ++GE           P R 
Sbjct  39   YPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIKGE----------YPERI  88

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTS  268
            G   C +Y+KTG CKFG TCKF HP     I G+  V   S
Sbjct  89   GQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLS  129


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 78/200 (39%), Gaps = 84/200 (42%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+G TC+++HP ++  I+     ++V V++                        
Sbjct  97   LKTGTCKFGVTCKFHHPRNKAGID---GSVSVNVLS------------------------  129

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ---------------  433
            YP RP + +C ++++ G+CKFG  C+F+HP   S ++  S+ G                 
Sbjct  130  YPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQPSYS  189

Query  432  -----------------------------------QNFKLSLAGLPR------REGAIHC  376
                                                +  L    LPR      R G   C
Sbjct  190  WSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPEC  249

Query  375  PYYMKTGICKFGATCKFDHP  316
             +YMKTG CKFG  CKF HP
Sbjct  250  QFYMKTGDCKFGTVCKFHHP  269


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 42/91 (46%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G  C+++HP DR T  P     +VG+                          
Sbjct  253  MKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGL--------------------------  286

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG+  C FY + G CKFG  C+F HP+
Sbjct  287  -PLRPGEPLCVFYSRYGICKFGPSCKFDHPM  316



>ref|XP_004495537.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Cicer arietinum]
Length=389

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 76/145 (52%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P A+L +                +T  M G     +
Sbjct  50   IRTGLCRFGATCRFNHP-------PNANLAI----------------VTARMIG----EF  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC FY+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  83   PERIGQPECQFYLKTGTCKFGATCKFHHPRDQA--------GISGRVALNILGYPLRPTE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
              C YY++TG CKFG TCKF HP P
Sbjct  135  AECSYYLRTGECKFGNTCKFHHPQP  159


 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 85/183 (46%), Gaps = 47/183 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP---DRYTINPPAAHLNVGVVNPTASLFQTFD------------  610
            L+TG CK+G TC+++HP   +  TI    + + +  V+      + F             
Sbjct  141  LRTGECKFGNTCKFHHPQPSNNMTIPLKGSPIYLSTVHSPTPQVRGFANWPRASYGPSSY  200

Query  609  -----PRLTQTMFGFAT--------------------TIYPQRPGQVECDFYMKTGECKF  505
                 P+   ++ G++                      I+P RPGQ EC FYMKTG+CKF
Sbjct  201  TPLVMPQGVISVPGWSAYSGQMGSVISTPPGSPLQRENIFPDRPGQPECQFYMKTGDCKF  260

Query  504  GERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKF  325
            G  CRFHHP    + V         +  LS  GLP R G   C +Y + GICKFG +CKF
Sbjct  261  GAVCRFHHPHQRLIPVPP-------DCLLSSLGLPLRHGEPLCVFYSRYGICKFGPSCKF  313

Query  324  DHP  316
            DHP
Sbjct  314  DHP  316


 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 63/109 (58%), Gaps = 14/109 (13%)
 Frame = -2

Query  639  PTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS  460
            P  SL+     +L  T     +  YP RPG+ +C +Y++TG C+FG  CRF+HP + +L+
Sbjct  16   PEGSLWMM---KLRSTQTFMDSQFYPHRPGEPDCSYYIRTGLCRFGATCRFNHPPNANLA  72

Query  459  -VTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             VT+ M GE           P R G   C +Y+KTG CKFGATCKF HP
Sbjct  73   IVTARMIGE----------FPERIGQPECQFYLKTGTCKFGATCKFHHP  111


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 4/48 (8%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGE  259
            P R G   C YY++TG+C+FGATC+F+HPP   L    + VT+  +GE
Sbjct  38   PHRPGEPDCSYYIRTGLCRFGATCRFNHPPNANL----AIVTARMIGE  81


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 25/90 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP +  I  P   L                          ++   
Sbjct  253  MKTGDCKFGAVCRFHHPHQRLIPVPPDCL-------------------------LSSLGL  287

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P R G+  C FY + G CKFG  C+F HP+
Sbjct  288  PLRHGEPLCVFYSRYGICKFGPSCKFDHPM  317



>ref|XP_008359920.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Malus domestica]
Length=443

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  93   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG TCKF HP P  ++
Sbjct  145  IECAYYLRTGQCKFGGTCKFHHPQPTNMM  173


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP++  +     +        LS  GLP R
Sbjct  297  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCV--------LSPIGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  349  PGEPMCIFYSRYGICKFGPSCKFDHP  374


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  96

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  97   GQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  105  LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVALNILG-----Y  138

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP ++EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  139  PLRPNEIECAYYLRTGQCKFGGTCKFHHPQPTNMMVS  175


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (46%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP    I  P       V++P                        
Sbjct  312  MKTGDCKFGAVCRFHHPMERLIPAPDC-----VLSPIG---------------------L  345

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  C FY + G CKFG  C+F HP+
Sbjct  346  PLRPGEPMCIFYSRYGICKFGPSCKFDHPM  375


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPP  313
            L   G P R G   C YY++TG+C+FGATC+F+HPP
Sbjct  42   LEAGGYPERTGEPDCSYYIRTGLCRFGATCRFNHPP  77



>gb|KDP23293.1| hypothetical protein JCGZ_23126 [Jatropha curcas]
Length=442

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  61   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  93

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  94   PERIGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVSLNIMGYPLRPNE  145

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  146  IECAYYLRTGQCKFGSTCKFHHPQPTNVM  174


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R G
Sbjct  299  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPIGLPLRPG  350

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +Y + G+CKFG +CK+DHP
Sbjct  351  EPLCIFYSRYGVCKFGPSCKYDHP  374


 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  48   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  97

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  98   GQPECQYYLKTGTCKFGATCKFHHP  122



>ref|XP_009420319.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 73/150 (49%), Gaps = 35/150 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C++G TCRYNHP    +   AA +  G                           +
Sbjct  72   LRTGLCRFGMTCRYNHPPNRQMAIAAARIKGG---------------------------F  104

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y++TG CKFG  C+FHHP D +        G     +L+  G P R   
Sbjct  105  PERVGQPECQYYLRTGTCKFGATCKFHHPRDKA--------GIAGRVQLNALGYPIRLNE  156

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIG  295
              C YYM+ G+CKFG+TCKF HP P   + 
Sbjct  157  TECAYYMRNGVCKFGSTCKFHHPQPSNTMA  186


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RP Q EC FYMKTG+CKFG  C+FHHP +  L           N  LS  GLP R
Sbjct  307  NVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLL--------PPPNCLLSPLGLPLR  358

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  359  PGEPLCIFYSRYGICKFGPHCKFDHP  384


 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (62%), Gaps = 11/99 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CR++HP +  +++ ++ ++G          G P R 
Sbjct  59   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKG----------GFPERV  108

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            G   C YY++TG CKFGATCKF HP     I G  Q+ +
Sbjct  109  GQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNA  147


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 45/97 (46%), Gaps = 28/97 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA C+++HP    + PP   L+ +G+                          
Sbjct  322  MKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGL--------------------------  355

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
             P RPG+  C FY + G CKFG  C+F HP+   + V
Sbjct  356  -PLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGV  391



>ref|XP_009420318.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 73/150 (49%), Gaps = 35/150 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C++G TCRYNHP    +   AA +  G                           +
Sbjct  74   LRTGLCRFGMTCRYNHPPNRQMAIAAARIKGG---------------------------F  106

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y++TG CKFG  C+FHHP D +        G     +L+  G P R   
Sbjct  107  PERVGQPECQYYLRTGTCKFGATCKFHHPRDKA--------GIAGRVQLNALGYPIRLNE  158

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIG  295
              C YYM+ G+CKFG+TCKF HP P   + 
Sbjct  159  TECAYYMRNGVCKFGSTCKFHHPQPSNTMA  188


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RP Q EC FYMKTG+CKFG  C+FHHP +  L           N  LS  GLP R
Sbjct  309  NVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLL--------PPPNCLLSPLGLPLR  360

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  361  PGEPLCIFYSRYGICKFGPHCKFDHP  386


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (62%), Gaps = 11/99 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CR++HP +  +++ ++ ++G          G P R 
Sbjct  61   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKG----------GFPERV  110

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
            G   C YY++TG CKFGATCKF HP     I G  Q+ +
Sbjct  111  GQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNA  149


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 45/97 (46%), Gaps = 28/97 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA C+++HP    + PP   L+ +G+                          
Sbjct  324  MKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGL--------------------------  357

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
             P RPG+  C FY + G CKFG  C+F HP+   + V
Sbjct  358  -PLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGV  393



>ref|NP_001042632.2| Os01g0257400 [Oryza sativa Japonica Group]
 sp|Q5NAV3.1|C3H5_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 5; Short=OsC3H5; 
AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 3 [Oryza sativa Japonica Group]
 dbj|BAD81393.1| putative floral homeotic protein HUA1 [Oryza sativa Japonica 
Group]
 dbj|BAG93710.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04546.2| Os01g0257400 [Oryza sativa Japonica Group]
Length=466

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 80/156 (51%), Gaps = 38/156 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG+C YG  CRYNHP DR      AA LN G              + T +        
Sbjct  61   LRTGACGYGENCRYNHPRDRAA----AAVLNGGG-------------KTTHS------AE  97

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPGQ  C++YMK G CKFG  C++ HP           EG  Q   L+ +G P R G
Sbjct  98   YPERPGQPVCEYYMKNGTCKFGSNCKYDHP----------REGSVQAVMLNSSGYPLRSG  147

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
               C YY+KTG CKFG+TCKF HP     IGG S+ 
Sbjct  148  EKDCTYYVKTGHCKFGSTCKFHHP----EIGGVSET  179


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P RPGQ EC +Y+KTG CKFG  C++HHP          +   + N  LS  GLP R G
Sbjct  296  FPARPGQPECQYYLKTGSCKFGSACKYHHP--------QYLNTPKSNCMLSPLGLPLRPG  347

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
            +  C YY + G CKFG TCKFDHP
Sbjct  348  SQPCAYYTQHGFCKFGPTCKFDHP  371


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +Y++TG C +GE CR++HP D + +   +  G+  +     A  P R G 
Sbjct  49   PERPGEADCVYYLRTGACGYGENCRYNHPRDRAAAAVLNGGGKTTHS----AEYPERPGQ  104

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGEL  301
              C YYMK G CKFG+ CK+DHP  G +
Sbjct  105  PVCEYYMKNGTCKFGSNCKYDHPREGSV  132


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 28/100 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +K G+CK+G+ C+Y+HP   ++   A  LN                          ++ Y
Sbjct  111  MKNGTCKFGSNCKYDHPREGSVQ--AVMLN--------------------------SSGY  142

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            P R G+ +C +Y+KTG CKFG  C+FHHP    +S T +M
Sbjct  143  PLRSGEKDCTYYVKTGHCKFGSTCKFHHPEIGGVSETPNM  182



>emb|CDP04213.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 76/149 (51%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C+YGATCR+NHP       P   L +                 T  M G     Y
Sbjct  56   IRTGLCRYGATCRFNHP-------PNRKLAIA----------------TARMRG----EY  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP + +        G      L+  G P R   
Sbjct  89   PERMGQPECQYYLKTGTCKFGATCKFHHPREKA--------GIAGRVTLNALGYPLRPNE  140

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  141  IECAYYLRTGHCKFGSTCKFHHPQPANMM  169


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            T++P+RPGQ EC FYMKTG+CKFG  C+FHHP +  L     +        LS  GLP R
Sbjct  259  TVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERILPAPDCV--------LSPIGLPLR  310

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  311  PGEPLCIFYSRYGICKFGPSCKFDHP  336


 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 61/103 (59%), Gaps = 13/103 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C++G  CRF+HP +  L++ T+ M GE           P R 
Sbjct  43   YPVREGEPDCSYYIRTGLCRYGATCRFNHPPNRKLAIATARMRGE----------YPERM  92

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
            G   C YY+KTG CKFGATCKF H  P E  G   +VT  ++G
Sbjct  93   GQPECQYYLKTGTCKFGATCKFHH--PREKAGIAGRVTLNALG  133


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T    G     Y
Sbjct  101  LKTGTCKFGATCKFHHPRE----------KAGIAG-----------RVTLNALG-----Y  134

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP ++EC +Y++TG CKFG  C+FHHP   ++ V+
Sbjct  135  PLRPNEIECAYYLRTGHCKFGSTCKFHHPQPANMMVS  171


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (46%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    +  P       V++P                        
Sbjct  274  MKTGDCKFGAVCKFHHPRERILPAPDC-----VLSPIG---------------------L  307

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  C FY + G CKFG  C+F HP+
Sbjct  308  PLRPGEPLCIFYSRYGICKFGPSCKFDHPM  337



>ref|XP_011077188.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Sesamum indicum]
Length=327

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP           LN  +   TA +                 + Y
Sbjct  50   IRTGLCRFGATCRFNHP-----------LNRTLAIATARM----------------KSEY  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D  L +   +        L++ G P R   
Sbjct  83   PERIGQPECQYYLKTGTCKFGATCKFHHPRD-ELGIAGRV-------ALNVLGYPLRPNE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
            I+C YY++ G+CKFG TCKF HP P
Sbjct  135  INCAYYIRNGLCKFGRTCKFHHPQP  159


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HPL+ +L++ T+ M+ E           P R 
Sbjct  37   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARMKSE----------YPERI  86

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  87   GQPECQYYLKTGTCKFGATCKFHHP  111


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 8/63 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ +C FYMKTG+CKFG  C+FHHP +  + +   +        LS  GLP R
Sbjct  272  NVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCV--------LSPIGLPLR  323

Query  393  EGA  385
              A
Sbjct  324  PVA  326



>ref|XP_004302155.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  60   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TARMKG----EF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  93   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKF +TCK+ HPPP  ++
Sbjct  145  IECAYYLRTGQCKFASTCKYHHPPPTNMM  173


 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 69/131 (53%), Gaps = 28/131 (21%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  297  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPIGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP----------------PPGELIGGTSQVTSTSVG  262
             G   C +Y + GICKFG +CKFDHP                P   L+G TS  TS ++ 
Sbjct  349  PGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLAASSSAESPVRRLLGSTSGTTSLNLS  408

Query  261  EEEGYAKLVEA  229
             E     LVEA
Sbjct  409  SE----GLVEA  415


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 68/111 (61%), Gaps = 15/111 (14%)
 Frame = -2

Query  645  VNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS  466
            ++P  +++Q  + R ++TM       YP+R G+ +C +Y++TG C+FG  CRF+HP +  
Sbjct  25   LSPQDAMWQ-MNLRSSETM---EPGPYPERAGEPDCSYYIRTGLCRFGATCRFNHPPNRK  80

Query  465  LSV-TSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            L++ T+ M+GE           P R G   C YY+KTG CKFGATCKF HP
Sbjct  81   LAIATARMKGE----------FPERVGQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 26/99 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  105  LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVALNILG-----Y  138

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS  448
            P RP ++EC +Y++TG+CKF   C++HHP   ++ V+ S
Sbjct  139  PLRPNEIECAYYLRTGQCKFASTCKYHHPPPTNMMVSLS  177


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P R G   C YY++TG+C+FGATC+F+HPP  +L   T+++
Sbjct  48   PERAGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  88



>ref|XP_008799408.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Phoenix dactylifera]
Length=437

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 76/145 (52%), Gaps = 39/145 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C YG+ CRYNHP+         ++  G +                      T   
Sbjct  59   LRTGYCGYGSNCRYNHPN---------YIGQGTL---------------------YTGEL  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C F++KTG CKFG  C++HHP D+          E +  +L++ GLP R+  
Sbjct  89   PERDGQPDCQFFLKTGTCKFGVTCKYHHPRDNH---------EVRQVQLNILGLPMRKDE  139

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
              CPYYMKTG+CKFG  CKF+HP P
Sbjct  140  KSCPYYMKTGLCKFGIACKFNHPQP  164


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 50/88 (57%), Gaps = 9/88 (10%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            A   +P+RP Q +C +YMKTG CKFG  C+FHHP + +     +         +   GLP
Sbjct  271  APVDFPERPDQPQCQYYMKTGSCKFGTSCKFHHPKERNQEAICT---------IGPLGLP  321

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R G   C +Y   G CK+G+TCKFDHP
Sbjct  322  LRPGQPLCTFYSMYGSCKYGSTCKFDHP  349



>ref|XP_010248778.1| PREDICTED: zinc finger CCCH domain-containing protein 67 isoform 
X2 [Nelumbo nucifera]
Length=447

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 85/156 (54%), Gaps = 25/156 (16%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG+C+YG+ CR+NHP R+       +   G  +P  S+ +                  
Sbjct  100  LRTGTCRYGSNCRFNHPIRW------KNQASGSSDPPESVQEREK----------ENEGS  143

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P++ GQ EC +Y++TG CKFG+ CR+ HP + S+ V S +E       L+  GLP R G 
Sbjct  144  PEKTGQTECKYYLRTGGCKFGKACRYSHPREKSV-VGSPLE-------LNFLGLPIRPGE  195

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
              CPYYM+TG CK+   C+F HP P   +GG+  ++
Sbjct  196  KECPYYMRTGSCKYATNCRFHHPDP-TAVGGSDPLS  230


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 18/128 (14%)
 Frame = -2

Query  699  HPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKT  520
            +P    I+PP+A +   + NPT    +  +P   Q   G     +P+RPGQ EC ++MKT
Sbjct  297  YPPERCIHPPSAMI---LNNPT----KMVNPTTQQQTHGEE---FPERPGQPECSYFMKT  346

Query  519  GECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFG  340
            G+CK+   C++HHP + +   +           LS  GLP R     C +Y + GICKFG
Sbjct  347  GDCKYRSACKYHHPKNRAPKSSVCT--------LSPMGLPLRPDQSICTHYNRYGICKFG  398

Query  339  ATCKFDHP  316
              CKFDHP
Sbjct  399  PACKFDHP  406


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ--QNFKLSLAGLPRR  394
            YPQR  + +C +Y++TG C++G  CRF+HP+      + S +  +  Q  +    G P +
Sbjct  87   YPQRSDEPDCSYYLRTGTCRYGSNCRFNHPIRWKNQASGSSDPPESVQEREKENEGSPEK  146

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
             G   C YY++TG CKFG  C++ HP    ++G
Sbjct  147  TGQTECKYYLRTGGCKFGKACRYSHPREKSVVG  179



>ref|XP_009611379.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=437

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 76/149 (51%), Gaps = 31/149 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP                 N    L Q      T  M G     Y
Sbjct  56   IRTGLCRFGSTCRFNHPP----------------NRKLYLMQAI---ATARMKG----EY  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  93   PERMGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVTLNVLGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYM+TG CKFG+TCKF HP P  ++
Sbjct  145  AECAYYMRTGQCKFGSTCKFHHPQPSNMM  173


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 69/135 (51%), Gaps = 27/135 (20%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+R GQ EC FYMKTG+CKFG  CRFHHP +  +     M        LS  GLP R
Sbjct  291  NVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCM--------LSPIGLPLR  342

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP----------------PPGELIGGTSQVTSTSVG  262
             G   C +Y + GICKFG +CKFDHP                P  + + G+S  TS    
Sbjct  343  PGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTL  402

Query  261  EEEGYAKLVEAIQKQ  217
              EG   LVEA+  +
Sbjct  403  TSEG---LVEAVSTK  414


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 55/97 (57%), Gaps = 15/97 (15%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-----TSSMEGEQQNFKLSLAGL  403
            YP R G+ +C +Y++TG C+FG  CRF+HP +  L +     T+ M+GE           
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLYLMQAIATARMKGE----------Y  92

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            P R G   C YY+KTG CKFGATCKF HP     I G
Sbjct  93   PERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAG  129


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T  + G     Y
Sbjct  105  LKTGTCKFGATCKFHHPKD----------KAGIAG-----------RVTLNVLG-----Y  138

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +YM+TG+CKFG  C+FHHP   ++ V+
Sbjct  139  PLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  175


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGE  259
            P REG   C YY++TG+C+FG+TC+F+HPP  +L    +  T+   GE
Sbjct  44   PVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLYLMQAIATARMKGE  91



>ref|XP_011077184.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077185.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077186.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
Length=417

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 75/145 (52%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP           LN  +   TA +                 + Y
Sbjct  50   IRTGLCRFGATCRFNHP-----------LNRTLAIATARM----------------KSEY  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D          G      L++ G P R   
Sbjct  83   PERIGQPECQYYLKTGTCKFGATCKFHHPRDEL--------GIAGRVALNVLGYPLRPNE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
            I+C YY++ G+CKFG TCKF HP P
Sbjct  135  INCAYYIRNGLCKFGRTCKFHHPQP  159


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ +C FYMKTG+CKFG  C+FHHP +  + +   +        LS  GLP R
Sbjct  272  NVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCV--------LSPIGLPLR  323

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  324  PGEPLCVFYSRYGICKFGPSCKFDHP  349


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HPL+ +L++ T+ M+ E           P R 
Sbjct  37   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARMKSE----------YPERI  86

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  87   GQPECQYYLKTGTCKFGATCKFHHP  111


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 29/106 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    I  P       V++P                        
Sbjct  287  MKTGDCKFGAVCKFHHPRERLIPLPDC-----VLSPIG---------------------L  320

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD---HSLSVTSSMEGE  436
            P RPG+  C FY + G CKFG  C+F HP+    H+ + ++S +G 
Sbjct  321  PLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASASTDGN  366



>gb|EPS74454.1| hypothetical protein M569_00301, partial [Genlisea aurea]
Length=205

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 74/143 (52%), Gaps = 35/143 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     Y
Sbjct  31   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TAQMKG----EY  63

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  64   PERIGQPECQYYIKTGTCKFGATCKFHHPPDKA--------GIAGRVPLNVHGYPLRPNE  115

