BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029J11

Length=786
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006363989.1|  PREDICTED: uncharacterized protein LOC102601007    330   6e-108   Solanum tuberosum [potatoes]
ref|XP_009614692.1|  PREDICTED: uncharacterized protein LOC104107561    330   1e-107   Nicotiana tomentosiformis
ref|XP_009780705.1|  PREDICTED: uncharacterized protein LOC104229716    327   2e-106   Nicotiana sylvestris
ref|XP_010091765.1|  hypothetical protein L484_019353                   325   1e-105   Morus notabilis
ref|XP_004235367.1|  PREDICTED: uncharacterized protein LOC101248757    324   2e-105   Solanum lycopersicum
ref|XP_008375017.1|  PREDICTED: uncharacterized protein LOC103438...    316   3e-102   
ref|XP_008375019.1|  PREDICTED: uncharacterized protein LOC103438...    316   4e-102   
ref|XP_011073153.1|  PREDICTED: uncharacterized protein LOC105158192    316   4e-102   Sesamum indicum [beniseed]
ref|XP_008356699.1|  PREDICTED: uncharacterized protein LOC103420...    316   5e-102   
ref|XP_008356700.1|  PREDICTED: uncharacterized protein LOC103420...    315   5e-102   
emb|CDO98647.1|  unnamed protein product                                315   5e-102   Coffea canephora [robusta coffee]
ref|XP_009355996.1|  PREDICTED: uncharacterized protein LOC103946...    315   7e-102   Pyrus x bretschneideri [bai li]
ref|XP_009355995.1|  PREDICTED: uncharacterized protein LOC103946...    315   9e-102   Pyrus x bretschneideri [bai li]
ref|XP_007036962.1|  Uncharacterized protein isoform 2                  315   1e-101   
ref|XP_010069444.1|  PREDICTED: uncharacterized protein LOC104456368    314   1e-101   Eucalyptus grandis [rose gum]
emb|CBI35458.3|  unnamed protein product                                313   3e-101   Vitis vinifera
ref|XP_006493269.1|  PREDICTED: uncharacterized protein LOC102611...    310   5e-100   Citrus sinensis [apfelsine]
ref|XP_002267281.3|  PREDICTED: uncharacterized protein LOC100262899    310   8e-100   Vitis vinifera
gb|KHG11329.1|  Alanine--tRNA ligase                                    309   2e-99    Gossypium arboreum [tree cotton]
ref|XP_006441318.1|  hypothetical protein CICLE_v10020337mg             308   3e-99    Citrus clementina [clementine]
gb|EYU21849.1|  hypothetical protein MIMGU_mgv1a007186mg                308   4e-99    Erythranthe guttata [common monkey flower]
gb|KDO47166.1|  hypothetical protein CISIN_1g014467mg                   307   8e-99    Citrus sinensis [apfelsine]
ref|XP_002885230.1|  predicted protein                                  307   9e-99    
ref|NP_001078173.1|  uncharacterized protein                            306   2e-98    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01343.1|  hypothetical protein                                   306   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AAL32564.1|  Unknown protein                                         306   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566588.1|  uncharacterized protein                               306   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466989.1|  PREDICTED: uncharacterized protein LOC103504355    305   6e-98    Cucumis melo [Oriental melon]
ref|XP_008798412.1|  PREDICTED: uncharacterized protein LOC103713309    304   9e-98    Phoenix dactylifera
ref|XP_010241168.1|  PREDICTED: uncharacterized protein LOC104585831    305   1e-97    Nelumbo nucifera [Indian lotus]
emb|CAL07981.1|  hypothetical protein                                   299   1e-97    Platanus x hispanica [London plane tree]
gb|KDP30111.1|  hypothetical protein JCGZ_18399                         304   2e-97    Jatropha curcas