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
            I C YYM+ G CKFG+TCKF+HP
Sbjct  116  IECAYYMRHGFCKFGSTCKFNHP  138


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 11/93 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  18   YPVREGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAQMKGE----------YPERI  67

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            G   C YY+KTG CKFGATCKF HPP    I G
Sbjct  68   GQPECQYYIKTGTCKFGATCKFHHPPDKAGIAG  100


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P REG   C YY++TG+C+FGATC+F+HPP  +L   T+Q+
Sbjct  19   PVREGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAQM  59



>ref|XP_009769498.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769499.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769500.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769502.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
Length=427

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TC++NHP    +   AA +N                             Y
Sbjct  50   IRTGLCRFGSTCQFNHPPNRKLALAAASMN---------------------------GEY  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ+EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  83   PERIGQLECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVTLNVLGYPLRPNE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYM+T  CKFG+TCKF HP P  ++
Sbjct  135  NECTYYMRTAQCKFGSTCKFHHPEPSNMM  163


 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+R GQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  281  NVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLPPPDCL--------LSPIGLPLR  332

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  333  AGEPMCIFYSRYGICKFGPSCKFDHP  358


 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 11/95 (12%)
 Frame = -2

Query  597  QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFK  421
            ++M    +  YP R G+ +C +Y++TG C+FG  C+F+HP +  L++  +SM GE     
Sbjct  27   RSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQFNHPPNRKLALAAASMNGE-----  81

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                  P R G + C YY+KTG CKFGATCKF HP
Sbjct  82   -----YPERIGQLECQYYLKTGTCKFGATCKFHHP  111


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 52/98 (53%), Gaps = 26/98 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T  + G     Y
Sbjct  95   LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVTLNVLG-----Y  128

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS  451
            P RP + EC +YM+T +CKFG  C+FHHP   ++ V+S
Sbjct  129  PLRPNENECTYYMRTAQCKFGSTCKFHHPEPSNMMVSS  166


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 31/105 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    + PP   L+ +G+                          
Sbjct  296  MKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGL--------------------------  329

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL---DHSLSVTSSME  442
             P R G+  C FY + G CKFG  C+F HP+    +++S +SS +
Sbjct  330  -PLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTD  373


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGEL  301
            P REG   C YY++TG+C+FG+TC+F+HPP  +L
Sbjct  38   PVREGESDCSYYIRTGLCRFGSTCQFNHPPNRKL  71



>ref|XP_011077187.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Sesamum indicum]
Length=407

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 75/145 (52%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP           LN  +   TA +                 + Y
Sbjct  40   IRTGLCRFGATCRFNHP-----------LNRTLAIATARM----------------KSEY  72

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D          G      L++ G P R   
Sbjct  73   PERIGQPECQYYLKTGTCKFGATCKFHHPRDEL--------GIAGRVALNVLGYPLRPNE  124

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
            I+C YY++ G+CKFG TCKF HP P
Sbjct  125  INCAYYIRNGLCKFGRTCKFHHPQP  149


 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ +C FYMKTG+CKFG  C+FHHP +  + +   +        LS  GLP R
Sbjct  262  NVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDCV--------LSPIGLPLR  313

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  314  PGEPLCVFYSRYGICKFGPSCKFDHP  339


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HPL+ +L++ T+ M+ E           P R 
Sbjct  27   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARMKSE----------YPERI  76

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  77   GQPECQYYLKTGTCKFGATCKFHHP  101


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 29/106 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    I  P       V++P                        
Sbjct  277  MKTGDCKFGAVCKFHHPRERLIPLPDC-----VLSPIG---------------------L  310

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD---HSLSVTSSMEGE  436
            P RPG+  C FY + G CKFG  C+F HP+    H+ + ++S +G 
Sbjct  311  PLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASASTDGN  356



>gb|EEE65800.1| hypothetical protein OsJ_21508 [Oryza sativa Japonica Group]
Length=830

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 58/159 (36%), Positives = 74/159 (47%), Gaps = 39/159 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +K GSCK+G +C YNHPD      P          P                       +
Sbjct  197  VKFGSCKFGISCVYNHPD------PRPQHGADDKKPAEQ--------------------F  230

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP-----------LDHSLSVTSSMEGEQ--QNF  424
            P+RPG+ +C +Y+K G CKFG  CRF+HP              +      +EG+   +  
Sbjct  231  PRRPGEPDCSYYVKFGSCKFGMNCRFNHPPRMPVPPQQEYFSGNACHCHHIEGKSKVEQV  290

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPG  307
            KL++ GLP R G   C YYM  GICKFG  CKFDHP PG
Sbjct  291  KLNVLGLPLRPGTGLCSYYMNRGICKFGTNCKFDHPDPG  329


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPG+ +C +Y+K G CKFG  C ++HP           +  +Q         PRR G
Sbjct  184  HPRRPGEPDCSYYVKFGSCKFGISCVYNHPDPRPQHGADDKKPAEQ--------FPRRPG  235

Query  387  AIHCPYYMKTGICKFGATCKFDHPP  313
               C YY+K G CKFG  C+F+HPP
Sbjct  236  EPDCSYYVKFGSCKFGMNCRFNHPP  260


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 8/102 (8%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +K GSCK+G  CR+NHP R  + P   + +    +      ++   ++   + G      
Sbjct  243  VKFGSCKFGMNCRFNHPPRMPVPPQQEYFSGNACHCHHIEGKSKVEQVKLNVLGL-----  297

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP---LDHSLSVTSS  448
            P RPG   C +YM  G CKFG  C+F HP    DH   V SS
Sbjct  298  PLRPGTGLCSYYMNRGICKFGTNCKFDHPDPGSDHEKWVVSS  339



>ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
 gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
Length=467

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TCR+NHP    +   AA +  G                           Y
Sbjct  73   IRTGLCRFGMTCRFNHPPNRKLAVAAARIKGG---------------------------Y  105

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  106  PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVLLNILGYPLRPNE  157

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P  ++
Sbjct  158  KECAYYLRTGQCKFGSTCKFHHPQPNAMV  186


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RP Q EC FYMKTG+CKFG  C+FHHP +  L V + M        LS  GLP R
Sbjct  309  NVFPERPDQPECQFYMKTGDCKFGAMCKFHHPRERLLPVPNCM--------LSPMGLPLR  360

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG TCKFDHP
Sbjct  361  PGEPLCIFYSRYGICKFGPTCKFDHP  386


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 14/98 (14%)
 Frame = -2

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQ  430
            R ++TM    +  YP+RPG+++C +Y++TG C+FG  CRF+HP +  L+V ++ ++G   
Sbjct  50   RSSETM---ESGPYPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNRKLAVAAARIKG---  103

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                   G P R G   C YY+KTG CKFGATCKF HP
Sbjct  104  -------GYPERVGQPECQYYLKTGTCKFGATCKFHHP  134


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (48%), Gaps = 31/103 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA C+++HP    +  P   L+ +G+                          
Sbjct  324  MKTGDCKFGAMCKFHHPRERLLPVPNCMLSPMGL--------------------------  357

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLD---HSLSVTSS  448
             P RPG+  C FY + G CKFG  C+F HP+    ++LS +S+
Sbjct  358  -PLRPGEPLCIFYSRYGICKFGPTCKFDHPMGPFAYNLSTSSA  399


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P R G I C YY++TG+C+FG TC+F+HPP  +L    +++
Sbjct  61   PERPGEIDCAYYIRTGLCRFGMTCRFNHPPNRKLAVAAARI  101



>ref|XP_010507840.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
 ref|XP_010507841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
Length=475

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 74/146 (51%), Gaps = 37/146 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C YG  CRYNHP DR                  AS+  T            AT  
Sbjct  58   MRTGVCGYGNRCRYNHPRDR------------------ASVEATVR----------ATGQ  89

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R G++ C FY+KTG CKFG  C+FHHP +          G   +  L++ G P REG
Sbjct  90   YPERIGELPCQFYLKTGTCKFGASCKFHHPKNAG--------GSMSHVPLNIYGYPVREG  141

Query  387  AIHCPYYMKTGICKFGATCKFDHPPP  310
               C YY+KTG CKFG TCKF HP P
Sbjct  142  ENECSYYLKTGQCKFGITCKFHHPQP  167


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPG+ EC +Y+KTG+CKFG  C+FHHP D            + N  LS  GLP R G
Sbjct  293  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVP--------PRANCILSPIGLPLRPG  344

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +Y++ G CKFG+TCKFDHP
Sbjct  345  VQRCTFYVQNGFCKFGSTCKFDHP  368


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 12/102 (12%)
 Frame = -2

Query  612  DPRLTQTMFGF---ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME  442
            D  L ++M+     ++  YP+R G  +C +YM+TG C +G RCR++HP D + SV +++ 
Sbjct  27   DSGLEESMWRLGLGSSETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDRA-SVEATVR  85

Query  441  GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               Q         P R G + C +Y+KTG CKFGA+CKF HP
Sbjct  86   ATGQ--------YPERIGELPCQFYLKTGTCKFGASCKFHHP  119


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 26/96 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GA+C+++HP     +     LN+                     +G     Y
Sbjct  103  LKTGTCKFGASCKFHHPKNAGGSMSHVPLNI---------------------YG-----Y  136

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            P R G+ EC +Y+KTG+CKFG  C+FHHP     SV
Sbjct  137  PVREGENECSYYLKTGQCKFGITCKFHHPQPAGTSV  172


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG CK+G +C+++HP DR    PP A+    +++P                       
Sbjct  306  LKTGDCKFGTSCKFHHPRDRV---PPRANC---ILSPIG---------------------  338

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG   C FY++ G CKFG  C+F HP+
Sbjct  339  LPLRPGVQRCTFYVQNGFCKFGSTCKFDHPV  369



>ref|XP_006422326.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
 ref|XP_006422332.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
 gb|ESR35566.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
 gb|ESR35572.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
Length=171

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 89/178 (50%), Gaps = 36/178 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G TC+++HP               +  P   +     P   +     ++   
Sbjct  1    MQTRTCKFGDTCKFDHP---------------IWVPEGGI-----PDWKEVPVIASSESL  40

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D  +  + S  G+       ++ LP R   
Sbjct  41   PERPGEPDCPYFLKTQRCKFGSKCKFNHPKDKLIGSSDSGNGD-------VSALPERPSE  93

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
              C +Y+K G CKFGATCKFDHP   +L          SVG+E G  +  E++ K  +
Sbjct  94   PPCAFYLKNGTCKFGATCKFDHPKDFQL---------PSVGQENGIGEQNESVIKTDE  142



>gb|KCW84570.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=345

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +    A +                              Y
Sbjct  55   IRTGLCRFGATCRFNHPSDRKLAIANARMK---------------------------GEY  87

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  88   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGKVALNILGYPFRPNE  139

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF HP P  ++
Sbjct  140  MECAYYLRTGQCKFGSTCKFHHPQPTNMM  168


 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L++ ++ M+GE           P R 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDRKLAIANARMKGE----------YPERV  91

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  92   GQPECQYYLKTGTCKFGATCKFHHP  116


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 54/98 (55%), Gaps = 28/98 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I   A  + + ++                         
Sbjct  100  LKTGTCKFGATCKFHHPRDKAGI---AGKVALNILG------------------------  132

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            YP RP ++EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  170


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 36/60 (60%), Gaps = 8/60 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  291  NIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCL--------LSPIGLPLR  342



>ref|XP_011015459.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=412

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  30   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P +   
Sbjct  63   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GISGRVSLNILGYPLQPNE  114

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  115  IECAYYLRTGQCKFGSTCKFHHPQPTNMM  143


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  267  SVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPIGLPLR  318

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  319  PGEPLCIFYSRYGICKFGPSCKFDHP  344


 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  17   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  66

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  67   GQPECQYYLKTGTCKFGATCKFHHP  91


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 65/137 (47%), Gaps = 37/137 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++  + G     Y
Sbjct  75   LKTGTCKFGATCKFHHPRD----------KAGISG-----------RVSLNILG-----Y  108

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-----------SVTSSMEGEQQNFKL  418
            P +P ++EC +Y++TG+CKFG  C+FHHP   ++           +V+S     QQ++  
Sbjct  109  PLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQQSYPG  168

Query  417  SLAGLPRREGAIHCPYY  367
             LA    R   I  P +
Sbjct  169  GLATTWSRASFITSPRW  185



>ref|XP_009611380.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=433

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 76/149 (51%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  56   IRTGLCRFGSTCRFNHP-------PNRKLAIA----------------TARMKG----EY  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  89   PERMGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVTLNVLGYPLRPNE  140

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYM+TG CKFG+TCKF HP P  ++
Sbjct  141  AECAYYMRTGQCKFGSTCKFHHPQPSNMM  169


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 69/135 (51%), Gaps = 27/135 (20%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+R GQ EC FYMKTG+CKFG  CRFHHP +  +     M        LS  GLP R
Sbjct  287  NVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCM--------LSPIGLPLR  338

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP----------------PPGELIGGTSQVTSTSVG  262
             G   C +Y + GICKFG +CKFDHP                P  + + G+S  TS    
Sbjct  339  PGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQRLLGSSSGTSALTL  398

Query  261  EEEGYAKLVEAIQKQ  217
              EG   LVEA+  +
Sbjct  399  TSEG---LVEAVSTK  410


 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 11/93 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKGE----------YPERM  92

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            G   C YY+KTG CKFGATCKF HP     I G
Sbjct  93   GQPECQYYLKTGTCKFGATCKFHHPKDKAGIAG  125


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T  + G     Y
Sbjct  101  LKTGTCKFGATCKFHHPKD----------KAGIAG-----------RVTLNVLG-----Y  134

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +YM+TG+CKFG  C+FHHP   ++ V+
Sbjct  135  PLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  171


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P REG   C YY++TG+C+FG+TC+F+HPP  +L   T+++
Sbjct  44   PVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84



>ref|XP_009793876.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Nicotiana sylvestris]
Length=433

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 76/149 (51%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  56   IRTGLCRFGSTCRFNHP-------PNRKLAIA----------------TARMKG----EY  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  89   PERMGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVTLNVLGYPLRPNE  140

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYM+TG CKFG+TCKF HP P  ++
Sbjct  141  AECAYYMRTGQCKFGSTCKFHHPQPSNMM  169


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 70/134 (52%), Gaps = 27/134 (20%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     M        LS  GLP R 
Sbjct  288  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCM--------LSPIGLPLRP  339

Query  390  GAIHCPYYMKTGICKFGATCKFDHP----------------PPGELIGGTSQVTSTSVGE  259
            G   C +Y + GICKFG +CKFDHP                P  + + G+S  TS     
Sbjct  340  GEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSPTDAPAVQRLLGSSSGTSALTLT  399

Query  258  EEGYAKLVEAIQKQ  217
             EG   LVEA+  +
Sbjct  400  SEG---LVEAVSTK  410


 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 11/93 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKGE----------YPERM  92

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            G   C YY+KTG CKFGATCKF HP     I G
Sbjct  93   GQPECQYYLKTGTCKFGATCKFHHPKDKAGIAG  125


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T  + G     Y
Sbjct  101  LKTGTCKFGATCKFHHPKD----------KAGIAG-----------RVTLNVLG-----Y  134

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +YM+TG+CKFG  C+FHHP   ++ V+
Sbjct  135  PLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  171


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P REG   C YY++TG+C+FG+TC+F+HPP  +L   T+++
Sbjct  44   PVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84



>ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
 gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
Length=411

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  30   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  63   PERAGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNILGYPLRPNE  114

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P  ++
Sbjct  115  PECAYYLRTGQCKFGSTCKFHHPQPTNMM  143


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  266  NVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVLPAPDCV--------LSPIGLPLR  317

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKF+HP
Sbjct  318  PGEPLCIFYSRYGICKFGPSCKFNHP  343


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  17   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERA  66

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  67   GQPECQYYLKTGTCKFGATCKFHHP  91


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++  + G     Y
Sbjct  75   LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVSLNILG-----Y  108

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  109  PLRPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  145



>ref|XP_007139733.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11727.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=408

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  30   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      L++ G P R   
Sbjct  63   PERIGQPECQYYLKTGTCKFGATCRFHHPRDKA--------GIAGRVALNILGYPLRPNE  114

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  115  PECAYYLRTGQCKFGNTCKFHHPQPSNMV  143


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q +C FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  263  NIFPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMIPAPDCV--------LSPIGLPLR  314

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  315  PGEPLCVFYSRYGICKFGPSCKFDHP  340


 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 61/98 (62%), Gaps = 14/98 (14%)
 Frame = -2

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQ  430
            R ++TM    +  YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE  
Sbjct  7    RSSETM---ESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE--  61

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                     P R G   C YY+KTG CKFGATC+F HP
Sbjct  62   --------FPERIGQPECQYYLKTGTCKFGATCRFHHP  91



>ref|XP_011014133.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=447

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  65   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  97

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P +   
Sbjct  98   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GISGRVSLNILGYPLQPNE  149

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  150  IECAYYLRTGQCKFGSTCKFHHPQPTNMM  178


 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  302  SVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPIGLPLR  353

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  354  PGEPLCIFYSRYGICKFGPSCKFDHP  379


 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  52   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  101

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  102  GQPECQYYLKTGTCKFGATCKFHHP  126


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 39/138 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I+                       R++  + G     
Sbjct  110  LKTGTCKFGATCKFHHPRDKAGISG----------------------RVSLNILG-----  142

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-----------SVTSSMEGEQQNFK  421
            YP +P ++EC +Y++TG+CKFG  C+FHHP   ++           +V+S     QQ++ 
Sbjct  143  YPLQPNEIECAYYLRTGQCKFGSTCKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQQSYP  202

Query  420  LSLAGLPRREGAIHCPYY  367
              LA    R   I  P +
Sbjct  203  GGLATTWSRASFITSPRW  220


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = -2

Query  477  LDHSLSVTSSMEGEQQNFKLSLAG-LPRREGAIHCPYYMKTGICKFGATCKFDHPP  313
            +  SLS  +  +   ++ +   AG  P R G   C YY++TG+C+FGATC+F+HPP
Sbjct  27   MSQSLSEDAMWQMNLRSSETMEAGPYPERSGEPDCSYYIRTGLCRFGATCRFNHPP  82



>ref|XP_007139732.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11726.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=426

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  80

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      L++ G P R   
Sbjct  81   PERIGQPECQYYLKTGTCKFGATCRFHHPRDKA--------GIAGRVALNILGYPLRPNE  132

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  133  PECAYYLRTGQCKFGNTCKFHHPQPSNMV  161


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q +C FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  281  NIFPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMIPAPDCV--------LSPIGLPLR  332

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  333  PGEPLCVFYSRYGICKFGPSCKFDHP  358


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 15/109 (14%)
 Frame = -2

Query  639  PTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS  460
            P  +++Q  + R ++TM    +  YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L+
Sbjct  15   PQDAMWQ-INLRSSETM---ESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLA  70

Query  459  VTSS-MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            + ++ M+GE           P R G   C YY+KTG CKFGATC+F HP
Sbjct  71   IAAARMKGE----------FPERIGQPECQYYLKTGTCKFGATCRFHHP  109



>ref|XP_011024099.1| PREDICTED: zinc finger CCCH domain-containing protein 43 isoform 
X2 [Populus euphratica]
Length=431

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 83/161 (52%), Gaps = 27/161 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG+CK+G  C++NHP               V     ++ +    R   T         
Sbjct  138  MKTGTCKFGVNCKFNHP---------------VRRKNQAVKEKVKEREEAT---------  173

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
             ++PGQ EC +Y++TG CK+GE CRF+H  + + SV+          +L+  GLP R G 
Sbjct  174  -EKPGQTECKYYLRTGGCKYGEACRFNHTREKTSSVSPLKTPMPSILELNFLGLPIRPGE  232

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YM+ G CK+GATCK++HP P  +  G S +TS  V 
Sbjct  233  KQCEFYMRNGSCKYGATCKYNHPDP--MAAGGSDLTSAFVN  271


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 67/178 (38%), Gaps = 69/178 (39%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTI---NPPAAHLNVGVV--------------------NPT  634
            ++ GSCKYGATC+YNHPD       +  +A +N G                      +PT
Sbjct  239  MRNGSCKYGATCKYNHPDPMAAGGSDLTSAFVNGGTASLPAPSPSSVGSWSSPRALNDPT  298

Query  633  ASLFQTFDP-RL---TQTMFGFATTIYP--------------------------------  562
              +   F P RL   +    G+  T+YP                                
Sbjct  299  PFVPYVFSPTRLPSQSSEWNGYQGTLYPPERMHPPPSYAMSNPATESNVYAPQQQQTVDE  358

Query  561  --QRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
              +RPGQ  C ++MK G+CKF   C++HHP +      S          LS  GLP R
Sbjct  359  FPERPGQQLCSYFMKFGDCKFKSNCKYHHPKNRIPKSPS--------LTLSDKGLPLR  408



>gb|KCW84568.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=419

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +    A +                              Y
Sbjct  55   IRTGLCRFGATCRFNHPSDRKLAIANARMK---------------------------GEY  87

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  88   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGKVALNILGYPFRPNE  139

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF HP P  ++
Sbjct  140  MECAYYLRTGQCKFGSTCKFHHPQPTNMM  168


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  281  NIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCL--------LSPIGLPLR  332

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  333  PGEPLCIFYSRYGICKFGPSCKFDHP  358


 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L++ ++ M+GE           P R 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDRKLAIANARMKGE----------YPERV  91

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  92   GQPECQYYLKTGTCKFGATCKFHHP  116


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 83/179 (46%), Gaps = 50/179 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I   A  + + ++                         
Sbjct  100  LKTGTCKFGATCKFHHPRDKAGI---AGKVALNILG------------------------  132

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-----------SVTSSMEGEQQNF-  424
            YP RP ++EC +Y++TG+CKFG  C+FHHP   ++           SV S     QQ++ 
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPVYPSVQSPTTPTQQSYP  192

Query  423  ------KLSLAGLPRREG-AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTS  268
                  + S    PR +G + + P  +  G+ + G+    D      ++ G SQ+  +S
Sbjct  193  GVTSWSRASFIPSPRWQGPSSYTPLIVPQGMGQLGSVSSSDS---QLIMMGQSQIFGSS  248


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 48/101 (48%), Gaps = 30/101 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    +  P   L+ +G+                          
Sbjct  296  MKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGL--------------------------  329

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLD--HSLSVTS  451
             P RPG+  C FY + G CKFG  C+F HP+   ++LS +S
Sbjct  330  -PLRPGEPLCIFYSRYGICKFGPSCKFDHPMGILNNLSASS  369



>ref|XP_010024648.1| PREDICTED: zinc finger CCCH domain-containing protein 58 isoform 
X2 [Eucalyptus grandis]
Length=452

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 76/149 (51%), Gaps = 36/149 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG+C YGA CR+NHP DR T+                         +  T  G A   
Sbjct  39   LRTGNCGYGAGCRFNHPRDRSTV-------------------------MGATRAGGAE--  71

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C FYM+TG CKFG  C++HHP   +        G      L+L G P R+G
Sbjct  72   YPERAGQPNCQFYMRTGTCKFGASCKYHHPRHGA--------GSSSPAPLNLCGYPFRQG  123

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGEL  301
               C +Y+KTG CKFGATCKF HP P  +
Sbjct  124  EKECSFYVKTGRCKFGATCKFHHPQPAGV  152


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 15/117 (13%)
 Frame = -2

Query  654  VGVVNPTASLF----QTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRF  487
            V  ++P+A  F    Q     L  ++ G     +P RPGQ EC  Y+KTG+C++G  C++
Sbjct  248  VTQLSPSAPAFPWPYQPSPSSLGPSVNGRREQSFPVRPGQPECQHYLKTGDCRYGSSCKY  307

Query  486  HHPLD-HSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH  319
            HHP D ++L+V         N  LS  GLP + GA  C ++ + G CKFG  CK+DH
Sbjct  308  HHPPDWNALNV---------NIVLSPTGLPIQPGAPPCMHFAR-GECKFGPACKYDH  354


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R    +C +Y++TG C +G  CRF+HP D S  + ++  G         A  P R G
Sbjct  26   YPERTEAADCIYYLRTGNCGYGAGCRFNHPRDRSTVMGATRAGG--------AEYPERAG  77

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
              +C +YM+TG CKFGA+CK+ HP
Sbjct  78   QPNCQFYMRTGTCKFGASCKYHHP  101



>ref|XP_007205202.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
 gb|EMJ06401.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
Length=442

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  60   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TARMKG----EF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  93   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCK+ HP P  ++
Sbjct  145  IECAYYLRTGQCKFGSTCKYHHPQPTNMM  173


 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 69/131 (53%), Gaps = 28/131 (21%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  297  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPIGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP----------------PPGELIGGTSQVTSTSVG  262
             G   C +Y + GICKFG +CKFDHP                P   L+G TS  TS ++ 
Sbjct  349  PGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNPNASSSADAPARRLLGSTSATTSLNLS  408

Query  261  EEEGYAKLVEA  229
             E     LVEA
Sbjct  409  PE----GLVEA  415


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKGE----------FPERI  96

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  97   GQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  105  LKTGTCKFGATCKFHHP----------RDKAGIAG-----------RVALNILG-----Y  138

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP ++EC +Y++TG+CKFG  C++HHP   ++ V+
Sbjct  139  PLRPNEIECAYYLRTGQCKFGSTCKYHHPQPTNMMVS  175


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = -2

Query  492  RFHHPLDHSLSVTSSMEGE---QQNFK----LSLAGLPRREGAIHCPYYMKTGICKFGAT  334
            R   P+  + S++ S+  +   Q N +    L     P R G   C YY++TG+C+FGAT
Sbjct  11   RAAAPVTDAPSLSPSLTQDAMWQMNLRSSETLEPGSYPERTGEPDCSYYIRTGLCRFGAT  70

Query  333  CKFDHPPPGELIGGTSQV  280
            C+F+HPP  +L   T+++
Sbjct  71   CRFNHPPNRKLAIATARM  88



>ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
 gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
Length=451

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  70   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  102

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  103  PERAGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNILGYPLRPNE  154

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P  ++
Sbjct  155  PECAYYLRTGQCKFGSTCKFHHPQPTNMM  183


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  306  NVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVLPAPDCV--------LSPIGLPLR  357

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKF+HP
Sbjct  358  PGEPLCIFYSRYGICKFGPSCKFNHP  383


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  57   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERA  106

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  107  GQPECQYYLKTGTCKFGATCKFHHP  131


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++  + G     Y
Sbjct  115  LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVSLNILG-----Y  148

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  149  PLRPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  185



>ref|XP_008218439.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Prunus mume]
Length=442

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 77/149 (52%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  60   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TARMKG----EF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  93   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCK+ HP P  ++
Sbjct  145  IECAYYLRTGQCKFGSTCKYHHPQPTNMM  173


 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 69/131 (53%), Gaps = 28/131 (21%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  297  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCV--------LSPIGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP----------------PPGELIGGTSQVTSTSVG  262
             G   C +Y + GICKFG +CKFDHP                P   L+G TS  TS ++ 
Sbjct  349  PGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNPNASSSADAPARRLLGSTSATTSLNLS  408

Query  261  EEEGYAKLVEA  229
             E     LVEA
Sbjct  409  SE----GLVEA  415


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKGE----------FPERI  96

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  97   GQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  105  LKTGTCKFGATCKFHHP----------RDKAGIAG-----------RVALNILG-----Y  138

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP ++EC +Y++TG+CKFG  C++HHP   ++ V+
Sbjct  139  PLRPNEIECAYYLRTGQCKFGSTCKYHHPQPTNMMVS  175


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = -2

Query  492  RFHHPLDHSLSVTSSMEGE---QQNFK----LSLAGLPRREGAIHCPYYMKTGICKFGAT  334
            R   P+  + S++ S+  +   Q N +    L     P R G   C YY++TG+C+FGAT
Sbjct  11   RAAAPVTDAPSLSPSLTQDAMWQMNLRSSETLEPGSYPERTGEPDCSYYIRTGLCRFGAT  70

Query  333  CKFDHPPPGELIGGTSQV  280
            C+F+HPP  +L   T+++
Sbjct  71   CRFNHPPNRKLAIATARM  88



>ref|XP_010038283.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Eucalyptus grandis]
 gb|KCW84569.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=429

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +    A +                              Y
Sbjct  55   IRTGLCRFGATCRFNHPSDRKLAIANARMK---------------------------GEY  87

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  88   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGKVALNILGYPFRPNE  139

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF HP P  ++
Sbjct  140  MECAYYLRTGQCKFGSTCKFHHPQPTNMM  168


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  291  NIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPAPDCL--------LSPIGLPLR  342

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  343  PGEPLCIFYSRYGICKFGPSCKFDHP  368


 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L++ ++ M+GE           P R 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDRKLAIANARMKGE----------YPERV  91

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  92   GQPECQYYLKTGTCKFGATCKFHHP  116


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 54/98 (55%), Gaps = 28/98 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG+CK+GATC+++HP D+  I   A  + + ++                         
Sbjct  100  LKTGTCKFGATCKFHHPRDKAGI---AGKVALNILG------------------------  132

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            YP RP ++EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  170


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 48/101 (48%), Gaps = 30/101 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    +  P   L+ +G+                          
Sbjct  306  MKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGL--------------------------  339

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLD--HSLSVTS  451
             P RPG+  C FY + G CKFG  C+F HP+   ++LS +S
Sbjct  340  -PLRPGEPLCIFYSRYGICKFGPSCKFDHPMGILNNLSASS  379



>emb|CDP03533.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 76/149 (51%), Gaps = 36/149 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C YGA CRYNHP DR ++         G V+                    A   
Sbjct  58   MRTGVCGYGAKCRYNHPRDRASVG--------GSVS-------------------LAAAD  90

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R G+ +C +Y++TG CKFG  C+FHHP +   S+ S          L++ G P R G
Sbjct  91   YPERVGEPDCQYYLRTGTCKFGASCKFHHPRNAGGSLIS--------VSLNIYGYPLRLG  142

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGEL  301
               C YY+KTG CKFG TCKF HP P  +
Sbjct  143  EKECSYYLKTGQCKFGNTCKFHHPQPAGM  171


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPGQ EC +YM+ G+CKFG  CRFHHP +  ++   S         LS  GLP R G
Sbjct  288  FPERPGQPECQYYMRYGDCKFGPSCRFHHPPNLVVAKAYS--------ALSPLGLPLRPG  339

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               CP+Y++ G CKFG  CKFDHP
Sbjct  340  MQSCPFYLQKGHCKFGRNCKFDHP  363


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG +EC +YM+TG C +G +CR++HP D + SV  S+        L+ A  P R G
Sbjct  45   YPERPGMLECAYYMRTGVCGYGAKCRYNHPRDRA-SVGGSVS-------LAAADYPERVG  96

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY++TG CKFGA+CKF HP
Sbjct  97   EPDCQYYLRTGTCKFGASCKFHHP  120


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++ G CK+G +CR++HP    +               A  +    P       G      
Sbjct  301  MRYGDCKFGPSCRFHHPPNLVV---------------AKAYSALSP------LGL-----  334

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG   C FY++ G CKFG  C+F HP+
Sbjct  335  PLRPGMQSCPFYLQKGHCKFGRNCKFDHPM  364



>ref|XP_004172583.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like, 
partial [Cucumis sativus]
Length=205

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +     TA +   F                
Sbjct  27   IRTGLCRFGATCRFNHP-------PNRELAIA----TARMKGEF----------------  59

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  60   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPSE  111

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  112  TECAYYLRTGQCKFGNTCKFHHPQPTNMM  140


 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP RPG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  14   YPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGE----------FPERI  63

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  64   GQPECQYYLKTGTCKFGATCKFHHP  88


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  72   LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVALNILG-----Y  105

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  106  PLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVS  142


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P R G   C YY++TG+C+FGATC+F+HPP  EL   T+++
Sbjct  15   PVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARM  55



>ref|XP_010024647.1| PREDICTED: zinc finger CCCH domain-containing protein 34 isoform 
X1 [Eucalyptus grandis]
 gb|KCW61097.1| hypothetical protein EUGRSUZ_H03871 [Eucalyptus grandis]
Length=484

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 75/146 (51%), Gaps = 36/146 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG+C YGA CR+NHP DR T+                         +  T  G A   
Sbjct  71   LRTGNCGYGAGCRFNHPRDRSTV-------------------------MGATRAGGAE--  103

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C FYM+TG CKFG  C++HHP   +        G      L+L G P R+G
Sbjct  104  YPERAGQPNCQFYMRTGTCKFGASCKYHHPRHGA--------GSSSPAPLNLCGYPFRQG  155

Query  387  AIHCPYYMKTGICKFGATCKFDHPPP  310
               C +Y+KTG CKFGATCKF HP P
Sbjct  156  EKECSFYVKTGRCKFGATCKFHHPQP  181


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (56%), Gaps = 15/117 (13%)
 Frame = -2

Query  654  VGVVNPTASLF----QTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRF  487
            V  ++P+A  F    Q     L  ++ G     +P RPGQ EC  Y+KTG+C++G  C++
Sbjct  280  VTQLSPSAPAFPWPYQPSPSSLGPSVNGRREQSFPVRPGQPECQHYLKTGDCRYGSSCKY  339

Query  486  HHPLD-HSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH  319
            HHP D ++L+V         N  LS  GLP + GA  C ++ + G CKFG  CK+DH
Sbjct  340  HHPPDWNALNV---------NIVLSPTGLPIQPGAPPCMHFAR-GECKFGPACKYDH  386


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R    +C +Y++TG C +G  CRF+HP D S  + ++  G         A  P R G
Sbjct  58   YPERTEAADCIYYLRTGNCGYGAGCRFNHPRDRSTVMGATRAGG--------AEYPERAG  109

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
              +C +YM+TG CKFGA+CK+ HP
Sbjct  110  QPNCQFYMRTGTCKFGASCKYHHP  133



>ref|XP_011024098.1| PREDICTED: zinc finger CCCH domain-containing protein 67 isoform 
X1 [Populus euphratica]
Length=473

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 83/161 (52%), Gaps = 27/161 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG+CK+G  C++NHP               V     ++ +    R   T         
Sbjct  138  MKTGTCKFGVNCKFNHP---------------VRRKNQAVKEKVKEREEAT---------  173

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
             ++PGQ EC +Y++TG CK+GE CRF+H  + + SV+          +L+  GLP R G 
Sbjct  174  -EKPGQTECKYYLRTGGCKYGEACRFNHTREKTSSVSPLKTPMPSILELNFLGLPIRPGE  232

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
              C +YM+ G CK+GATCK++HP P  +  G S +TS  V 
Sbjct  233  KQCEFYMRNGSCKYGATCKYNHPDP--MAAGGSDLTSAFVN  271


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/236 (31%), Positives = 96/236 (41%), Gaps = 74/236 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTI---NPPAAHLNVGVV--------------------NPT  634
            ++ GSCKYGATC+YNHPD       +  +A +N G                      +PT
Sbjct  239  MRNGSCKYGATCKYNHPDPMAAGGSDLTSAFVNGGTASLPAPSPSSVGSWSSPRALNDPT  298

Query  633  ASLFQTFDP-RL---TQTMFGFATTIY---------------------------------  565
              +   F P RL   +    G+  T+Y                                 
Sbjct  299  PFVPYVFSPTRLPSQSSEWNGYQGTLYPPERMHPPPSYAMSNPATESNVYAPQQQQTVDE  358

Query  564  -PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
             P+RPGQ  C ++MK G+CKF   C++HHP +      S          LS  GLP R  
Sbjct  359  FPERPGQQLCSYFMKFGDCKFKSNCKYHHPKNRIPKSPS--------LTLSDKGLPLRPD  410

Query  387  AIHCPYYMKTGICKFGATCKFDHP--PPGELIGGTSQVT-STSVGEEEGYAKLVEA  229
             I C YY + GICKFG  CKFDH   PP    G         SV +EE  A++ E+
Sbjct  411  QIICSYYSRYGICKFGPACKFDHSIQPPSSGSGDDQHTAFGNSVTQEE--ARMAES  464



>ref|XP_009134713.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=377

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 87/167 (52%), Gaps = 42/167 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR  +                         +   M G     
Sbjct  51   IRTGLCRFGSTCRFNHPRDRELV-------------------------IATAMRG----E  81

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G   +  L++ G P R  
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGSVSLNMLGYPLRSN  133

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
             + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  134  EVDCAYFLRTGHCKFGATCKFNHPQPQP----TTNLMVPTSGQQQSY  176


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + ++M GE           P R G
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATAMRGE----------YPERIG  87

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
               C YY+KTG CKFG TCKF HP     I G+
Sbjct  88   QPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGS  120


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 10/123 (8%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            + +++P+RPGQ EC FYMKTG+CKFG  C+FHHP D        +        LS  GLP
Sbjct  248  SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCL--------LSPIGLP  299

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELI-GGTSQVTSTSVGEEEGYAKLVEAIQ  223
             R G   C +Y +  ICKFG +CKF HPP G      T+  T   +    G+++ +   +
Sbjct  300  LRPGEPLCVFYSRYRICKFGPSCKF-HPPMGVFTYDNTASETDEVMKTTTGHSRRLSVSE  358

Query  222  KQQ  214
             +Q
Sbjct  359  TRQ  361


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 27/115 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP            N   +  + SL           M G     Y
Sbjct  95   LKTGTCKFGVTCKFHHPR-----------NKAGIAGSVSL----------NMLG-----Y  128

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGL  403
            P R  +V+C ++++TG CKFG  C+F+HP    + ++     G+QQ++  S A  
Sbjct  129  PLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASF  183


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            + L   P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+
Sbjct  33   MELGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATA  77



>gb|KJB82178.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=252

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATC +NHP    +   AA +                              +
Sbjct  65   IRTGLCRFGATCHFNHPPNRKLAIAAARMK---------------------------GEF  97

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  98   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNILGYPLRPNE  149

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P  ++
Sbjct  150  TECAYYLRTGQCKFGSTCKFHHPQPTNMM  178


 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = -2

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQ  430
            R ++TM    ++ YP+RPG+ +C +Y++TG C+FG  C F+HP +  L++ ++ M+GE  
Sbjct  42   RSSETM---ESSPYPERPGEPDCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGE--  96

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                     P R G   C YY+KTG CKFGATCKF HP
Sbjct  97   --------FPERVGQPECQYYLKTGTCKFGATCKFHHP  126


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++  + G     Y
Sbjct  110  LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVSLNILG-----Y  143

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  144  PLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  180



>ref|XP_010929824.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=263

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP   ++   AA +  G                           Y
Sbjct  51   IRTGLCRFGMTCKFNHPPNRSLAIAAARIKGG---------------------------Y  83

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D      + M G  Q   L++ G P R   
Sbjct  84   PERVGQPECQYYLKTGTCKFGATCKFHHPKD-----KAGMAGRVQ---LNILGYPLRLNE  135

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P   +
Sbjct  136  KECAYYIRTGQCKFGNTCKFHHPQPSNAM  164


 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 13/133 (10%)
 Frame = -2

Query  675  PPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGER  496
            PPAA +  G  +         + R +++M    +  YP+RPG+ +C +Y++TG C+FG  
Sbjct  6    PPAA-MTEGSSSLDEEAMWQMNLRGSESM---ESGPYPERPGEPDCAYYIRTGLCRFGMT  61

Query  495  CRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            C+F+HP + SL++ ++             G P R G   C YY+KTG CKFGATCKF HP
Sbjct  62   CKFNHPPNRSLAIAAAR---------IKGGYPERVGQPECQYYLKTGTCKFGATCKFHHP  112

Query  315  PPGELIGGTSQVT  277
                 + G  Q+ 
Sbjct  113  KDKAGMAGRVQLN  125



>ref|XP_009134712.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=379

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 87/167 (52%), Gaps = 42/167 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR  +                         +   M G     
Sbjct  51   IRTGLCRFGSTCRFNHPRDRELV-------------------------IATAMRG----E  81

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G   +  L++ G P R  
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGSVSLNMLGYPLRSN  133

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
             + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  134  EVDCAYFLRTGHCKFGATCKFNHPQPQP----TTNLMVPTSGQQQSY  176


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 10/93 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + ++M GE           P R G
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATAMRGE----------YPERIG  87

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
               C YY+KTG CKFG TCKF HP     I G+
Sbjct  88   QPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGS  120


 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 10/123 (8%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            + +++P+RPGQ EC FYMKTG+CKFG  C+FHHP D        +        LS  GLP
Sbjct  250  SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCL--------LSPIGLP  301

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELI-GGTSQVTSTSVGEEEGYAKLVEAIQ  223
             R G   C +Y +  ICKFG +CKF HPP G      T+  T   +    G+++ +   +
Sbjct  302  LRPGEPLCVFYSRYRICKFGPSCKF-HPPMGVFTYDNTASETDEVMKTTTGHSRRLSVSE  360

Query  222  KQQ  214
             +Q
Sbjct  361  TRQ  363


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 27/115 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP            N   +  + SL           M G     Y
Sbjct  95   LKTGTCKFGVTCKFHHPR-----------NKAGIAGSVSL----------NMLG-----Y  128

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGL  403
            P R  +V+C ++++TG CKFG  C+F+HP    + ++     G+QQ++  S A  
Sbjct  129  PLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASF  183


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
            + L   P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+
Sbjct  33   MELGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATA  77



>ref|XP_009776617.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Nicotiana sylvestris]
Length=338

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 84/177 (47%), Gaps = 42/177 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDR--------------YTINP-PAAHLNVGVVNPTASLFQTFD  610
            L+TG+CK+GA+C+++HP                Y + P P +        P+A +   + 
Sbjct  103  LRTGTCKFGASCKFHHPKNLGGSLSNIPLNTHGYPVRPGPVSPALSPGAQPSAGVTSIYG  162

Query  609  -PRLTQTMFGFATTI------------------YPQRPGQVECDFYMKTGECKFGERCRF  487
              +L  +   FA T                   +P+RPGQ  C +YMKTG+CKFG  CR+
Sbjct  163  ISQLASSTHAFAGTYSPLHSAASPSSKTQKEKSFPERPGQPTCQYYMKTGDCKFGSSCRY  222

Query  486  HHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            HHP D   S T        N  +S  GLP R G   C +Y+  G CKFG  CKFDHP
Sbjct  223  HHPPDWIASKT--------NCAISPLGLPLRPGVQPCSFYLLKGFCKFGRACKFDHP  271


 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 9/94 (10%)
 Frame = -2

Query  597  QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKL  418
            Q +  +   IYP+RPG  +C +YM+TG C +G  CR++HP D +      M+ E+  F  
Sbjct  35   QRLGLWGREIYPERPGVPDCSYYMRTGSCGYGANCRYNHPRDRAYG--GKMQLERVEF--  90

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                 P R G   C YY++TG CKFGA+CKF HP
Sbjct  91   -----PERLGEPMCQYYLRTGTCKFGASCKFHHP  119



>ref|XP_006602842.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=426

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  80

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      L++ G P R   
Sbjct  81   PERIGQPECQYYLKTGTCKFGATCRFHHPRDKA--------GIAGRVALNILGYPLRPNE  132

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  133  PECGYYLRTGQCKFGNTCKFHHPQPNNMV  161


 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  281  NIFPERPDQPECQFYMKTGDCKFGAVCRFHHPHERMIPAPDCV--------LSPIGLPLR  332

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  333  PGEPLCVFYSRYGICKFGPSCKFDHP  358


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 15/109 (14%)
 Frame = -2

Query  639  PTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS  460
            P  +++Q  + R ++TM    +  YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L+
Sbjct  15   PQDAMWQ-INLRSSETM---ESEPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLA  70

Query  459  VTSS-MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            + ++ M+GE           P R G   C YY+KTG CKFGATC+F HP
Sbjct  71   IAAARMKGE----------FPERIGQPECQYYLKTGTCKFGATCRFHHP  109


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (46%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP    I  P       V++P                        
Sbjct  296  MKTGDCKFGAVCRFHHPHERMIPAPDC-----VLSPIG---------------------L  329

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  C FY + G CKFG  C+F HP+
Sbjct  330  PLRPGEPLCVFYSRYGICKFGPSCKFDHPM  359



>emb|CDY28712.1| BnaCnng05980D [Brassica napus]
Length=390

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 39/166 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  50   IRTGLCRFGSTCRFNHP-------PDRELVIA----------------TARMRG----EY  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC++Y+KTG CKFG  C+FHHP + +        G      L++ G P R   
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRVSLNMLGYPLRSNE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
            + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  135  VDCAYFLRTGHCKFGATCKFNHPQPQP----TTSLMVPTSGQQQSY  176


 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 8/122 (7%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            + +++P+RPGQ EC FYMKTG+CKFG  C+FHHP D        +        LS  GLP
Sbjct  267  SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCL--------LSPIGLP  318

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQK  220
             R G   C +Y + GICKFG +CKF HP        T+  T   V    G+++ V   + 
Sbjct  319  LRPGEPLCVFYSRYGICKFGPSCKFHHPMEVFAYDNTASETDEVVETSGGHSRRVSVSET  378

Query  219  QQ  214
            +Q
Sbjct  379  RQ  380


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 52/85 (61%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+RPG+  C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P R 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARMRGE----------YPERI  86

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFG TCKF HP
Sbjct  87   GQPECEYYLKTGTCKFGVTCKFHHP  111


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            +     P R G  +C YY++TG+C+FG+TC+F+HPP  EL+  T+++
Sbjct  32   MEAGSYPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARM  78



>ref|XP_008794629.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794630.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794631.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
Length=467

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 72/149 (48%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C+YG TCRYNHP    +   AA +  G                           Y
Sbjct  66   LRTGLCRYGLTCRYNHPPDRKLAIAAARIRGG---------------------------Y  98

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  99   PERVGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIFGRAPLNVLGYPIRPNE  150

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P   +
Sbjct  151  KECAYYLRTGQCKFGNTCKFHHPQPSNAM  179


 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
            +++P+RP Q EC FYMKTG+CKFG  C+FHHP +  +           N  LS  GLP R
Sbjct  303  SVFPERPDQPECQFYMKTGDCKFGAACKFHHPKERLVPAP--------NCVLSPLGLPLR  354

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  355  PGEPLCVFYSRYGICKFGPNCKFDHP  380


 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 53/85 (62%), Gaps = 9/85 (11%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YP+RPG  +C +Y++TG C++G  CR++HP D  L++ ++             G P R 
Sbjct  52   LYPERPGVPDCAYYLRTGLCRYGLTCRYNHPPDRKLAIAAAR---------IRGGYPERV  102

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  103  GQPECQYYLKTGTCKFGATCKFHHP  127


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (45%), Gaps = 33/109 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    +  P       V++P                        
Sbjct  318  MKTGDCKFGAACKFHHPKERLVPAPNC-----VLSPLG---------------------L  351

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL-------DHSLSVTSSMEG  439
            P RPG+  C FY + G CKFG  C+F HP+        +SLS +SS + 
Sbjct  352  PLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPMGIFAYSLSTSSSADA  400



>ref|XP_004296815.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 70/145 (48%), Gaps = 36/145 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG C YG+ CRYNHP DR  +      L  G V                         
Sbjct  56   LRTGICGYGSRCRYNHPRDRSAVT---GALRAGSVE------------------------  88

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C +YM+TG CKFG  C++HHP     S T           L+  G P R G
Sbjct  89   YPERVGQPVCQYYMRTGTCKFGATCKYHHPKQGGGSAT--------PVSLNYYGYPLRPG  140

Query  387  AIHCPYYMKTGICKFGATCKFDHPP  313
               C YY+KTG CKFGATCKF HPP
Sbjct  141  ERECSYYVKTGQCKFGATCKFHHPP  165


 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPGQ EC +Y++TGECKFG  CR+HHP +        +   +    LS  GLP R G
Sbjct  296  HPERPGQAECQYYLRTGECKFGSSCRYHHPAE--------VVPLKTPVALSSTGLPSRPG  347

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
            A  C +Y + G CKFG+ CKFDHP
Sbjct  348  APLCTHYAQRGACKFGSACKFDHP  371


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (60%), Gaps = 11/99 (11%)
 Frame = -2

Query  603  LTQTMFGFAT---TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ  433
            L ++M+  A      YP+RP + +C +Y++TG C +G RCR++HP D S +VT ++    
Sbjct  28   LEESMWQLALGPGESYPERPDEADCSYYLRTGICGYGSRCRYNHPRDRS-AVTGALRAGS  86

Query  432  QNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              +       P R G   C YYM+TG CKFGATCK+ HP
Sbjct  87   VEY-------PERVGQPVCQYYMRTGTCKFGATCKYHHP  118


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 46/101 (46%), Gaps = 29/101 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG CK+G++CRY+HP             V +  P A                 ++T  
Sbjct  309  LRTGECKFGSSCRYHHPAEV----------VPLKTPVA----------------LSSTGL  342

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP---LDHSLSVTS  451
            P RPG   C  Y + G CKFG  C+F HP   L +S S +S
Sbjct  343  PSRPGAPLCTHYAQRGACKFGSACKFDHPVGTLSYSPSASS  383



>gb|KEH23393.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=408

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  30   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TARMKG----EF  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      L++ G P R   
Sbjct  63   PERLGQPECQYYLKTGTCKFGATCRFHHPKDKA--------GVAGRVALNILGYPLRPNE  114

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  115  SECAYYLRTGQCKFGNTCKFHHPQPSNMV  143


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  CRFHHP + ++     +        LS  GLP R
Sbjct  263  NIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCV--------LSPLGLPLR  314

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  315  PGEPLCVFYSRYGICKFGPSCKFDHP  340


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKGE----------FPERL  66

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATC+F HP
Sbjct  67   GQPECQYYLKTGTCKFGATCRFHHP  91


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 51/110 (46%), Gaps = 27/110 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP   TI  P       V++P                        
Sbjct  278  MKTGDCKFGAVCRFHHPRERTIPAPDC-----VLSPLG---------------------L  311

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD-HSLSVTSSMEGEQQNFKL  418
            P RPG+  C FY + G CKFG  C+F HP+   + +V++S   E    +L
Sbjct  312  PLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEAAGRRL  361



>gb|EYU43139.1| hypothetical protein MIMGU_mgv1a007548mg [Erythranthe guttata]
Length=404

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 75/146 (51%), Gaps = 36/146 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG+C YG+ CR+NHP     N     +  GV N T  L                    
Sbjct  55   LRTGACGYGSNCRFNHP----FNNAGGQV-YGVKNTTIEL--------------------  89

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C +Y+KTG CK+G  C++HHP +    V ++M            GLP R+ +
Sbjct  90   PERAGQPDCGYYLKTGTCKYGSTCKYHHPKERQADVLTNM-----------LGLPMRQDS  138

Query  384  IHCPYYMKTGICKFGATCKFDHPPPG  307
              CPYYM+TGICK+G  CKF HP P 
Sbjct  139  RACPYYMRTGICKYGYACKFHHPQPA  164


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = -2

Query  588  FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLA  409
             G    +YP RPG+ +C +Y++TG C +G  CRF+HP +++        G+    K +  
Sbjct  35   VGDEPVVYPDRPGEPDCIYYLRTGACGYGSNCRFNHPFNNA-------GGQVYGVKNTTI  87

Query  408  GLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             LP R G   C YY+KTG CK+G+TCK+ HP
Sbjct  88   ELPERAGQPDCGYYLKTGTCKYGSTCKYHHP  118


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 78/185 (42%), Gaps = 51/185 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVN-----------------------PT  634
            ++TG CKYG  C+++HP    + P      VG V                        PT
Sbjct  145  MRTGICKYGYACKFHHPQP-ALAPNVLPAVVGTVYGASASSAVPSSAVPQLSAKATYFPT  203

Query  633  A-SLFQTFDPRLTQTMFGF---------------ATTIYPQRPGQVECDFYMKTGECKFG  502
            +  L Q++ P       G+               + +  P+RP Q EC ++M  G CK+G
Sbjct  204  SLQLPQSYMPLFISQSQGWNAYAGGMNHLSNGMMSASYLPERPDQPECRYFMNHGSCKYG  263

Query  501  ERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFD  322
              C++HHP +   S++               GLP R G   C +Y   GICK+G TC+FD
Sbjct  264  PDCKYHHPREKLASIS-----------FGPLGLPLRPGQAICSHYNLYGICKYGPTCRFD  312

Query  321  HPPPG  307
            HP  G
Sbjct  313  HPMDG  317



>ref|XP_003624157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES80375.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=418

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  40   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TARMKG----EF  72

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      L++ G P R   
Sbjct  73   PERLGQPECQYYLKTGTCKFGATCRFHHPKDKA--------GVAGRVALNILGYPLRPNE  124

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  125  SECAYYLRTGQCKFGNTCKFHHPQPSNMV  153


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  CRFHHP + ++     +        LS  GLP R
Sbjct  273  NIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCV--------LSPLGLPLR  324

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  325  PGEPLCVFYSRYGICKFGPSCKFDHP  350


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 15/109 (14%)
 Frame = -2

Query  639  PTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS  460
            P  +++Q    R ++TM    +  YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L+
Sbjct  7    PQEAMWQ-MSLRPSETM---ESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLA  62

Query  459  V-TSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            + T+ M+GE           P R G   C YY+KTG CKFGATC+F HP
Sbjct  63   IATARMKGE----------FPERLGQPECQYYLKTGTCKFGATCRFHHP  101


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 42/90 (47%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP   TI  P       V++P                        
Sbjct  288  MKTGDCKFGAVCRFHHPRERTIPAPDC-----VLSPLG---------------------L  321

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  C FY + G CKFG  C+F HP+
Sbjct  322  PLRPGEPLCVFYSRYGICKFGPSCKFDHPM  351



>ref|XP_003534518.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoformX2 [Glycine max]
Length=426

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  48   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  80

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      +++ G P R   
Sbjct  81   PERIGQPECQYYLKTGTCKFGATCRFHHPRDKA--------GIAGRVAMNILGYPLRPNE  132

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  133  PECAYYLRTGQCKFGNTCKFHHPQPNNMV  161


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  281  NIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMIPAPDCV--------LSPIGLPLR  332

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  333  PGEPLCVFYSRYGICKFGPSCKFDHP  358


 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 67/109 (61%), Gaps = 15/109 (14%)
 Frame = -2

Query  639  PTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS  460
            P  +++Q  + R ++TM    +  YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L+
Sbjct  15   PPDAMWQ-INLRSSETM---ESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLA  70

Query  459  VTSS-MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            + ++ M+GE           P R G   C YY+KTG CKFGATC+F HP
Sbjct  71   IAAARMKGE----------FPERIGQPECQYYLKTGTCKFGATCRFHHP  109


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (46%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP    I  P       V++P                        
Sbjct  296  MKTGDCKFGAVCRFHHPRERMIPAPDC-----VLSPIG---------------------L  329

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  C FY + G CKFG  C+F HP+
Sbjct  330  PLRPGEPLCVFYSRYGICKFGPSCKFDHPM  359



>gb|ACC85690.1| zinc finger protein [Medicago sativa]
 gb|AFP86282.1| zinc finger protein [Medicago sativa]
Length=418

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  40   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TARMKG----EF  72

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      L++ G P R   
Sbjct  73   PERLGQPECQYYLKTGTCKFGATCRFHHPKDKA--------GVAGRVALNILGYPLRPNE  124

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  125  SECAYYLRTGQCKFGNTCKFHHPQPSNMV  153


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  CRFHHP + ++     +        LS  GLP R
Sbjct  273  NIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPDCV--------LSPLGLPLR  324

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  325  PGEPLCVFYSRYGICKFGPSCKFDHP  350


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 15/109 (14%)
 Frame = -2

Query  639  PTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS  460
            P  +++Q    R ++TM    +  YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L+
Sbjct  7    PQEAMWQ-MSLRPSETM---ESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLA  62

Query  459  V-TSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            + T+ M+GE           P R G   C YY+KTG CKFGATC+F HP
Sbjct  63   IATARMKGE----------FPERLGQPECQYYLKTGTCKFGATCRFHHP  101


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 51/110 (46%), Gaps = 27/110 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP   TI  P       V++P                        
Sbjct  288  MKTGDCKFGAVCRFHHPRERTIPAPDC-----VLSPLG---------------------L  321

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD-HSLSVTSSMEGEQQNFKL  418
            P RPG+  C FY + G CKFG  C+F HP+   + +V++S   E    +L
Sbjct  322  PLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEAAGRRL  371



>ref|XP_006397979.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
 gb|ESQ39432.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
Length=525

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 71/147 (48%), Gaps = 37/147 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C YG  CRYNHP DR T+                                 AT  
Sbjct  110  MRTGVCGYGNRCRYNHPRDRATVEAAVR----------------------------ATGQ  141

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R G+  C FY+KTG CKFG  C+FHHP +          G   +  L++ G P REG
Sbjct  142  YPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAG--------GSMSHVPLNIYGYPVREG  193

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPG  307
               C YY+KTG CKFG TCKF HP P 
Sbjct  194  EKDCSYYLKTGQCKFGITCKFHHPQPA  220


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPG+ EC +Y+KTG+CKFG  C+FHHP D            + N  LS  GLP R G
Sbjct  342  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRI--------PPRANCVLSPIGLPLRPG  393

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +Y++ G CKFG+TCKFDHP
Sbjct  394  VQRCTFYVQNGFCKFGSTCKFDHP  417


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 67/128 (52%), Gaps = 16/128 (13%)
 Frame = -2

Query  693  DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGF--ATTIYPQRPGQVECDFYMKT  520
            D Y  NPP     +    P        D  L ++M+     +  YP+RPG  +C +YM+T
Sbjct  58   DMYGRNPP-----MNASQPAEWTPGDADTGLDESMWQLRLGSETYPERPGAPDCAYYMRT  112

Query  519  GECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFG  340
            G C +G RCR++HP D + +V +++    Q         P R G   C +Y+KTG CKFG
Sbjct  113  GVCGYGNRCRYNHPRDRA-TVEAAVRATGQ--------YPERIGEPPCQFYLKTGTCKFG  163

Query  339  ATCKFDHP  316
            A+CKF HP
Sbjct  164  ASCKFHHP  171


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG CK+G +C+++HP DR    PP A+    V++P                       
Sbjct  355  LKTGDCKFGTSCKFHHPRDRI---PPRANC---VLSPIG---------------------  387

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG   C FY++ G CKFG  C+F HP+
Sbjct  388  LPLRPGVQRCTFYVQNGFCKFGSTCKFDHPM  418



>ref|XP_004157161.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
Length=220

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 67/116 (58%), Gaps = 17/116 (15%)
 Frame = -2

Query  636  TASLFQTFDPRLTQTMFGFATT---------IYPQRPGQVECDFYMKTGECKFGERCRFH  484
            +A+LF TF  R T  +   +++         ++P+RPGQ EC FYMKTG+CKFG  CRFH
Sbjct  46   SATLFSTFAIRSTDQLGSVSSSESPQQTRENVFPERPGQPECQFYMKTGDCKFGAVCRFH  105

Query  483  HPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            HP +  L     +        LS  GLP R G   C +Y + GICKFG +CKFDHP
Sbjct  106  HPRERVLPAPDCV--------LSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHP  153



>ref|XP_006606433.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=430

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  47   IRTGLCRFGATCRFNHP-------PNRRLAIA----------------TARMIG----EF  79

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  80   PERIGQPECQYYLKTGTCKFGATCKFHHPKDQA--------GIAGRVALNILGYPLRPNE  131

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  132  PECTYYLRTGQCKFGNTCKFHHPQPSNMM  160


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -2

Query  663  HLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFH  484
            +LN+ V NP  SL+   + R  +TM    +  YP+RPG+ +C +Y++TG C+FG  CRF+
Sbjct  6    NLNLIVPNPQDSLWM-MNLRTGETM---DSGSYPERPGEPDCSYYIRTGLCRFGATCRFN  61

Query  483  HPLDHSLSV-TSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPG  307
            HP +  L++ T+ M GE           P R G   C YY+KTG CKFGATCKF HP   
Sbjct  62   HPPNRRLAIATARMIGE----------FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQ  111

Query  306  ELIGG  292
              I G
Sbjct  112  AGIAG  116


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC FY+KTG+CKFG  C+FHHP +  +     +        LS  GLP R
Sbjct  284  NIFPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLIPAPDCV--------LSPIGLPLR  335

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  336  LGEPLCVFYSRYGICKFGPSCKFDHP  361


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 27/100 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    I  P       V++P                        
Sbjct  299  VKTGDCKFGAVCQFHHPRERLIPAPDC-----VLSPIG---------------------L  332

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD-HSLSVTSS  448
            P R G+  C FY + G CKFG  C+F HP++  S ++T+S
Sbjct  333  PLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITTS  372


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P R G   C YY++TG+C+FGATC+F+HPP   L   T+++
Sbjct  35   PERPGEPDCSYYIRTGLCRFGATCRFNHPPNRRLAIATARM  75



>ref|XP_009118612.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=372

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 86/167 (51%), Gaps = 41/167 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR  +                          T  M G     
Sbjct  51   IRTGLCRFGSTCRFNHPRDRELV------------------------IATARMRG----E  82

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G      L++ G P R  
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GVAGRVSLNMLGYPLRSN  134

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
             + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  135  EVDCAYFLRTGHCKFGATCKFNHPQPQP----TTNLMVPTSGQQQSY  177


 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 102/230 (44%), Gaps = 53/230 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPD-----------------------------RYT--------IN  676
            L+TG CK+GATC++NHP                              R+         + 
Sbjct  142  LRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASPRWQDPSGFTPLMM  201

Query  675  PPAAHLN---VGVVNPTASLFQTFDPR-LTQTMFGFAT----TIYPQRPGQVECDFYMKT  520
            P     N   +G V+P+ +  +  + R + Q   G +      ++P+RPGQ EC FYMKT
Sbjct  202  PQGVVWNPYSLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKT  261

Query  519  GECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFG  340
            G+CKFG  C+FHHP D        +        LS  GLP R G   C +Y + GICKFG
Sbjct  262  GDCKFGTVCKFHHPRDRQPPSPDCL--------LSPIGLPLRPGEPVCVFYSRYGICKFG  313

Query  339  ATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TFCSVQ  190
             +CKF+HP        T+  T   V    G ++ V   + +Q  T  S Q
Sbjct  314  PSCKFNHPMEIFAYDNTASETDEVVETSRGDSRRVSVSETRQATTTTSGQ  363


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP  400
            T  YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct  35   TGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE----------YP  84

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R G   C YY+KTG CKFG TCKF HP
Sbjct  85   ERIGQPECEYYLKTGTCKFGVTCKFHHP  112


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 78/206 (38%), Gaps = 89/206 (43%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP              GV             R++  M G     Y
Sbjct  96   LKTGTCKFGVTCKFHHPRN----------KAGVAG-----------RVSLNMLG-----Y  129

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGL---PR  397
            P R  +V+C ++++TG CKFG  C+F+HP    + ++     G+QQ++  S A     PR
Sbjct  130  PLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASPR  189

Query  396  R------------EGAIHCPY---------------------------------------  370
                         +G +  PY                                       
Sbjct  190  WQDPSGFTPLMMPQGVVWNPYSLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENVFPER  249

Query  369  --------YMKTGICKFGATCKFDHP  316
                    YMKTG CKFG  CKF HP
Sbjct  250  PGQPECQFYMKTGDCKFGTVCKFHHP  275


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            +     P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+++
Sbjct  33   METGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  79



>ref|XP_009147316.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Brassica 
rapa]
Length=392

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 77/145 (53%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  50   IRTGLCRFGSTCRFNHP-------PDRELVIA----------------TARMRG----EY  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC++Y+KTG CKFG  C+FHHP + +        G      L++ G P R   
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRVSLNMLGYPLRSNE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
            + C Y+++TG CKFGATCKF+HP P
Sbjct  135  VDCAYFLRTGHCKFGATCKFNHPQP  159


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 65/122 (53%), Gaps = 8/122 (7%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            + +++P+RPGQ EC FYMKTG+CKFG  C+FHHP D        +        LS  GLP
Sbjct  269  SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCL--------LSPIGLP  320

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQK  220
             R G   C +Y +  ICKFG +CKF HP        T+  T   V    G+++ V   + 
Sbjct  321  LRPGEPLCVFYSRYRICKFGPSCKFHHPMEVFAYDNTASETDEVVEASGGHSRRVSVSET  380

Query  219  QQ  214
            +Q
Sbjct  381  RQ  382


 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 11/88 (13%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP  400
            T  YP+RPG+  C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct  34   TGSYPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARMRGE----------YP  83

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R G   C YY+KTG CKFG TCKF HP
Sbjct  84   ERIGQPECEYYLKTGTCKFGVTCKFHHP  111


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  432  QNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            Q+  +     P R G  +C YY++TG+C+FG+TC+F+HPP  EL+  T+++
Sbjct  28   QDETMETGSYPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARM  78



>ref|XP_009118604.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=374

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 86/167 (51%), Gaps = 41/167 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR  +                          T  M G     
Sbjct  51   IRTGLCRFGSTCRFNHPRDRELV------------------------IATARMRG----E  82