ref|XP_007036961.1|  Uncharacterized protein isoform 1                  303   5e-97    
ref|XP_011047792.1|  PREDICTED: uncharacterized protein LOC105142042    302   7e-97    Populus euphratica
ref|XP_009360040.1|  PREDICTED: uncharacterized protein LOC103950...    301   1e-96    Pyrus x bretschneideri [bai li]
ref|XP_009360039.1|  PREDICTED: uncharacterized protein LOC103950...    301   2e-96    Pyrus x bretschneideri [bai li]
ref|XP_010936872.1|  PREDICTED: uncharacterized protein LOC105056391    301   2e-96    Elaeis guineensis
ref|XP_008393456.1|  PREDICTED: uncharacterized protein LOC103455...    301   3e-96    
ref|XP_008393457.1|  PREDICTED: uncharacterized protein LOC103455...    301   3e-96    
ref|XP_009408547.1|  PREDICTED: uncharacterized protein LOC103990...    300   3e-96    
ref|XP_009408539.1|  PREDICTED: uncharacterized protein LOC103990...    300   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK30572.1|AF346660_1  unknown                                       295   4e-96    Brassica napus [oilseed rape]
ref|XP_006374245.1|  hypothetical protein POPTR_0015s05360g             298   6e-96    
ref|XP_009414789.1|  PREDICTED: uncharacterized protein LOC103995...    299   8e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004137518.1|  PREDICTED: uncharacterized protein LOC101203627    299   9e-96    Cucumis sativus [cucumbers]
ref|XP_009414790.1|  PREDICTED: uncharacterized protein LOC103995...    299   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006374246.1|  hypothetical protein POPTR_0015s05360g             298   2e-95    
ref|XP_002533448.1|  conserved hypothetical protein                     296   6e-95    
ref|XP_004981974.1|  PREDICTED: uncharacterized protein LOC101781...    296   7e-95    Setaria italica
ref|XP_004981973.1|  PREDICTED: uncharacterized protein LOC101781...    296   8e-95    Setaria italica
ref|XP_010465837.1|  PREDICTED: uncharacterized protein LOC104746127    296   8e-95    Camelina sativa [gold-of-pleasure]
dbj|BAJ34170.1|  unnamed protein product                                296   9e-95    Eutrema halophilum
ref|XP_010487675.1|  PREDICTED: uncharacterized protein LOC104765624    296   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010271178.1|  PREDICTED: uncharacterized protein LOC104607271    296   1e-94    Nelumbo nucifera [Indian lotus]
emb|CDX95820.1|  BnaC05g35710D                                          296   2e-94    
ref|XP_006406690.1|  hypothetical protein EUTSA_v10020677mg             297   2e-94    
ref|XP_006297794.1|  hypothetical protein CARUB_v10013829mg             295   2e-94    Capsella rubella
gb|KJB53076.1|  hypothetical protein B456_008G292100                    295   2e-94    Gossypium raimondii
gb|KFK39108.1|  hypothetical protein AALP_AA3G202000                    295   3e-94    Arabis alpina [alpine rockcress]
ref|XP_002317709.1|  hypothetical protein POPTR_0012s03930g             294   4e-94    Populus trichocarpa [western balsam poplar]
ref|XP_010505920.1|  PREDICTED: uncharacterized protein LOC104782624    295   4e-94    Camelina sativa [gold-of-pleasure]
gb|KGN64195.1|  hypothetical protein Csa_1G042990                       300   6e-94    Cucumis sativus [cucumbers]
emb|CDX92162.1|  BnaA05g22450D                                          294   6e-94    
gb|KHG07714.1|  Ribosomal L11 methyltransferase                         291   9e-94    Gossypium arboreum [tree cotton]
ref|XP_009145975.1|  PREDICTED: uncharacterized protein LOC103869650    293   3e-93    Brassica rapa
ref|XP_011464472.1|  PREDICTED: uncharacterized protein LOC101299...    292   4e-93    Fragaria vesca subsp. vesca
ref|XP_004299503.1|  PREDICTED: uncharacterized protein LOC101299...    292   4e-93    Fragaria vesca subsp. vesca