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G      L++ G P R  
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GVAGRVSLNMLGYPLRSN  134

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
             + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  135  EVDCAYFLRTGHCKFGATCKFNHPQPQP----TTNLMVPTSGQQQSY  177


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 97/232 (42%), Gaps = 55/232 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPD-----------------------RYTINP---------PAAH  661
            L+TG CK+GATC++NHP                         +  +P         P   
Sbjct  142  LRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASPRWQDPSGFTPLMM  201

Query  660  LNVGVVNPTASLFQTFDP-----------RLTQTMFGFAT----TIYPQRPGQVECDFYM  526
                V NP +    +  P            + Q   G +      ++P+RPGQ EC FYM
Sbjct  202  PQGVVWNPYSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENVFPERPGQPECQFYM  261

Query  525  KTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICK  346
            KTG+CKFG  C+FHHP D        +        LS  GLP R G   C +Y + GICK
Sbjct  262  KTGDCKFGTVCKFHHPRDRQPPSPDCL--------LSPIGLPLRPGEPVCVFYSRYGICK  313

Query  345  FGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TFCSVQ  190
            FG +CKF+HP        T+  T   V    G ++ V   + +Q  T  S Q
Sbjct  314  FGPSCKFNHPMEIFAYDNTASETDEVVETSRGDSRRVSVSETRQATTTTSGQ  365


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP  400
            T  YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct  35   TGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE----------YP  84

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R G   C YY+KTG CKFG TCKF HP
Sbjct  85   ERIGQPECEYYLKTGTCKFGVTCKFHHP  112


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 27/115 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP              GV             R++  M G     Y
Sbjct  96   LKTGTCKFGVTCKFHHPRN----------KAGVAG-----------RVSLNMLG-----Y  129

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGL  403
            P R  +V+C ++++TG CKFG  C+F+HP    + ++     G+QQ++  S A  
Sbjct  130  PLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASF  184


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            +     P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+++
Sbjct  33   METGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  79



>emb|CDY51531.1| BnaA05g33310D [Brassica napus]
Length=395

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 77/145 (53%), Gaps = 35/145 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  50   IRTGLCRFGSTCRFNHP-------PDRELVIA----------------TARMRG----EY  82

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC++Y+KTG CKFG  C+FHHP + +        G      L++ G P R   
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRVSLNMLGYPLRSNE  134

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
            + C Y+++TG CKFGATCKF+HP P
Sbjct  135  VDCAYFLRTGHCKFGATCKFNHPQP  159


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 8/122 (7%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            + +++P+RPGQ EC FYMKTG+CKFG  C+FHHP D        +        LS  GLP
Sbjct  272  SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCL--------LSTIGLP  323

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQK  220
             R G   C +Y + GICKFG +CKF HP        T+  T   V    G+++ V   + 
Sbjct  324  LRPGEPLCVFYSRYGICKFGPSCKFHHPMEVFAYDNTASETDEVVETSGGHSRRVSVSET  383

Query  219  QQ  214
            +Q
Sbjct  384  RQ  385


 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 53/88 (60%), Gaps = 11/88 (13%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP  400
            T  YP+RPG+  C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct  34   TGSYPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARMRGE----------YP  83

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R G   C YY+KTG CKFG TCKF HP
Sbjct  84   ERIGQPECEYYLKTGTCKFGVTCKFHHP  111


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 41/91 (45%), Gaps = 26/91 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+G  C+++HP      PP   L                          +T   
Sbjct  289  MKTGDCKFGTVCKFHHPRDRQAPPPDCLL--------------------------STIGL  322

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD  472
            P RPG+  C FY + G CKFG  C+FHHP++
Sbjct  323  PLRPGEPLCVFYSRYGICKFGPSCKFHHPME  353


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            +     P R G  +C YY++TG+C+FG+TC+F+HPP  EL+  T+++
Sbjct  32   METGSYPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARM  78



>emb|CDY53749.1| BnaAnng12770D [Brassica napus]
Length=374

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 86/167 (51%), Gaps = 41/167 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR  +                          T  M G     
Sbjct  51   IRTGLCRFGSTCRFNHPRDRELV------------------------IATARMRG----E  82

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G      L++ G P R  
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRVSLNMLGYPLRSN  134

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
             + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  135  EVDCAYFLRTGHCKFGATCKFNHPQPQP----TTNLMVPTSGQQQSY  177


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 97/232 (42%), Gaps = 55/232 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPD-----------------------RYTINP---------PAAH  661
            L+TG CK+GATC++NHP                         +  +P         P   
Sbjct  142  LRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASPRWQDPSGFTPLMM  201

Query  660  LNVGVVNPTASLFQTFDP-----------RLTQTMFGFAT----TIYPQRPGQVECDFYM  526
                V NP +    +  P            + Q   G +      ++P+RPGQ EC FYM
Sbjct  202  PQGVVWNPYSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENVFPERPGQPECQFYM  261

Query  525  KTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICK  346
            KTG+CKFG  C+FHHP D        +        LS  GLP R G   C +Y + GICK
Sbjct  262  KTGDCKFGTVCKFHHPRDRQPPSPDCL--------LSPIGLPLRPGEPVCVFYSRYGICK  313

Query  345  FGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TFCSVQ  190
            FG +CKF+HP        T+  T   V    G ++ V   + +Q  T  S Q
Sbjct  314  FGPSCKFNHPMEVFAYDNTASETDEVVETSRGDSRRVSVSETRQATTTTSGQ  365


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP  400
            T  YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct  35   TGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE----------YP  84

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R G   C YY+KTG CKFG TCKF HP
Sbjct  85   ERIGQPECEYYLKTGTCKFGVTCKFHHP  112


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (50%), Gaps = 27/115 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP              G+             R++  M G     Y
Sbjct  96   LKTGTCKFGVTCKFHHPRN----------KAGIAG-----------RVSLNMLG-----Y  129

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGL  403
            P R  +V+C ++++TG CKFG  C+F+HP    + ++     G+QQ++  S A  
Sbjct  130  PLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASF  184


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            +     P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+++
Sbjct  33   METGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  79



>ref|XP_004967812.1| PREDICTED: zinc finger CCCH domain-containing protein 5-like 
isoform X1 [Setaria italica]
Length=450

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 72/144 (50%), Gaps = 34/144 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TGSC YG  CRYNHP DR    P      V  V  TA                  T  
Sbjct  51   IRTGSCGYGERCRYNHPRDRDRAAP------VNGVGRTA-----------------GTVE  87

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPGQ  C++Y K G CKFG  C+F HP           EG      L+ +G P R+G
Sbjct  88   YPERPGQPLCEYYAKNGTCKFGSNCKFDHP----------REGGFVPVALNSSGFPIRQG  137

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YYMKTG CKFGATCKF HP
Sbjct  138  EKECSYYMKTGHCKFGATCKFHHP  161


 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 8/83 (10%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPGQ EC+ YMKTG CK+G  C++HHP   S        G + N  LS  GLP R G+
Sbjct  287  PERPGQPECEHYMKTGTCKYGAACKYHHPQYFS--------GPKSNCVLSPLGLPLRPGS  338

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C YY   G CKFG TCKFDHP
Sbjct  339  QPCSYYAHHGFCKFGPTCKFDHP  361


 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+V+C +Y++TG C +GERCR++HP D   +   +  G            P R G 
Sbjct  39   PERPGEVDCAYYIRTGSCGYGERCRYNHPRDRDRAAPVNGVGRTAG----TVEYPERPGQ  94

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C YY K G CKFG+ CKFDHP
Sbjct  95   PLCEYYAKNGTCKFGSNCKFDHP  117


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (45%), Gaps = 29/118 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG+CKYGA C+Y+HP  ++        +  V++P                        
Sbjct  299  MKTGTCKYGAACKYHHPQYFS-----GPKSNCVLSPLG---------------------L  332

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHP---LDHSLSVTSSMEGEQQNFKLSLAGLP  400
            P RPG   C +Y   G CKFG  C+F HP   L++S SV+S  +     +  SL   P
Sbjct  333  PLRPGSQPCSYYAHHGFCKFGPTCKFDHPMGTLNYSPSVSSLTDVPVAPYPPSLPLTP  390



>emb|CDY67901.1| BnaCnng56860D [Brassica napus]
Length=374

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 86/167 (51%), Gaps = 41/167 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR  +                          T  M G     
Sbjct  51   IRTGLCRFGSTCRFNHPRDRELV------------------------IATARMRG----E  82

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G      L++ G P R  
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRVSLNMLGYPLRSN  134

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
             + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  135  EVDCAYFLRTGHCKFGATCKFNHPQPQP----TTNLMVPTSGQQQSY  177


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 97/232 (42%), Gaps = 55/232 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPD-----------------------RYTINP---------PAAH  661
            L+TG CK+GATC++NHP                         +  +P         P   
Sbjct  142  LRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASFIASPRWQDPSGFTPLMM  201

Query  660  LNVGVVNPTASLFQTFDP-----------RLTQTMFGFAT----TIYPQRPGQVECDFYM  526
                V NP +    +  P            + Q   G +      ++P+RPGQ EC FYM
Sbjct  202  PQGVVWNPYSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSENVFPERPGQPECQFYM  261

Query  525  KTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICK  346
            KTG+CKFG  C+FHHP D        +        LS  GLP R G   C +Y + GICK
Sbjct  262  KTGDCKFGTVCKFHHPRDRQPPSPDCL--------LSPIGLPLRPGEPVCVFYSRYGICK  313

Query  345  FGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TFCSVQ  190
            FG +CKF+HP        T+  T   V    G ++ V   + +Q  T  S Q
Sbjct  314  FGPSCKFNHPMEIFAYDNTASETDEVVETSRGDSRRVSVSETRQATTTTSGQ  365


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP  400
            T  YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct  35   TGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE----------YP  84

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R G   C YY+KTG CKFG TCKF HP
Sbjct  85   ERIGQPECEYYLKTGTCKFGVTCKFHHP  112


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (50%), Gaps = 27/115 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP              G+             R++  M G     Y
Sbjct  96   LKTGTCKFGVTCKFHHPRN----------KAGIAG-----------RVSLNMLG-----Y  129

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGL  403
            P R  +V+C ++++TG CKFG  C+F+HP    + ++     G+QQ++  S A  
Sbjct  130  PLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASF  184


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            +     P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+++
Sbjct  33   METGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  79



>emb|CDM82689.1| unnamed protein product [Triticum aestivum]
Length=467

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 76/144 (53%), Gaps = 35/144 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG+C YG TCRYNHP DR      AA  + G                T+T     T  
Sbjct  61   LRTGACGYGETCRYNHPRDR------AAAFDGG----------------TRTA---RTVE  95

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPGQ  C++YMK G CKFG  C+++HP +          G  Q   L+  G P R G
Sbjct  96   YPERPGQPPCEYYMKNGTCKFGSNCKYNHPRE---------GGSVQPVVLNSCGYPLRLG  146

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C YY+KTG CKFG+TCKF HP
Sbjct  147  EKECSYYIKTGHCKFGSTCKFHHP  170


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC  YMKTG CKFG  C+++HP          +   + N+ LS  GLP R
Sbjct  295  VVFPERPGQPECHHYMKTGTCKFGSTCKYNHP--------QYLSTPRSNYMLSPLGLPIR  346

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             GA  C YY + G CKFG  CKFDHP
Sbjct  347  PGAQPCLYYSQHGFCKFGPGCKFDHP  372


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+  C +Y++TG C +GE CR++HP D +    ++ +G  +  +      P R G 
Sbjct  49   PERPGEANCVYYLRTGACGYGETCRYNHPRDRA----AAFDGGTRTAR--TVEYPERPGQ  102

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
              C YYMK G CKFG+ CK++HP
Sbjct  103  PPCEYYMKNGTCKFGSNCKYNHP  125



>ref|XP_002278934.2| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Vitis vinifera]
Length=441

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TCR+NHP       P   L +                 T  M G     +
Sbjct  58   IRTGLCRFGITCRFNHP-------PNRKLAIA----------------TARMKG----EF  90

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  91   PERMGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNILGYPLRPDE  142

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            I C YY++TG CKFG+TCKF HP P  ++
Sbjct  143  IDCAYYLRTGQCKFGSTCKFHHPQPSSMM  171


 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  295  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPDCV--------LSPIGLPLR  346

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  347  PGEPLCIFYSRYGICKFGPSCKFDHP  372


 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  45   YPERPGEPDCSYYIRTGLCRFGITCRFNHPPNRKLAIATARMKGE----------FPERM  94

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  95   GQPECQYYLKTGTCKFGATCKFHHP  119


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++  + G     Y
Sbjct  103  LKTGTCKFGATCKFHHP----------RDKAGIAG-----------RVSLNILG-----Y  136

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP +++C +Y++TG+CKFG  C+FHHP   S+ V+
Sbjct  137  PLRPDEIDCAYYLRTGQCKFGSTCKFHHPQPSSMMVS  173



>ref|XP_009417930.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=467

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC F+MKTG+CKFG +C++HHP    + +T        N  L++ GLP R
Sbjct  286  NIFPERPGQPECQFFMKTGDCKFGAKCKYHHPPGRRMPMT--------NVVLNVLGLPLR  337

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             GA  C YYM+ G+CKFG TCKFDHP
Sbjct  338  PGAQPCTYYMQHGLCKFGQTCKFDHP  363


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 71/147 (48%), Gaps = 36/147 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG+C YG  CRYNHP DR ++         G V                         
Sbjct  51   MRTGTCSYGEKCRYNHPRDRGSLT---GAGRTGAVE------------------------  83

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C++YM+TG CKFG  C++ HP            G  Q   L+  G P R G
Sbjct  84   YPERVGQPVCEYYMRTGSCKFGSSCKYDHPRQGG--------GSAQPVSLNYYGYPLRPG  135

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPG  307
               C YYMKTG CKFG+TCKF HP PG
Sbjct  136  EKECGYYMKTGQCKFGSTCKFHHPQPG  162


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 66/118 (56%), Gaps = 16/118 (14%)
 Frame = -2

Query  612  DPRLTQTMF-----GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS  448
            D  L ++M+     G     YP+RPG+ +C +YM+TG C +GE+CR++HP D      + 
Sbjct  18   DTGLEESMWRLGFGGGGDAHYPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAG  77

Query  447  MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS  274
              G  +         P R G   C YYM+TG CKFG++CK+DHP  G   GG++Q  S
Sbjct  78   RTGAVE--------YPERVGQPVCEYYMRTGSCKFGSSCKYDHPRQG---GGSAQPVS  124


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 26/99 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TGSCK+G++C+Y+HP +            G   P           ++   +G     Y
Sbjct  97   MRTGSCKFGSSCKYDHPRQ----------GGGSAQP-----------VSLNYYG-----Y  130

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS  448
            P RPG+ EC +YMKTG+CKFG  C+FHHP     SV S+
Sbjct  131  PLRPGEKECGYYMKTGQCKFGSTCKFHHPQPGGASVPSA  169


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 39/90 (43%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+Y+HP                             R+  T         
Sbjct  301  MKTGDCKFGAKCKYHHPPGR--------------------------RMPMTNVVLNVLGL  334

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG   C +YM+ G CKFG+ C+F HP+
Sbjct  335  PLRPGAQPCTYYMQHGLCKFGQTCKFDHPV  364



>gb|KJB26823.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=449

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  70   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  102

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP + +        G      L++ G P R   
Sbjct  103  PERVGQPECQYYLKTGTCKFGATCKFHHPREQA--------GIAGRVSLNILGYPFRPNE  154

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P  ++
Sbjct  155  TECAYYLRTGQCKFGSTCKFHHPQPTNMM  183


 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +        +        LS  GLP R
Sbjct  304  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVPPAPDCL--------LSPIGLPLR  355

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKF+HP
Sbjct  356  PGEPLCDFYSRYGICKFGPSCKFNHP  381


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = -2

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQ  430
            R ++TM    +  YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE  
Sbjct  47   RSSETM---ESGYYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE--  101

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                     P R G   C YY+KTG CKFGATCKF HP
Sbjct  102  --------FPERVGQPECQYYLKTGTCKFGATCKFHHP  131


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++  + G     Y
Sbjct  115  LKTGTCKFGATCKFHHPRE----------QAGIAG-----------RVSLNILG-----Y  148

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ ++
Sbjct  149  PFRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMIS  185


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 43/90 (48%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP      PPA                   P    +  G      
Sbjct  319  MKTGDCKFGAVCRFHHPRERV--PPA-------------------PDCLLSPIGL-----  352

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  CDFY + G CKFG  C+F+HP+
Sbjct  353  PLRPGEPLCDFYSRYGICKFGPSCKFNHPM  382



>ref|XP_011100472.1| PREDICTED: zinc finger CCCH domain-containing protein 3 isoform 
X2 [Sesamum indicum]
Length=411

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 72/145 (50%), Gaps = 27/145 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG+C YG+ CR+NHP        A     GV N                     T+  
Sbjct  30   LRTGTCGYGSNCRFNHPSN------AGGQVHGVKN---------------------TSEL  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C FY+KTG CK+G  C++HHP D                 L++ GLP R+  
Sbjct  63   PERAGKPDCGFYLKTGTCKYGSTCKYHHPKDRQGDNRPKDSKPDSLILLNILGLPMRQDG  122

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
              CPYYM+TG+CK+G  CKF HP P
Sbjct  123  KACPYYMQTGLCKYGYACKFHHPQP  147


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 80/198 (40%), Gaps = 63/198 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------------INPPAAHLNVGVVN----PTA  631
            ++TG CKYG  C+++HP   +                  + P +   +VG +     P A
Sbjct  129  MQTGLCKYGYACKFHHPQPTSAANVLPVVGPVYGSGASAVAPSSGAPSVGEIPAPTLPKA  188

Query  630  SLF--------QTFDPRLTQTMFGFAT-------------------------TIYPQRPG  550
            + F        Q++ P +     G+ T                            PQRP 
Sbjct  189  TYFSSSLLHVPQSYMPIILSPSQGWNTYTGSVSPLSVTSVLTAPASDGQLPVPYLPQRPD  248

Query  549  QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY  370
            Q EC +YM  G CK+G  C+FHHP+     +  S         L   GLP R G   C Y
Sbjct  249  QPECQYYMNHGSCKYGSNCKFHHPIKKITQLPPS--------SLGPLGLPLRPGLPVCSY  300

Query  369  YMKTGICKFGATCKFDHP  316
            Y   G+CK+G TCKFDHP
Sbjct  301  YSLYGLCKYGPTCKFDHP  318


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            ++P RPG+ +C +Y++TG C +G  CRF+HP         S  G Q +   + + LP R 
Sbjct  16   LFPDRPGEPDCLYYLRTGTCGYGSNCRFNHP---------SNAGGQVHGVKNTSELPERA  66

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C +Y+KTG CK+G+TCK+ HP
Sbjct  67   GKPDCGFYLKTGTCKYGSTCKYHHP  91



>ref|XP_006294141.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27039.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=471

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 73/146 (50%), Gaps = 37/146 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C YG  CRYNHP DR                  AS+  T            AT  
Sbjct  57   MRTGVCGYGNRCRYNHPRDR------------------ASVEATVR----------ATGQ  88

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R G+  C FY+KTG CKFG  C+FHHP +          G   +  L++ G P REG
Sbjct  89   YPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAG--------GSMSHVPLNIYGYPVREG  140

Query  387  AIHCPYYMKTGICKFGATCKFDHPPP  310
               C YY+KTG CKFG TCKF HP P
Sbjct  141  ENECSYYLKTGQCKFGITCKFHHPQP  166


 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPG+ EC +Y+KTG+CKFG  C+FHHP D            + N  LS  GLP R G
Sbjct  288  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVP--------PRANCILSPIGLPLRPG  339

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +Y++ G CKFG+TCKFDHP
Sbjct  340  VQRCTFYVQNGFCKFGSTCKFDHP  363


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 13/128 (10%)
 Frame = -2

Query  693  DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMF--GFATTIYPQRPGQVECDFYMKT  520
            D Y  NPP       +      +    D  L ++M+  G  +  YP+RPG  +C +YM+T
Sbjct  2    DLYARNPPINGSQSALA--PDWIPADADTGLEESMWRLGLGSETYPERPGAPDCAYYMRT  59

Query  519  GECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFG  340
            G C +G RCR++HP D + SV +++    Q         P R G   C +Y+KTG CKFG
Sbjct  60   GVCGYGNRCRYNHPRDRA-SVEATVRATGQ--------YPERIGEPPCQFYLKTGTCKFG  110

Query  339  ATCKFDHP  316
            A+CKF HP
Sbjct  111  ASCKFHHP  118


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 28/93 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG CK+G +C+++HP DR    PP A+    +++P                       
Sbjct  301  LKTGDCKFGTSCKFHHPRDRV---PPRANC---ILSPIG---------------------  333

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDH  469
             P RPG   C FY++ G CKFG  C+F HP+ +
Sbjct  334  LPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGN  366



>emb|CDX74233.1| BnaA03g28140D [Brassica napus]
Length=365

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 87/167 (52%), Gaps = 41/167 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G+TCR+NHP DR  +                          T  M G     
Sbjct  36   IRTGLCRFGSTCRFNHPRDRELV------------------------IATARMRG----E  67

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G   +  L++ G P R  
Sbjct  68   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGSVSLNMLGYPLRSN  119

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
             + C Y+++TG CKFGATCKF+HP P      T+ +   + G+++ Y
Sbjct  120  EVDCAYFLRTGHCKFGATCKFNHPQPQP----TTNLMVPTSGQQQSY  162


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 56/94 (60%), Gaps = 11/94 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P R 
Sbjct  23   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE----------YPERI  72

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
            G   C YY+KTG CKFG TCKF HP     I G+
Sbjct  73   GQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGS  106


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 65/122 (53%), Gaps = 8/122 (7%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            + +++P+RPGQ EC FYMKTG+CKFG  C+FHHP D        +        LS  GLP
Sbjct  236  SESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCL--------LSPIGLP  287

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQK  220
             R G   C +Y +  ICKFG +CKF HP        T+  T   +    G+++ +   + 
Sbjct  288  LRPGEPLCVFYSRYRICKFGPSCKFHHPMGVFTYDNTASETDEVMKTTTGHSRRLSVSET  347

Query  219  QQ  214
            +Q
Sbjct  348  RQ  349


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (50%), Gaps = 27/115 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP            N   +  + SL           M G     Y
Sbjct  81   LKTGTCKFGVTCKFHHPR-----------NKAGIAGSVSL----------NMLG-----Y  114

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGL  403
            P R  +V+C ++++TG CKFG  C+F+HP    + ++     G+QQ++  S A  
Sbjct  115  PLRSNEVDCAYFLRTGHCKFGATCKFNHPQPQPTTNLMVPTSGQQQSYPWSRASF  169


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 41/91 (45%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G  C+++HP DR T  P      +G+                          
Sbjct  253  MKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGL--------------------------  286

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG+  C FY +   CKFG  C+FHHP+
Sbjct  287  -PLRPGEPLCVFYSRYRICKFGPSCKFHHPM  316



>ref|XP_010913061.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=381

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP    +   AA +  G                           Y
Sbjct  60   IRTGLCRFGMTCKFNHPPNRKMAIAAARIKGG---------------------------Y  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G     +L++ G P R   
Sbjct  93   PERVGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVQLNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P   +
Sbjct  145  KECAYYLRTGQCKFGNTCKFHHPQPSNAM  173


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 11/98 (11%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  C+F+HP +  +++ ++ ++G          G P R 
Sbjct  47   YPKRPGEPDCAYYIRTGLCRFGMTCKFNHPPNRKMAIAAARIKG----------GYPERV  96

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
            G   C YY+KTG CKFGATCKF HP     I G  Q+ 
Sbjct  97   GQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLN  134


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 8/60 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P RP Q EC FYMKTG+CKFG  CRFHHP +  + V   +        LS  GLP R
Sbjct  297  NIFPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMPVPDCV--------LSPLGLPLR  348



>tpg|DAA54001.1| TPA: hypothetical protein ZEAMMB73_676626 [Zea mays]
Length=269

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 73/149 (49%), Gaps = 34/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG+C +G  CRYNHP DR            G  N  A  F                  
Sbjct  71   LRTGACGFGERCRYNHPRDR-----GGTEFGGGAKNGAAQYF------------------  107

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
             P+R GQ  C++Y+KTG CKFG  C++HHP           +G  Q+  L+  G P R G
Sbjct  108  -PERQGQPVCEYYLKTGTCKFGSNCKYHHP---------KQDGSVQSVILNNNGFPLRPG  157

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGEL  301
               C YYMKTG CKFG+TCKF HP  G +
Sbjct  158  EKECSYYMKTGQCKFGSTCKFHHPEFGGI  186


 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 9/90 (10%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV--TSSMEGEQQNFKLSLAG  406
            A T  P+RPG+ +C +Y++TG C FGERCR++HP D   +     +  G  Q F      
Sbjct  54   ADTWLPERPGEADCGYYLRTGACGFGERCRYNHPRDRGGTEFGGGAKNGAAQYF------  107

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             P R+G   C YY+KTG CKFG+ CK+ HP
Sbjct  108  -PERQGQPVCEYYLKTGTCKFGSNCKYHHP  136


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 50/99 (51%), Gaps = 27/99 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G+ C+Y+HP +         +   ++N                        +
Sbjct  120  LKTGTCKFGSNCKYHHPKQ------DGSVQSVILNNNG---------------------F  152

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS  448
            P RPG+ EC +YMKTG+CKFG  C+FHHP    + VT S
Sbjct  153  PLRPGEKECSYYMKTGQCKFGSTCKFHHPEFGGIPVTRS  191



>ref|XP_009392477.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392478.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392479.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392480.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP    +   AA +  G                           Y
Sbjct  30   IRTGLCRFGMTCKFNHPQNRMLAIAAARIRGG---------------------------Y  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP + +        G  +  +L++ G P R   
Sbjct  63   PERVGQPECQYYLKTGTCKFGSTCKFHHPKEKA--------GIAKQAQLNILGYPLRPNE  114

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCK+ HP P   I
Sbjct  115  QECAYYIRTGECKFGSTCKYHHPQPSNTI  143


 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +           N  L+  GLP R
Sbjct  265  NIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTP--------NCVLNPLGLPLR  316

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  317  PGEPLCVFYSRYGICKFGPNCKFDHP  342


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 9/97 (9%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP RPG+ +C +Y++TG C+FG  C+F+HP +  L++ ++             G P R G
Sbjct  17   YPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAAR---------IRGGYPERVG  67

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
               C YY+KTG CKFG+TCKF HP     I   +Q+ 
Sbjct  68   QPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLN  104



>ref|XP_009337999.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Pyrus x bretschneideri]
Length=443

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 76/150 (51%), Gaps = 36/150 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR-EG  388
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R + 
Sbjct  93   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GMAGRVALNILGYPLRPQN  144

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELI  298
             + C YY++TG CKFG+TCKF HP P  ++
Sbjct  145  EVECAYYLRTGQCKFGSTCKFHHPQPTNMM  174


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  298  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAPDCV--------LSPMGLPLR  349

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKF+HP
Sbjct  350  PGEPLCIFYSRYGICKFGPSCKFNHP  375


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 14/108 (13%)
 Frame = -2

Query  636  TASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            T       + R ++TM   A   YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++
Sbjct  27   TQDAMWQMNLRSSETMEAGA---YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAI  83

Query  456  TSS-MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             ++ M+GE           P R G   C YY+KTG CKFGATCKF HP
Sbjct  84   AAARMKGE----------FPERIGQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 7/71 (10%)
 Frame = -2

Query  492  RFHHPLDHSLSVTSSMEGE---QQNFK----LSLAGLPRREGAIHCPYYMKTGICKFGAT  334
            R   P+  + S++ S+  +   Q N +    +     P R G   C YY++TG+C+FGAT
Sbjct  11   RAAAPVTDARSLSPSLTQDAMWQMNLRSSETMEAGAYPERTGEPDCSYYIRTGLCRFGAT  70

Query  333  CKFDHPPPGEL  301
            C+F+HPP  +L
Sbjct  71   CRFNHPPNRKL  81



>ref|XP_004250094.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum lycopersicum]
Length=433

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  56   IRTGLCRFGSTCRFNHP-------PNRKLAIA----------------TARMKG----EY  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +++KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  89   PERIGQPECQYFLKTGTCKFGATCKFHHPKDKA--------GIAGRVTLNVMGYPLRPNE  140

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYM+TG CKFG+TCKF HP P  ++
Sbjct  141  SECAYYMRTGQCKFGSTCKFHHPQPSNMM  169


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R
Sbjct  287  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCL--------LSPIGLPLR  338

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  339  PGEPLCIFYSRYGICKFGPSCKFDHP  364


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 11/93 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKGE----------YPERI  92

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            G   C Y++KTG CKFGATCKF HP     I G
Sbjct  93   GQPECQYFLKTGTCKFGATCKFHHPKDKAGIAG  125


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T  + G     Y
Sbjct  101  LKTGTCKFGATCKFHHPKD----------KAGIAG-----------RVTLNVMG-----Y  134

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +YM+TG+CKFG  C+FHHP   ++ V+
Sbjct  135  PLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  171


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 31/105 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    I PP   L+ +G+                          
Sbjct  302  MKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGL--------------------------  335

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL---DHSLSVTSSME  442
             P RPG+  C FY + G CKFG  C+F HP+    +S++ +S+ +
Sbjct  336  -PLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSIAASSATD  379


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P REG   C YY++TG+C+FG+TC+F+HPP  +L   T+++
Sbjct  44   PVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84



>ref|XP_011100471.1| PREDICTED: zinc finger CCCH domain-containing protein 3 isoform 
X1 [Sesamum indicum]
Length=443

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 72/145 (50%), Gaps = 27/145 (19%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG+C YG+ CR+NHP        A     GV N                     T+  
Sbjct  62   LRTGTCGYGSNCRFNHPSN------AGGQVHGVKN---------------------TSEL  94

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R G+ +C FY+KTG CK+G  C++HHP D                 L++ GLP R+  
Sbjct  95   PERAGKPDCGFYLKTGTCKYGSTCKYHHPKDRQGDNRPKDSKPDSLILLNILGLPMRQDG  154

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
              CPYYM+TG+CK+G  CKF HP P
Sbjct  155  KACPYYMQTGLCKYGYACKFHHPQP  179


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 80/198 (40%), Gaps = 63/198 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYT------------------INPPAAHLNVGVVN----PTA  631
            ++TG CKYG  C+++HP   +                  + P +   +VG +     P A
Sbjct  161  MQTGLCKYGYACKFHHPQPTSAANVLPVVGPVYGSGASAVAPSSGAPSVGEIPAPTLPKA  220

Query  630  SLF--------QTFDPRLTQTMFGFAT-------------------------TIYPQRPG  550
            + F        Q++ P +     G+ T                            PQRP 
Sbjct  221  TYFSSSLLHVPQSYMPIILSPSQGWNTYTGSVSPLSVTSVLTAPASDGQLPVPYLPQRPD  280

Query  549  QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY  370
            Q EC +YM  G CK+G  C+FHHP+     +  S         L   GLP R G   C Y
Sbjct  281  QPECQYYMNHGSCKYGSNCKFHHPIKKITQLPPS--------SLGPLGLPLRPGLPVCSY  332

Query  369  YMKTGICKFGATCKFDHP  316
            Y   G+CK+G TCKFDHP
Sbjct  333  YSLYGLCKYGPTCKFDHP  350


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            ++P RPG+ +C +Y++TG C +G  CRF+HP         S  G Q +   + + LP R 
Sbjct  48   LFPDRPGEPDCLYYLRTGTCGYGSNCRFNHP---------SNAGGQVHGVKNTSELPERA  98

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C +Y+KTG CK+G+TCK+ HP
Sbjct  99   GKPDCGFYLKTGTCKYGSTCKYHHP  123



>ref|XP_011014371.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=445

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TCR+NHP    +   AA +                              +
Sbjct  63   IRTGLCRFGPTCRFNHPPNRKLAIAAARMK---------------------------GEF  95

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  96   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GVSGRVSLNILGYPLRLNE  147

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF HP P  ++
Sbjct  148  MECAYYLRTGQCKFGSTCKFHHPQPTNVM  176


 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 60/106 (57%), Gaps = 13/106 (12%)
 Frame = -2

Query  618  TFDP-RLTQTMFGFAT----TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            TF P R      GF      +++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +   
Sbjct  280  TFSPYRSDSVPMGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAP  339

Query  453  SSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              +        LS  GLP R G   C +Y + GICKFG +CKF HP
Sbjct  340  DCV--------LSAIGLPLRPGEPLCIFYSRYGICKFGPSCKFHHP  377


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKGE----------FPERI  99

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  100  GQPECQYYLKTGTCKFGATCKFHHP  124


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 55/117 (47%), Gaps = 31/117 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    I  P   L+ +G+                          
Sbjct  315  MKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGL--------------------------  348

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLD---HSLSVTSSMEGEQQNFKLSLAG  406
             P RPG+  C FY + G CKFG  C+FHHP+    ++L+ +SS +   +    S +G
Sbjct  349  -PLRPGEPLCIFYSRYGICKFGPSCKFHHPMGIFTYNLTASSSADAPVRRLLGSSSG  404



>ref|XP_006353234.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum tuberosum]
Length=433

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G+TCR+NHP       P   L +                 T  M G     Y
Sbjct  56   IRTGLCRFGSTCRFNHP-------PNRKLAIA----------------TARMKG----EY  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +++KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  89   PERIGQPECQYFLKTGTCKFGATCKFHHPKDKA--------GIAGRVTLNVLGYPLRPNE  140

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YYM+TG CKFG+TCKF HP P  ++
Sbjct  141  SECAYYMRTGQCKFGSTCKFHHPQPSNMM  169


 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R 
Sbjct  288  VFPERPGQAECQFYMKTGDCKFGAVCRFHHPRERLIPPPDCL--------LSPIGLPLRT  339

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C +Y + GICKFG +CKFDHP
Sbjct  340  GEPLCIFYSRYGICKFGPSCKFDHP  364


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 11/93 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP R G+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKGE----------YPERI  92

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
            G   C Y++KTG CKFGATCKF HP     I G
Sbjct  93   GQPECQYFLKTGTCKFGATCKFHHPKDKAGIAG  125


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+T  + G     Y
Sbjct  101  LKTGTCKFGATCKFHHPKD----------KAGIAG-----------RVTLNVLG-----Y  134

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +YM+TG+CKFG  C+FHHP   ++ V+
Sbjct  135  PLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  171


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 31/105 (30%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    I PP   L+ +G+                          
Sbjct  302  MKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGL--------------------------  335

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL---DHSLSVTSSME  442
             P R G+  C FY + G CKFG  C+F HP+    +S++ +S+ +
Sbjct  336  -PLRTGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSIAASSTTD  379


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P REG   C YY++TG+C+FG+TC+F+HPP  +L   T+++
Sbjct  44   PVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84



>gb|KJB75169.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=361

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  62   IRTGLCRFGATCRFNHP-------PNRKLAI----------------TTARMKG----EF  94

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L+  G P R   
Sbjct  95   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNFLGYPLRPNE  146

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P  ++
Sbjct  147  TECAYYLRTGQCKFGSTCKFHHPQPTNMM  175


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++T++ M+GE           P R 
Sbjct  49   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMKGE----------FPERV  98

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  99   GQPECQYYLKTGTCKFGATCKFHHP  123


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++    G     Y
Sbjct  107  LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVSLNFLG-----Y  140

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  141  PLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  177


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 8/60 (13%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPG++EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  299  NVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCI--------LSPIGLPLR  350


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 72/180 (40%), Gaps = 39/180 (22%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPD--RYTINPPAAHLNVGVVNPTASLFQTFDPRLT---------  598
            L+TG CK+G+TC+++HP      ++   + +     +PT S  Q+F   LT         
Sbjct  153  LRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYPTFPSPTTSGQQSFLGGLTNWSRASFIP  212

Query  597  ----QTMFGFATTIYPQRPGQVECDFYMKTG----ECKFGERCRFHHPLDHSLSVT----  454
                Q    +A  I PQ  G V    +   G         E  +  +  +     +    
Sbjct  213  SPRWQGPSSYAPLILPQ--GMVSVPSWNAYGGQLASVSSSENLQQTNGNNQIYGTSRPNE  270

Query  453  SSMEGEQQNFKLSLAG--------------LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            S+  G Q  F    +G               P R G + C +YMKTG CKFGA C+F HP
Sbjct  271  SASAGSQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHP  330



>ref|XP_009418525.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=338

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 84/166 (51%), Gaps = 40/166 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C +G+ C+YNHP             +GV N               T F   +   
Sbjct  57   LRTGKCGFGSKCKYNHP------------ALGVQN---------------TQF---SGEL  86

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            PQR GQ +C F++KTG CK+G  C++HHP D         + E    +L++ GLP R+  
Sbjct  87   PQRDGQPDCQFFLKTGSCKYGITCKYHHPRD---------KHEIHMVQLNVLGLPIRKDE  137

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGY  247
              C YYMKTG CK+G  CKF+HP P    G +  VT +SV +  GY
Sbjct  138  KPCAYYMKTGSCKYGVACKFNHPQPASR-GSSFPVTGSSVYDYSGY  182


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -2

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            P+RP Q EC FYMKTG CK+G  C++HHP + +    +++
Sbjct  272  PERPDQPECQFYMKTGNCKYGSSCKYHHPKERNQPAMATI  311



>ref|XP_003536159.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Glycine max]
Length=421

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP            N  +   TA +   F                
Sbjct  48   MRTGLCRFGATCRFNHPP-----------NRKLAIATARMIGEF----------------  80

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  81   PERIGQPECQYYLKTGTCKFGATCKFHHPKDQA--------GIAGRVALNILGYPLRPNE  132

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  133  PECTYYLRTGQCKFGNTCKFHHPQPSNMM  161


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +           N  LS  GLP R
Sbjct  276  NIFPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAP--------NCVLSPIGLPLR  327

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  328  PGEPLCVFYSRYGICKFGPSCKFDHP  353


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 67/112 (60%), Gaps = 15/112 (13%)
 Frame = -2

Query  648  VVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDH  469
            V NP  SL+   + R  +TM    +  YP+RPG+ +C +YM+TG C+FG  CRF+HP + 
Sbjct  12   VPNPQDSLWM-MNLRTGETM---DSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHPPNR  67

Query  468  SLSV-TSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
             L++ T+ M GE           P R G   C YY+KTG CKFGATCKF HP
Sbjct  68   KLAIATARMIGE----------FPERIGQPECQYYLKTGTCKFGATCKFHHP  109


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 54/115 (47%), Gaps = 39/115 (34%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  93   LKTGTCKFGATCKFHHPKD----------QAGIAG-----------RVALNILG-----Y  126

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            P RP + EC +Y++TG+CKFG  C+FHHP             +  N  LSL G P
Sbjct  127  PLRPNEPECTYYLRTGQCKFGNTCKFHHP-------------QPSNMMLSLRGSP  168


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (47%), Gaps = 29/116 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP    +  P       V++P                        
Sbjct  291  MKTGDCKFGAVCRFHHPQERLVPAPNC-----VLSPIG---------------------L  324

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLD---HSLSVTSSMEGEQQNFKLSLAG  406
            P RPG+  C FY + G CKFG  C+F HP++   H++S + S +   ++   S +G
Sbjct  325  PLRPGEPLCVFYSRYGICKFGPSCKFDHPMEIFSHNISASPSADAPSRHLLGSSSG  380


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P R G   C YYM+TG+C+FGATC+F+HPP  +L   T+++
Sbjct  36   PERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIATARM  76



>ref|XP_010523985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523986.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523988.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523989.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
Length=475

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 73/146 (50%), Gaps = 37/146 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C YG+ CRYNHP DR  +               A++  T D              
Sbjct  58   MRTGICGYGSRCRYNHPRDRAMVE--------------AAVRATGD--------------  89

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R G+  C FY+KTG CKFG  C+FHHP +          G      L++ G P REG
Sbjct  90   YPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAG--------GSMSQVPLNIHGYPLREG  141

Query  387  AIHCPYYMKTGICKFGATCKFDHPPP  310
               C +Y+KTG CKFG TCKF HP P
Sbjct  142  EKECSHYLKTGQCKFGVTCKFHHPQP  167


 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 8/85 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            I+P+RPG+ EC +Y++TG+CKFG  C+FHHP D            + N  LS  GLP R 
Sbjct  290  IFPERPGEPECQYYLRTGDCKFGLSCKFHHPRDRVP--------PRANCILSPIGLPLRP  341

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C +Y++ G C+FG+TCKFDHP
Sbjct  342  GVQPCTFYLQNGFCRFGSTCKFDHP  366


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 12/99 (12%)
 Frame = -2

Query  603  LTQTMFGFA---TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ  433
            L ++M+      +  YP+RPG  +C +YM+TG C +G RCR++HP D ++ V +++    
Sbjct  30   LEESMWRLGLSNSETYPERPGVPDCAYYMRTGICGYGSRCRYNHPRDRAM-VEAAVR---  85

Query  432  QNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                 +    P R G   C +Y+KTG CKFGA+CKF HP
Sbjct  86   -----ATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHP  119


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 45/91 (49%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG CK+G +C+++HP DR    PP A+    +++P                       
Sbjct  304  LRTGDCKFGLSCKFHHPRDRV---PPRANC---ILSPIG---------------------  336

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG   C FY++ G C+FG  C+F HP+
Sbjct  337  LPLRPGVQPCTFYLQNGFCRFGSTCKFDHPM  367



>ref|XP_010270055.1| PREDICTED: zinc finger CCCH domain-containing protein 57 isoform 
X3 [Nelumbo nucifera]
Length=345

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 87/162 (54%), Gaps = 27/162 (17%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYT-----INPPAAHLNVGVVNPTAS-------LFQTFDPR  604
            LKTG+CK+GATC+Y+HP DR+      +N     +  G ++P +S       +     P+
Sbjct  104  LKTGTCKFGATCKYHHPRDRHDTAHVLLNILGLPMRQGTLSPISSTSVLGSNIAYNSKPQ  163

Query  603  LTQTMFG----FATTI--YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME  442
                  G     +T++  +P+RP Q EC +YMKTG CKFG  C++HHP +    + +S  
Sbjct  164  GESGSSGQVQLLSTSVPHFPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTL  223

Query  441  GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            G          GLP R G   C +Y   GICK+G TCK+DHP
Sbjct  224  GP--------LGLPLRPGQAVCTFYTLYGICKYGPTCKYDHP  257


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 59/115 (51%), Gaps = 13/115 (11%)
 Frame = -2

Query  657  NVGVVNPTASLFQ-TFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH  481
            N    N   S+++    P   Q      ++ YP RPG+ +C +Y++TG C +G  CRF+H
Sbjct  18   NASADNLEDSMWRLKIQPHDNQEGVAANSSPYPDRPGEPDCIYYLRTGLCGYGSNCRFNH  77

Query  480  PLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            P     +V     GE          LP R G   C Y++KTG CKFGATCK+ HP
Sbjct  78   PAYAGRAV--QYRGE----------LPERVGQPDCQYFLKTGTCKFGATCKYHHP  120


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 70/180 (39%), Gaps = 67/180 (37%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C YG+ CR+NHP                          +  R  Q          
Sbjct  62   LRTGLCGYGSNCRFNHP-------------------------AYAGRAVQYRGEL-----  91