ref|NP_175278.1|  uncharacterized protein                               292   6e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDX75937.1|  BnaC03g40200D                                          292   6e-93    
gb|AFK42768.1|  unknown                                                 291   8e-93    Lotus japonicus
ref|XP_006393405.1|  hypothetical protein EUTSA_v10011507mg             291   1e-92    Eutrema salsugineum [saltwater cress]
ref|XP_011003767.1|  PREDICTED: uncharacterized protein LOC105110429    291   1e-92    Populus euphratica
gb|ACF87802.1|  unknown                                                 291   1e-92    Zea mays [maize]
ref|NP_001143815.1|  uncharacterized protein LOC100276591               291   1e-92    Zea mays [maize]
gb|ABF98565.1|  expressed protein                                       287   3e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007209930.1|  hypothetical protein PRUPE_ppa004570mg             293   3e-92    
ref|XP_008240405.1|  PREDICTED: uncharacterized protein LOC103338912    290   4e-92    Prunus mume [ume]
ref|XP_010549033.1|  PREDICTED: uncharacterized protein LOC104820...    290   4e-92    Tarenaya hassleriana [spider flower]
ref|XP_010549034.1|  PREDICTED: uncharacterized protein LOC104820...    290   5e-92    Tarenaya hassleriana [spider flower]
ref|XP_002894114.1|  hypothetical protein ARALYDRAFT_473985             290   5e-92    
ref|XP_010500371.1|  PREDICTED: uncharacterized protein LOC104777762    290   6e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010461662.1|  PREDICTED: uncharacterized protein LOC104742...    290   6e-92    Camelina sativa [gold-of-pleasure]
gb|KJB30250.1|  hypothetical protein B456_005G134400                    289   8e-92    Gossypium raimondii
ref|XP_010479269.1|  PREDICTED: uncharacterized protein LOC104758146    288   2e-91    Camelina sativa [gold-of-pleasure]
dbj|BAJ85118.1|  predicted protein                                      287   3e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006306266.1|  hypothetical protein CARUB_v10012116mg             288   3e-91    Capsella rubella
gb|EAY91660.1|  hypothetical protein OsI_13299                          286   6e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_006374243.1|  hypothetical protein POPTR_0015s05360g             286   1e-90    
gb|KFK36092.1|  hypothetical protein AALP_AA4G076400                    285   2e-90    Arabis alpina [alpine rockcress]
ref|NP_001051084.1|  Os03g0717900                                       286   2e-90    
emb|CDX82345.1|  BnaA03g34760D                                          285   3e-90    
ref|XP_003530975.1|  PREDICTED: uncharacterized protein LOC100793300    285   3e-90    Glycine max [soybeans]
ref|XP_004503251.1|  PREDICTED: uncharacterized protein LOC101489103    284   4e-90    Cicer arietinum [garbanzo]
ref|XP_003560595.1|  PREDICTED: uncharacterized protein LOC100829350    284   5e-90    Brachypodium distachyon [annual false brome]
tpg|DAA51043.1|  TPA: hypothetical protein ZEAMMB73_539342              276   2e-89    
ref|XP_009135549.1|  PREDICTED: uncharacterized protein LOC103859727    283   2e-89    Brassica rapa
ref|XP_006650499.1|  PREDICTED: uncharacterized protein LOC102715191    280   3e-89    
gb|AFK36208.1|  unknown                                                 282   4e-89    Medicago truncatula
gb|ACJ84884.1|  unknown                                                 282   5e-89    Medicago truncatula
gb|AGV54799.1|  hypothetical protein                                    281   5e-89    Phaseolus vulgaris [French bean]