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDH------------------SLSVTSSM--  445
            P+R GQ +C +++KTG CKFG  C++HHP D                   +LS  SS   
Sbjct  92   PERVGQPDCQYFLKTGTCKFGATCKYHHPRDRHDTAHVLLNILGLPMRQGTLSPISSTSV  151

Query  444  -----------------EGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                              G+ Q    S+   P R     C YYMKTG CKFG TCK+ HP
Sbjct  152  LGSNIAYNSKPQGESGSSGQVQLLSTSVPHFPERPDQPECQYYMKTGSCKFGPTCKYHHP  211



>ref|XP_002325901.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF00283.2| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TCR+NHP    +   AA +                              +
Sbjct  63   IRTGLCRFGPTCRFNHPPNRKLAIAAARMK---------------------------GEF  95

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  96   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GVSGRVSLNILGYPLRLNE  147

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YY++TG CKFG+TCKF HP P  ++
Sbjct  148  MECAYYLRTGQCKFGSTCKFHHPQPTNVM  176


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 60/106 (57%), Gaps = 13/106 (12%)
 Frame = -2

Query  618  TFDP-RLTQTMFGFAT----TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            TF P R      GF      +++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  +   
Sbjct  280  TFSPYRSDSVPMGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPAP  339

Query  453  SSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              +        LS  GLP R G   C +Y + GICKFG +CKF HP
Sbjct  340  DCV--------LSAIGLPLRPGEPLCIFYSRYGICKFGPSCKFHHP  377


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKGE----------FPERI  99

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  100  GQPECQYYLKTGTCKFGATCKFHHP  124


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 55/117 (47%), Gaps = 31/117 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA CR++HP    I  P   L+ +G+                          
Sbjct  315  MKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGL--------------------------  348

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLD---HSLSVTSSMEGEQQNFKLSLAG  406
             P RPG+  C FY + G CKFG  C+FHHP+    ++L+ +SS +   +    S +G
Sbjct  349  -PLRPGEPLCIFYSRYGICKFGPSCKFHHPMGIFTYNLTASSSADAPVRRLLGSSSG  404



>ref|XP_009406323.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP    +   A  +  G                           Y
Sbjct  30   IRTGLCRFGMTCKFNHPPNRMLAVAATSIRGG---------------------------Y  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP + +        G  +  +L++ G P R   
Sbjct  63   PERVGQPECQYYLKTGTCKFGATCKFHHPREKA--------GISEQVQLNILGYPLRPNE  114

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P   +
Sbjct  115  KECAYYLRTGECKFGSTCKFHHPQPSNAV  143


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RPGQ EC FYMKTG+CKFG  C+FHHP +  + V         N  LS  GLP R
Sbjct  265  NIFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP--------NCVLSPLGLPLR  316

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CK+DHP
Sbjct  317  PGEPLCDFYSRYGICKFGPNCKYDHP  342


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 62/103 (60%), Gaps = 13/103 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS-SMEGEQQNFKLSLAGLPRRE  391
            YP+RPG+ +C +Y++TG C+FG  C+F+HP +  L+V + S+ G          G P R 
Sbjct  17   YPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRMLAVAATSIRG----------GYPERV  66

Query  390  GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG  262
            G   C YY+KTG CKFGATCKF H  P E  G + QV    +G
Sbjct  67   GQPECQYYLKTGTCKFGATCKFHH--PREKAGISEQVQLNILG  107


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 48/104 (46%), Gaps = 29/104 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA C+++HP    +  P       V++P                        
Sbjct  280  MKTGDCKFGAVCKFHHPRERLVPVPNC-----VLSPLG---------------------L  313

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL---DHSLSVTSSME  442
            P RPG+  CDFY + G CKFG  C++ HP+    + LS +S  E
Sbjct  314  PLRPGEPLCDFYSRYGICKFGPNCKYDHPIRTYTYGLSASSMAE  357



>ref|XP_010921758.1| PREDICTED: zinc finger CCCH domain-containing protein 6 [Elaeis 
guineensis]
Length=466

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 56/84 (67%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPGQ EC FYM+TG+CKFG  CR+HHP D S+  T        N  LS  GLP R G
Sbjct  288  FPERPGQPECQFYMRTGDCKFGSTCRYHHPRDWSMPKT--------NCALSPLGLPLRPG  339

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
            A  C YY + G+CKFG TCKFDHP
Sbjct  340  AQPCAYYAQHGVCKFGPTCKFDHP  363


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 73/147 (50%), Gaps = 36/147 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TGSC YG  CRYNHP DR       A    G                       A   
Sbjct  52   MRTGSCGYGERCRYNHPRDR------GARSGAGRT---------------------AAGE  84

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C++YM+TG CKFG  C++HHP     SV   +        L+ +G P R G
Sbjct  85   YPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVL--------LNYSGYPLRPG  136

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPG  307
               C YYMKTG CKFG+TCKF HP PG
Sbjct  137  EKECSYYMKTGQCKFGSTCKFHHPQPG  163


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 10/85 (12%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG-LPRRE  391
            YP+RPG+ +C +YM+TG C +GERCR++HP D          G +     + AG  P R 
Sbjct  39   YPERPGEPDCAYYMRTGSCGYGERCRYNHPRD---------RGARSGAGRTAAGEYPERV  89

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YYM+TG CKFG+TCK+ HP
Sbjct  90   GQPVCEYYMRTGTCKFGSTCKYHHP  114


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 26/98 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG+CK+G+TC+Y+HP +            G V P    +                + Y
Sbjct  98   MRTGTCKFGSTCKYHHPRQ----------GGGSVRPVLLNY----------------SGY  131

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS  451
            P RPG+ EC +YMKTG+CKFG  C+FHHP     SV S
Sbjct  132  PLRPGEKECSYYMKTGQCKFGSTCKFHHPQPGGASVPS  169



>ref|XP_003577562.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Brachypodium distachyon]
Length=445

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 74/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP    +   AA +                              Y
Sbjct  66   MRTGLCRFGMTCKFNHPADRKMAVAAARMK---------------------------GEY  98

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            PQR GQ EC +Y+KTG CKFG  C+FHHP + +   T          +L++ G P R   
Sbjct  99   PQRIGQPECQYYLKTGMCKFGATCKFHHPREKAAMAT--------RVQLNVLGYPLRPNE  150

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF+HP P   +
Sbjct  151  KECSYYLRTGQCKFGSTCKFNHPQPSNTM  179


 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 51/85 (60%), Gaps = 8/85 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            I+P RP Q EC FYMKTG+CKFG  C+FHHP +  +   S          LS  GLP R 
Sbjct  305  IFPDRPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPSPSC--------ALSPLGLPLRS  356

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C +Y + GICKFG  CKFDHP
Sbjct  357  GEPICTFYSRYGICKFGPNCKFDHP  381


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 11/86 (13%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRR  394
            +YP+R G+ +C +YM+TG C+FG  C+F+HP D  ++V ++ M+GE           P+R
Sbjct  52   LYPERVGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKGE----------YPQR  101

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C YY+KTG+CKFGATCKF HP
Sbjct  102  IGQPECQYYLKTGMCKFGATCKFHHP  127


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 53/117 (45%), Gaps = 29/117 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA C+++HP    I  P+  L+ +G+                          
Sbjct  319  MKTGDCKFGAVCKFHHPKERIIPSPSCALSPLGL--------------------------  352

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-SVTSSMEGEQQNFKLSLAGLP  400
             P R G+  C FY + G CKFG  C+F HP+   +  + +S  GE    +  LA +P
Sbjct  353  -PLRSGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGEVPTGRHMLAPVP  408



>ref|XP_006829499.1| hypothetical protein AMTR_s00074p00110430 [Amborella trichopoda]
 gb|ERM96915.1| hypothetical protein AMTR_s00074p00110430 [Amborella trichopoda]
Length=276

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 72/148 (49%), Gaps = 39/148 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C YG+ CR+NHP                           DPR      G      
Sbjct  84   LRTGMCGYGSNCRFNHPP--------------------------DPRQVVLYRGE----L  113

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C +++KTG CKFG  C++HHP D           E     L+++GLP R+G 
Sbjct  114  PERDGQPDCQYFLKTGTCKFGPTCKYHHPSDRH---------ESGPVPLNVSGLPVRQGE  164

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGEL  301
              C YY++TG CKFG  CKF+HP P  L
Sbjct  165  KACAYYLRTGSCKFGVACKFNHPQPAAL  192


 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 51/88 (58%), Gaps = 12/88 (14%)
 Frame = -2

Query  579  ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP  400
            A T YP+RPGQ +C +Y++TG C +G  CRF+HP D             +   L    LP
Sbjct  67   ANTPYPERPGQPDCVYYLRTGMCGYGSNCRFNHPPD------------PRQVVLYRGELP  114

Query  399  RREGAIHCPYYMKTGICKFGATCKFDHP  316
             R+G   C Y++KTG CKFG TCK+ HP
Sbjct  115  ERDGQPDCQYFLKTGTCKFGPTCKYHHP  142



>ref|XP_010666383.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 76/151 (50%), Gaps = 35/151 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG C Y   CR+NHP DR T    +A +  G V                      +  
Sbjct  25   LRTGFCGYADRCRFNHPRDRST----SAVVRSGRV----------------------SGD  58

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C +YM+TG CKFG  C++HHP   S S +         F L++ G P R G
Sbjct  59   YPERAGQPICQYYMRTGSCKFGSSCKYHHPRQGSSSGSP--------FALNIYGYPLRPG  110

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
               C YY+KTG CKFG TCKF HPPP  + G
Sbjct  111  EKECTYYIKTGQCKFGMTCKFHHPPPTNVPG  141


 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQRPGQ EC  Y+KTG+CKFG  C++HHP +  +  TSS         LS  GLP R 
Sbjct  266  LYPQRPGQPECQHYIKTGDCKFGSSCKYHHPSEWVVPETSS--------ALSPMGLPLRP  317

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY   G+CKFG TCKFDHP
Sbjct  318  GTSTCSYYAHHGVCKFGLTCKFDHP  342



>ref|XP_006422325.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
 ref|XP_006422330.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
 gb|ESR35565.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
 gb|ESR35570.1| hypothetical protein CICLE_v100047902mg, partial [Citrus clementina]
Length=312

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 89/178 (50%), Gaps = 36/178 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++T +CK+G TC+++HP               +  P   +     P   +     ++   
Sbjct  142  MQTRTCKFGDTCKFDHP---------------IWVPEGGI-----PDWKEVPVIASSESL  181

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C +++KT  CKFG +C+F+HP D  +  + S  G+       ++ LP R   
Sbjct  182  PERPGEPDCPYFLKTQRCKFGSKCKFNHPKDKLIGSSDSGNGD-------VSALPERPSE  234

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ  211
              C +Y+K G CKFGATCKFDHP   +L          SVG+E G  +  E++ K  +
Sbjct  235  PPCAFYLKNGTCKFGATCKFDHPKDFQL---------PSVGQENGIGEQNESVIKTDE  283


 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK-----LSLAG  406
            +YPQRPG+ +C +YM+T  CKFG+ C+F HP+          EG   ++K      S   
Sbjct  128  VYPQRPGEKDCAYYMQTRTCKFGDTCKFDHPI-------WVPEGGIPDWKEVPVIASSES  180

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT  289
            LP R G   CPY++KT  CKFG+ CKF+H P  +LIG +
Sbjct  181  LPERPGEPDCPYFLKTQRCKFGSKCKFNH-PKDKLIGSS  218



>ref|XP_010666382.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=473

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 76/151 (50%), Gaps = 35/151 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG C Y   CR+NHP DR T    +A +  G V                      +  
Sbjct  51   LRTGFCGYADRCRFNHPRDRST----SAVVRSGRV----------------------SGD  84

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C +YM+TG CKFG  C++HHP   S S +         F L++ G P R G
Sbjct  85   YPERAGQPICQYYMRTGSCKFGSSCKYHHPRQGSSSGSP--------FALNIYGYPLRPG  136

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIG  295
               C YY+KTG CKFG TCKF HPPP  + G
Sbjct  137  EKECTYYIKTGQCKFGMTCKFHHPPPTNVPG  167


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 54/85 (64%), Gaps = 8/85 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            +YPQRPGQ EC  Y+KTG+CKFG  C++HHP +  +  TSS         LS  GLP R 
Sbjct  292  LYPQRPGQPECQHYIKTGDCKFGSSCKYHHPSEWVVPETSS--------ALSPMGLPLRP  343

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY   G+CKFG TCKFDHP
Sbjct  344  GTSTCSYYAHHGVCKFGLTCKFDHP  368



>ref|XP_002871723.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47982.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 83/182 (46%), Gaps = 47/182 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTIN---------------PP-------AAHLNVGVVNP--  637
            L+TG CK+G TC++NHP   + N               PP       +      V NP  
Sbjct  111  LRTGHCKFGGTCKFNHPQTQSTNLMVSLRGSPVYSALQPPTDGQQSYSWPRTSFVANPPR  170

Query  636  -----------TASLFQTFDPRLTQTMFGFAT----TIYPQRPGQVECDFYMKTGECKFG  502
                          LF +          GF       ++P+RPGQ EC FYMKTG+CKFG
Sbjct  171  WQDPSSFSSGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFG  230

Query  501  ERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFD  322
              C+FHHP D         +    +  LS  GLP R+G   C +Y + GICKFG +CKFD
Sbjct  231  TVCKFHHPRDR--------QTPAPDCALSSVGLPLRQGEPLCVFYSRYGICKFGPSCKFD  282

Query  321  HP  316
            HP
Sbjct  283  HP  284


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 74/144 (51%), Gaps = 37/144 (26%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C++G TCR+NHP DR             +V  TA +                   
Sbjct  20   IRTGLCRFGFTCRFNHPHDR------------KLVIATARI----------------KGE  51

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ EC+FY+KTG CKFG  C+FHHP + +        G      +++ G P R  
Sbjct  52   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKA--------GNDGRVSVNVLGYPLRPN  103

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C Y+++TG CKFG TCKF+HP
Sbjct  104  EDDCSYFLRTGHCKFGGTCKFNHP  127


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP D  L + T+ ++GE           P R 
Sbjct  7    YPERHGEPDCAYYIRTGLCRFGFTCRFNHPHDRKLVIATARIKGE----------YPERI  56

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C +Y+KTG CKFG TCKF HP
Sbjct  57   GQPECEFYLKTGTCKFGVTCKFHHP  81


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 78/200 (39%), Gaps = 83/200 (42%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G TC+++HP     N                     D R++  + G     Y
Sbjct  65   LKTGTCKFGVTCKFHHPRNKAGN---------------------DGRVSVNVLG-----Y  98

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGE------------QQNFK  421
            P RP + +C ++++TG CKFG  C+F+HP   S ++  S+ G             QQ++ 
Sbjct  99   PLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTNLMVSLRGSPVYSALQPPTDGQQSYS  158

Query  420  ---------------------------------------LSLAGLPR------REGAIHC  376
                                                   L    LPR      R G   C
Sbjct  159  WPRTSFVANPPRWQDPSSFSSGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPEC  218

Query  375  PYYMKTGICKFGATCKFDHP  316
             +YMKTG CKFG  CKF HP
Sbjct  219  QFYMKTGDCKFGTVCKFHHP  238


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 50/112 (45%), Gaps = 36/112 (32%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+G  C+++HP DR T  P  A  +VG+                          
Sbjct  222  MKTGDCKFGTVCKFHHPRDRQTPAPDCALSSVGL--------------------------  255

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL--------DHSLSVTSSMEGE  436
             P R G+  C FY + G CKFG  C+F HP+        D S S +SS+  E
Sbjct  256  -PLRQGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNDASPSPSSSLHQE  306



>ref|XP_008359919.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Malus domestica]
Length=444

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 75/150 (50%), Gaps = 36/150 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP    +   AA +                              +
Sbjct  60   IRTGLCRFGATCRFNHPPNRKLAIAAARMK---------------------------GEF  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR-EG  388
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R + 
Sbjct  93   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPQN  144

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELI  298
             I C YY++TG CKFG TCKF HP P  ++
Sbjct  145  EIECAYYLRTGQCKFGGTCKFHHPQPTNMM  174


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP++  +     +        LS  GLP R
Sbjct  298  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCV--------LSPIGLPLR  349

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  350  PGEPMCIFYSRYGICKFGPSCKFDHP  375


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE  391
            YP+R G+ +C +Y++TG C+FG  CRF+HP +  L++ ++ M+GE           P R 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKGE----------FPERI  96

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  97   GQPECQYYLKTGTCKFGATCKFHHP  121


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 27/98 (28%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  105  LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVALNILG-----Y  138

Query  564  PQRP-GQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP  ++EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  139  PLRPQNEIECAYYLRTGQCKFGGTCKFHHPQPTNMMVS  176


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 41/90 (46%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG CK+GA CR++HP    I  P       V++P                        
Sbjct  313  MKTGDCKFGAVCRFHHPMERLIPAPDC-----VLSPIG---------------------L  346

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG+  C FY + G CKFG  C+F HP+
Sbjct  347  PLRPGEPMCIFYSRYGICKFGPSCKFDHPM  376


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  420  LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPP  313
            L   G P R G   C YY++TG+C+FGATC+F+HPP
Sbjct  42   LEAGGYPERTGEPDCSYYIRTGLCRFGATCRFNHPP  77



>ref|XP_008812314.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=457

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP    +   AA +  G                           Y
Sbjct  60   IRTGLCRFGMTCKFNHPPNRKLAIAAARIKGG---------------------------Y  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G     +L++ G P R   
Sbjct  93   PERVGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVQLNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P   +
Sbjct  145  KECAYYLRTGQCKFGNTCKFHHPQPSNAM  173


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  C+FHHP +  + V         N  LS  GLP R
Sbjct  297  NIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP--------NCSLSPLGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  349  PGEPLCVFYARYGICKFGPNCKFDHP  374


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG+ +C +Y++TG C+FG  C+F+HP +  L++ ++             G P R G
Sbjct  47   YPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRKLAIAAAR---------IKGGYPERVG  97

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
               C YY+KTG CKFGATCKF HP     I G  Q+ 
Sbjct  98   QPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLN  134



>ref|XP_002881253.1| hypothetical protein ARALYDRAFT_345050 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57512.1| hypothetical protein ARALYDRAFT_345050 [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 81/163 (50%), Gaps = 39/163 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C YG TCRYNHP          HL  GV+                    +     
Sbjct  54   LRTGQCGYGNTCRYNHP--------LTHLPQGVI--------------------YYKDQL  85

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C++++KTG CK+G  C++HHP D + +              ++ G P R+G 
Sbjct  86   PERIGQPDCEYFLKTGACKYGPTCKYHHPKDRNGAGP---------VLFNVLGFPMRQGE  136

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTST--SVG  262
              CPYYM+TG+C+FG  CKF HP P    G ++   S+  SVG
Sbjct  137  KSCPYYMQTGLCRFGVACKFHHPHPQPSNGHSAYALSSFPSVG  179


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPR  397
            ++ YP RPG+ +C F+++TG+C +G  CR++HPL H            Q        LP 
Sbjct  38   SSPYPDRPGERDCQFFLRTGQCGYGNTCRYNHPLTHL----------PQGVIYYKDQLPE  87

Query  396  REGAIHCPYYMKTGICKFGATCKFDHP  316
            R G   C Y++KTG CK+G TCK+ HP
Sbjct  88   RIGQPDCEYFLKTGACKYGPTCKYHHP  114


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 8/77 (10%)
 Frame = -2

Query  549  QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY  370
            + EC F+M TG CK+G+ C++ HP +  L    ++        L+   LP R G   C  
Sbjct  266  RAECRFFMNTGTCKYGDDCKYSHPKERLLQSPPNL--------LNPIVLPARPGQPACGN  317

Query  369  YMKTGICKFGATCKFDH  319
            +   G CKFGA+CKFDH
Sbjct  318  FKAYGFCKFGASCKFDH  334



>gb|EYU39704.1| hypothetical protein MIMGU_mgv1a0076882mg [Erythranthe guttata]
Length=398

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     Y
Sbjct  27   IRTGLCRFGATCRFNHP-------PNRKLAIA----------------TAKMKG----EY  59

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+F HP + +        G      L++ G P R   
Sbjct  60   PERMGQSECQYYLKTGTCKFGATCKFDHPREKA--------GIAGRVALNVLGYPIRANE  111

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
            + C YYM+ G CKFG+TCKF HP P  ++
Sbjct  112  MECAYYMRNGQCKFGSTCKFHHPQPSNMM  140


 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  C+FHHP +  + V   +        LS  GLP R
Sbjct  253  NVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRERLMPVPDCV--------LSPIGLPLR  304

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  305  TGEPLCVFYSRYGICKFGPSCKFDHP  330


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 11/94 (12%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRR  394
            +YP R  + +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R
Sbjct  13   LYPVREDEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAKMKGE----------YPER  62

Query  393  EGAIHCPYYMKTGICKFGATCKFDHPPPGELIGG  292
             G   C YY+KTG CKFGATCKFDHP     I G
Sbjct  63   MGQSECQYYLKTGTCKFGATCKFDHPREKAGIAG  96


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  72   LKTGTCKFGATCKFDHPRE----------KAGIAG-----------RVALNVLG-----Y  105

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P R  ++EC +YM+ G+CKFG  C+FHHP   ++ V+
Sbjct  106  PIRANEMECAYYMRNGQCKFGSTCKFHHPQPSNMMVS  142


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P RE    C YY++TG+C+FGATC+F+HPP  +L   T+++
Sbjct  15   PVREDEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAKM  55



>ref|XP_006581890.1| PREDICTED: zinc finger CCCH domain-containing protein 43-like 
[Glycine max]
Length=562

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 76/153 (50%), Gaps = 32/153 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G  C++NHP R                            L +          
Sbjct  234  LKTGTCKFGFNCKFNHPLRRK-------------------------NLAKNENAGEREEQ  268

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
             +R GQ EC +Y+++G CKFG+ C+F+H    S S +S+ E       L+  GLP R G 
Sbjct  269  EERSGQTECKYYLRSGGCKFGKACKFNHTRGKSSSASSTAE-------LNFLGLPIRVGE  321

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
              C YYM+TG CKFGA C+F+HP P  + GG S
Sbjct  322  KECHYYMRTGSCKFGANCRFNHPDPTAIGGGDS  354


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 68/143 (48%), Gaps = 24/143 (17%)
 Frame = -2

Query  696  PDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTG  517
            P  Y +N PA   NV + +      + F                P+RPG+ EC +++KTG
Sbjct  424  PSTYVMNNPAIESNVYMHHQKQMQVEEF----------------PERPGEPECSYFLKTG  467

Query  516  ECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGA  337
            +CKF   C+FHHP +    +            LS  GLP R     C YY + GICKFG 
Sbjct  468  DCKFKSNCKFHHPKNRIARLPPC--------NLSDKGLPLRPEQTVCTYYRRYGICKFGP  519

Query  336  TCKFDHPPPGELIGGTSQVTSTS  268
             CKFDHPPP  + G   Q + T+
Sbjct  520  ACKFDHPPPSTMAGLDQQSSYTN  542



>ref|XP_010928414.1| PREDICTED: zinc finger CCCH domain-containing protein 3-like 
[Elaeis guineensis]
Length=420

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 74/145 (51%), Gaps = 39/145 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C YG+ CRYNHP          ++  G +                      +   
Sbjct  59   LRTGYCGYGSNCRYNHP---------TYIGQGTL---------------------YSGEL  88

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C F++KTG CKFG  C++HHP D         + E +  +L+  GLP R+  
Sbjct  89   PERDGQPDCQFFLKTGTCKFGATCKYHHPRD---------KHEARPVQLNFLGLPMRKEE  139

Query  384  IHCPYYMKTGICKFGATCKFDHPPP  310
              CPYYMKTG+CKFG  CKF+HP P
Sbjct  140  KSCPYYMKTGLCKFGIACKFNHPQP  164


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 10/94 (11%)
 Frame = -2

Query  594  TMFGFATTI-YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKL  418
             + G +T + +P+RP Q EC +YMKTG CKFG  C+FHHP + +     +         +
Sbjct  265  ALLGSSTPVNFPERPDQPECQYYMKTGSCKFGTSCKFHHPKERNQEAICT---------I  315

Query  417  SLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               GLP R G   C +Y   G CK+G+TCKFDHP
Sbjct  316  GPLGLPLRPGQPVCTFYSMYGSCKYGSTCKFDHP  349


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 12/90 (13%)
 Frame = -2

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG  406
            G    +YP RPG+  C +Y++TG C +G  CR++HP         S E            
Sbjct  40   GAFPNLYPDRPGEPNCIYYLRTGYCGYGSNCRYNHPTYIGQGTLYSGE------------  87

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHP  316
            LP R+G   C +++KTG CKFGATCK+ HP
Sbjct  88   LPERDGQPDCQFFLKTGTCKFGATCKYHHP  117



>gb|EWM30456.1| zinc finger ccch type domain-containing protein zfn-like 3 [Nannochloropsis 
gaditana]
Length=374

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 71/143 (50%), Gaps = 28/143 (20%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            +KTG+CKY   C+++HP   T          G V P            T    G     Y
Sbjct  31   MKTGTCKYATKCKFHHPPDVTPT-------WGTVAPA-----------TDVTIGLNKESY  72

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+RPG+ +C F++KTG CK+   C+F HP           E  QQ  +L     P R G 
Sbjct  73   PRRPGEQQCTFFLKTGTCKYKMSCKFDHPP----------EAIQQTLQLQATPYPMRPGE  122

Query  384  IHCPYYMKTGICKFGATCKFDHP  316
            + C YY+KTG CKFGATC+FDHP
Sbjct  123  LQCSYYLKTGKCKFGATCRFDHP  145


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = -2

Query  585  GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG  406
            G     YPQRPG++EC +YMKTG CK+  +C+FHHP D + +  +          L+   
Sbjct  12   GVGAVCYPQRPGELECQYYMKTGTCKYATKCKFHHPPDVTPTWGTVAPATDVTIGLNKES  71

Query  405  LPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTST  271
             PRR G   C +++KTG CK+  +CKFDHPP  E I  T Q+ +T
Sbjct  72   YPRRPGEQQCTFFLKTGTCKYKMSCKFDHPP--EAIQQTLQLQAT  114


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 59/147 (40%), Gaps = 37/147 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP------------------------DRYTINPPAAH-------L  658
            LKTG CK+GATCR++HP                        + +       H       +
Sbjct  129  LKTGKCKFGATCRFDHPAMAPEHATALAAGQYAGAGGAGGMNGHVGGAAGMHAMLAMGRV  188

Query  657  NVGVVNPTAS--LFQTFDPRLTQTMFGFATTI----YPQRPGQVECDFYMKTGECKFGER  496
             +G    TA   +         Q +  F         PQRPG+ EC F+++TG C++G R
Sbjct  189  GMGYYEGTAGGGMLDMMGLPGQQMLANFGAGAPLAQLPQRPGEKECTFFLRTGRCQYGPR  248

Query  495  CRFHHPLDHSLSVTSSMEGEQQNFKLS  415
            C+FHHPLD        + G      LS
Sbjct  249  CKFHHPLDKLQGALMGLNGVHGGPHLS  275



>ref|XP_004142565.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
 gb|KGN66679.1| hypothetical protein Csa_1G659020 [Cucumis sativus]
Length=367

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  27   IRTGLCRFGATCRFNHP-------PNRELAIA----------------TARMKG----EF  59

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  60   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPSE  111

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  112  TECAYYLRTGQCKFGNTCKFHHPQPTNMM  140


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  223  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCV--------LSPIGLPLR  274

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  275  PGEPLCIFYSRYGICKFGPSCKFDHP  300


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP RPG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  14   YPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGE----------FPERI  63

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  64   GQPECQYYLKTGTCKFGATCKFHHP  88


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  72   LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVALNILG-----Y  105

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  106  PLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVS  142


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P R G   C YY++TG+C+FGATC+F+HPP  EL   T+++
Sbjct  15   PVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARM  55



>gb|KHN31930.1| Zinc finger CCCH domain-containing protein 43 [Glycine soja]
Length=579

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 76/153 (50%), Gaps = 32/153 (21%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+G  C++NHP R                            L +          
Sbjct  251  LKTGTCKFGFNCKFNHPLRRK-------------------------NLAKNENAGEREEQ  285

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
             +R GQ EC +Y+++G CKFG+ C+F+H    S S +S+ E       L+  GLP R G 
Sbjct  286  EERSGQTECKYYLRSGGCKFGKACKFNHTRGKSSSASSTAE-------LNFLGLPIRVGE  338

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTS  286
              C YYM+TG CKFGA C+F+HP P  + GG S
Sbjct  339  KECHYYMRTGSCKFGANCRFNHPDPTAIGGGDS  371


 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 68/143 (48%), Gaps = 24/143 (17%)
 Frame = -2

Query  696  PDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTG  517
            P  Y +N PA   NV + +      + F                P+RPG+ EC +++KTG
Sbjct  441  PSTYVMNNPAIESNVYMHHQKQMQVEEF----------------PERPGEPECSYFLKTG  484

Query  516  ECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGA  337
            +CKF   C+FHHP +    +            LS  GLP R     C YY + GICKFG 
Sbjct  485  DCKFKSNCKFHHPKNRIARLPPC--------NLSDKGLPLRPEQTVCTYYRRYGICKFGP  536

Query  336  TCKFDHPPPGELIGGTSQVTSTS  268
             CKFDHPPP  + G   Q + T+
Sbjct  537  ACKFDHPPPSTMAGLDQQSSYTN  559



>ref|XP_010513101.1| PREDICTED: zinc finger CCCH domain-containing protein 26-like 
[Camelina sativa]
Length=326

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 81/164 (49%), Gaps = 40/164 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            L+TG C YG TCRYNHP          HL  GV+                    +     
Sbjct  54   LRTGQCGYGNTCRYNHP--------LTHLPQGVI--------------------YYKDQL  85

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ +C++++KTG CK+G  C++HHP D + +              ++ G P R+G 
Sbjct  86   PERIGQPDCEYFLKTGACKYGPTCKYHHPKDRNGAGP---------VLFNVLGFPMRQGE  136

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTST---SVG  262
              CPYYM+TG+C+FG  CKF HP P    G ++   S+   SVG
Sbjct  137  KSCPYYMQTGLCRFGVACKFHHPHPQAPNGHSAYAMSSFPPSVG  180


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  576  TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPR  397
            ++ YP RPG+ +C F+++TG+C +G  CR++HPL H            Q        LP 
Sbjct  38   SSPYPDRPGERDCQFFLRTGQCGYGNTCRYNHPLTHL----------PQGVIYYKDQLPE  87

Query  396  REGAIHCPYYMKTGICKFGATCKFDHP  316
            R G   C Y++KTG CK+G TCK+ HP
Sbjct  88   RIGQPDCEYFLKTGACKYGPTCKYHHP  114



>gb|ADN33845.1| nucleic acid binding protein [Cucumis melo subsp. melo]
Length=367

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATCR+NHP       P   L +                 T  M G     +
Sbjct  27   IRTGLCRFGATCRFNHP-------PNRELAIA----------------TARMKG----EF  59

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  60   PERIGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVALNILGYPLRPSE  111

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P  ++
Sbjct  112  TECAYYLRTGQCKFGNTCKFHHPQPTNMM  140


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPGQ EC FYMKTG+CKFG  CRFHHP +  L     +        LS  GLP R
Sbjct  223  NVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCV--------LSPIGLPLR  274

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKFDHP
Sbjct  275  PGEPLCIFYSRYGICKFGPSCKFDHP  300


 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 55/85 (65%), Gaps = 11/85 (13%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE  391
            YP RPG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct  14   YPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMKGE----------FPERI  63

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            G   C YY+KTG CKFGATCKF HP
Sbjct  64   GQPECQYYLKTGTCKFGATCKFHHP  88


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 51/97 (53%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R+   + G     Y
Sbjct  72   LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVALNILG-----Y  105

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  106  PLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVS  142


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  402  PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV  280
            P R G   C YY++TG+C+FGATC+F+HPP  EL   T+++
Sbjct  15   PVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARM  55



>ref|NP_182306.2| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 ref|NP_001078078.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 sp|Q84W91.2|C3H32_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 32; 
Short=AtC3H32; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 1 [Arabidopsis thaliana]
 gb|ABO45694.1| At2g47850 [Arabidopsis thaliana]
 gb|AEC10897.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10899.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=468

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 73/146 (50%), Gaps = 37/146 (25%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            ++TG C YG  CRYNHP DR                  AS+  T            AT  
Sbjct  55   MRTGVCGYGNRCRYNHPRDR------------------ASVEATVR----------ATGQ  86

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R G+  C FY+KTG CKFG  C+FHHP +          G   +  L++ G P REG
Sbjct  87   YPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAG--------GSMSHVPLNIYGYPVREG  138

Query  387  AIHCPYYMKTGICKFGATCKFDHPPP  310
               C YY+KTG CKFG TCKF HP P
Sbjct  139  DNECSYYLKTGQCKFGITCKFHHPQP  164


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            +P+RPG+ EC +Y+KTG+CKFG  C+FHHP D            + N  LS  GLP R G
Sbjct  286  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVP--------PRANCVLSPIGLPLRPG  337

Query  387  AIHCPYYMKTGICKFGATCKFDHP  316
               C +Y++ G CKFG+TCKFDHP
Sbjct  338  VQRCTFYVQNGFCKFGSTCKFDHP  361


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 61/101 (60%), Gaps = 11/101 (11%)
 Frame = -2

Query  612  DPRLTQTMF--GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG  439
            D  L ++M+  G  +  YP+RPG  +C +YM+TG C +G RCR++HP D + SV +++  
Sbjct  25   DTGLQESMWRLGLGSDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRA-SVEATVRA  83

Query  438  EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
              Q         P R G   C +Y+KTG CKFGA+CKF HP
Sbjct  84   TGQ--------YPERFGEPPCQFYLKTGTCKFGASCKFHHP  116


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 45/91 (49%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            LKTG CK+G +C+++HP DR    PP A+    V++P                       
Sbjct  299  LKTGDCKFGTSCKFHHPRDRV---PPRANC---VLSPIG---------------------  331

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG   C FY++ G CKFG  C+F HP+
Sbjct  332  LPLRPGVQRCTFYVQNGFCKFGSTCKFDHPM  362



>ref|XP_006380188.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
 gb|ERP57985.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
Length=477

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 71/149 (48%), Gaps = 36/149 (24%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            L+TG C YGA CRYNHP DR  +                         L     G A   
Sbjct  57   LRTGFCGYGARCRYNHPRDRNAV-------------------------LGAARAGGAE--  89

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+R GQ  C +YM+TG CKFG  C++HHP            G      L+  G P R G
Sbjct  90   YPERAGQPLCQYYMRTGTCKFGASCKYHHPKQGG--------GSASPVSLNYYGYPLRPG  141

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGEL  301
               C YY+KTG CKFGATCKF HP PG +
Sbjct  142  ERECTYYIKTGQCKFGATCKFHHPQPGNI  170


 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 59/103 (57%), Gaps = 8/103 (8%)
 Frame = -2

Query  624  FQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM  445
            FQ+  P    +       ++P+RPGQ EC +Y+KTG+CKF   CR+HHP +  +S     
Sbjct  279  FQSIPPATGPSSSTQKEHLFPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVS-----  333

Query  444  EGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
               + N  LS  GLP R GA  C +Y + G CKFG  CKFDHP
Sbjct  334  ---KSNVVLSPIGLPLRPGAPTCSHYTQRGQCKFGPACKFDHP  373


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -2

Query  603  LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF  424
            + Q   G   + YP+R  + +C +Y++TG C +G RCR++HP D +  + ++  G     
Sbjct  32   VWQLGLGETESEYPERSNEQDCMYYLRTGFCGYGARCRYNHPRDRNAVLGAARAGG----  87

Query  423  KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                A  P R G   C YYM+TG CKFGA+CK+ HP
Sbjct  88   ----AEYPERAGQPLCQYYMRTGTCKFGASCKYHHP  119


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 26/96 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG+CK+GA+C+Y+HP +            G  +P           ++   +G     Y
Sbjct  103  MRTGTCKFGASCKYHHPKQ----------GGGSASP-----------VSLNYYG-----Y  136

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV  457
            P RPG+ EC +Y+KTG+CKFG  C+FHHP   ++ +
Sbjct  137  PLRPGERECTYYIKTGQCKFGATCKFHHPQPGNIQI  172



>ref|XP_010929827.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Elaeis guineensis]
Length=430

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP    +   AA +  G                           Y
Sbjct  30   IRTGLCRFGMTCKFNHPPNRRLAIAAARIKGG---------------------------Y  62

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G     +L++ G P R   
Sbjct  63   PERVGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVQLNILGYPLRPNE  114

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P   +
Sbjct  115  KECAYYIRTGQCKFGNTCKFHHPQPSNAM  143


 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  C+FHHP +  + V         N  LS  GLP R
Sbjct  267  NIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP--------NCLLSPLGLPLR  318

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  319  PGEPLCVFYSRYGICKFGPNCKFDHP  344


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YP+RPG+ +C +Y++TG C+FG  C+F+HP +  L++ ++             G P R G
Sbjct  17   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLAIAAAR---------IKGGYPERVG  67

Query  387  AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT  277
               C YY+KTG CKFGATCKF HP     I G  Q+ 
Sbjct  68   QPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLN  104


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 42/91 (46%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA C+++HP    +  P   L+ +G+                          
Sbjct  282  MKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGL--------------------------  315

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG+  C FY + G CKFG  C+F HP+
Sbjct  316  -PLRPGEPLCVFYSRYGICKFGPNCKFDHPM  345



>ref|XP_010929825.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Elaeis guineensis]
Length=460

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++G TC++NHP    +   AA +  G                           Y
Sbjct  60   IRTGLCRFGMTCKFNHPPNRRLAIAAARIKGG---------------------------Y  92

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G     +L++ G P R   
Sbjct  93   PERVGQPECQYYLKTGTCKFGATCKFHHPKDKA--------GIAGRVQLNILGYPLRPNE  144

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG TCKF HP P   +
Sbjct  145  KECAYYIRTGQCKFGNTCKFHHPQPSNAM  173


 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 53/86 (62%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             I+P+RP Q EC FYMKTG+CKFG  C+FHHP +  + V         N  LS  GLP R
Sbjct  297  NIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP--------NCLLSPLGLPLR  348

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG  CKFDHP
Sbjct  349  PGEPLCVFYSRYGICKFGPNCKFDHP  374


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 72/135 (53%), Gaps = 13/135 (10%)
 Frame = -2

Query  681  INPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFG  502
            + PPAA +  G  +         + R +++M    +  YP+RPG+ +C +Y++TG C+FG
Sbjct  13   VRPPAA-MTEGSSSLDEEAMWQMNLRGSESM---ESGPYPERPGEADCGYYIRTGLCRFG  68

Query  501  ERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFD  322
              C+F+HP +  L++ ++             G P R G   C YY+KTG CKFGATCKF 
Sbjct  69   MTCKFNHPPNRRLAIAAAR---------IKGGYPERVGQPECQYYLKTGTCKFGATCKFH  119

Query  321  HPPPGELIGGTSQVT  277
            HP     I G  Q+ 
Sbjct  120  HPKDKAGIAGRVQLN  134


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 42/91 (46%), Gaps = 28/91 (31%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLN-VGVVNPTASLFQTFDPRLTQTMFGFATTI  568
            +KTG CK+GA C+++HP    +  P   L+ +G+                          
Sbjct  312  MKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGL--------------------------  345

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPL  475
             P RPG+  C FY + G CKFG  C+F HP+
Sbjct  346  -PLRPGEPLCVFYSRYGICKFGPNCKFDHPM  375



>ref|XP_008796232.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X2 [Phoenix dactylifera]
Length=409

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 57/85 (67%), Gaps = 8/85 (9%)
 Frame = -2

Query  570  IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE  391
            ++P+RPGQ EC FYM+TG+CKFG  C++HHP D S+  T        N  LS  GLP R 
Sbjct  230  MFPERPGQPECQFYMRTGDCKFGATCKYHHPRDWSIPKT--------NCVLSPLGLPLRP  281

Query  390  GAIHCPYYMKTGICKFGATCKFDHP  316
            GA  C YY + G+CKFG TCKFDHP
Sbjct  282  GAQICSYYAQHGVCKFGPTCKFDHP  306


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 50/86 (58%), Gaps = 8/86 (9%)
 Frame = -2

Query  567  YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG  388
            YPQ  GQ  C++YMKTG CKFG  C++HHP            G +Q   L+  G P R G
Sbjct  28   YPQHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGG--------GSEQPVLLNYYGYPLRPG  79

Query  387  AIHCPYYMKTGICKFGATCKFDHPPP  310
               C YYMKTG CKFG TCKF HP P
Sbjct  80   EKECSYYMKTGQCKFGLTCKFHHPQP  105


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (49%), Gaps = 26/90 (29%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG CK+GATC+Y+HP  ++I  P  +    V++P                        
Sbjct  244  MRTGDCKFGATCKYHHPRDWSI--PKTNC---VLSPLG---------------------L  277

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPL  475
            P RPG   C +Y + G CKFG  C+F HP+
Sbjct  278  PLRPGAQICSYYAQHGVCKFGPTCKFDHPV  307



>gb|KJB82177.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=447

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 73/149 (49%), Gaps = 35/149 (23%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            ++TG C++GATC +NHP    +   AA +                              +
Sbjct  65   IRTGLCRFGATCHFNHPPNRKLAIAAARMK---------------------------GEF  97

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA  385
            P+R GQ EC +Y+KTG CKFG  C+FHHP D +        G      L++ G P R   
Sbjct  98   PERVGQPECQYYLKTGTCKFGATCKFHHPRDKA--------GIAGRVSLNILGYPLRPNE  149

Query  384  IHCPYYMKTGICKFGATCKFDHPPPGELI  298
              C YY++TG CKFG+TCKF HP P  ++
Sbjct  150  TECAYYLRTGQCKFGSTCKFHHPQPTNMM  178


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -2

Query  573  TIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRR  394
             ++P+RPG+ EC FYMKTG+CKFG  C+FHHP +  L     +        LS  GLP R
Sbjct  302  NVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCV--------LSPIGLPLR  353

Query  393  EGAIHCPYYMKTGICKFGATCKFDHP  316
             G   C +Y + GICKFG +CKF+HP
Sbjct  354  PGEPLCIFYSRYGICKFGPSCKFNHP  379


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 62/98 (63%), Gaps = 14/98 (14%)
 Frame = -2

Query  606  RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQ  430
            R ++TM    ++ YP+RPG+ +C +Y++TG C+FG  C F+HP +  L++ ++ M+GE  
Sbjct  42   RSSETM---ESSPYPERPGEPDCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGE--  96

Query  429  NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP  316
                     P R G   C YY+KTG CKFGATCKF HP
Sbjct  97   --------FPERVGQPECQYYLKTGTCKFGATCKFHHP  126


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (54%), Gaps = 26/97 (27%)
 Frame = -2

Query  744  LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY  565
            LKTG+CK+GATC+++HP              G+             R++  + G     Y
Sbjct  110  LKTGTCKFGATCKFHHPRD----------KAGIAG-----------RVSLNILG-----Y  143

Query  564  PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT  454
            P RP + EC +Y++TG+CKFG  C+FHHP   ++ V+
Sbjct  144  PLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420