ref|XP_010687245.1|  PREDICTED: uncharacterized protein LOC104901374    281   7e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001169730.1|  hypothetical protein                               281   7e-89    Zea mays [maize]
ref|XP_006580389.1|  PREDICTED: uncharacterized protein LOC100817...    281   1e-88    Glycine max [soybeans]
ref|XP_003525180.1|  PREDICTED: uncharacterized protein LOC100817...    280   1e-88    Glycine max [soybeans]
emb|CDY58279.1|  BnaCnng32840D                                          281   2e-88    Brassica napus [oilseed rape]
gb|EPS73872.1|  hypothetical protein M569_00881                         280   2e-88    Genlisea aurea
ref|XP_009145005.1|  PREDICTED: uncharacterized protein LOC103868678    280   3e-88    Brassica rapa
ref|XP_003528983.1|  PREDICTED: uncharacterized protein LOC100777...    276   4e-87    Glycine max [soybeans]
gb|ACU24516.1|  unknown                                                 276   4e-87    Glycine max [soybeans]
gb|KHN43658.1|  hypothetical protein glysoja_027724                     275   6e-87    Glycine soja [wild soybean]
ref|XP_003534126.1|  PREDICTED: uncharacterized protein LOC100802...    275   2e-86    Glycine max [soybeans]
ref|XP_004513343.1|  PREDICTED: uncharacterized protein LOC101494...    274   6e-86    
gb|EMT10781.1|  hypothetical protein F775_30852                         276   1e-85    
gb|KEH26747.1|  plant/T1N15-5 protein                                   273   2e-85    Medicago truncatula
ref|XP_006849427.1|  hypothetical protein AMTR_s00024p00021530          271   1e-84    
ref|XP_007160560.1|  hypothetical protein PHAVU_002G331900g             270   2e-84    Phaseolus vulgaris [French bean]
ref|XP_007152648.1|  hypothetical protein PHAVU_004G147200g             270   2e-84    Phaseolus vulgaris [French bean]
gb|AFK35334.1|  unknown                                                 259   7e-83    Lotus japonicus
gb|EYU24493.1|  hypothetical protein MIMGU_mgv1a007418mg                264   3e-82    Erythranthe guttata [common monkey flower]
ref|XP_010939981.1|  PREDICTED: uncharacterized protein LOC105058679    256   5e-79    
gb|ABR17692.1|  unknown                                                 252   2e-77    Picea sitchensis
ref|XP_010661178.1|  PREDICTED: uncharacterized protein LOC100245...    242   3e-74    
emb|CAN79123.1|  hypothetical protein VITISV_030635                     242   9e-74    Vitis vinifera
ref|XP_002273280.1|  PREDICTED: uncharacterized protein LOC100245...    242   1e-73    Vitis vinifera
gb|ADE77481.1|  unknown                                                 237   2e-71    Picea sitchensis
ref|XP_010461665.1|  PREDICTED: uncharacterized protein LOC104742360    228   3e-71    Camelina sativa [gold-of-pleasure]
ref|XP_002304357.2|  hypothetical protein POPTR_0003s09600g             218   4e-66    
ref|XP_006471483.1|  PREDICTED: uncharacterized protein LOC102623998    220   4e-65    Citrus sinensis [apfelsine]
gb|KDP30713.1|  hypothetical protein JCGZ_15541                         219   7e-65    Jatropha curcas
ref|XP_008466020.1|  PREDICTED: uncharacterized protein LOC103503...    216   2e-64    
ref|XP_011028101.1|  PREDICTED: uncharacterized protein LOC105128231    218   2e-64    Populus euphratica
emb|CAN68920.1|  hypothetical protein VITISV_039448                     215   2e-64    Vitis vinifera
gb|KHG08376.1|  Beta-casein                                             216   1e-63    Gossypium arboreum [tree cotton]
ref|XP_008466019.1|  PREDICTED: uncharacterized protein LOC103503...    216   1e-63    Cucumis melo [Oriental melon]
ref|XP_009373461.1|  PREDICTED: uncharacterized protein LOC103962488    215   3e-63    Pyrus x bretschneideri [bai li]
ref|XP_004136206.1|  PREDICTED: uncharacterized protein LOC101213975    215   3e-63    Cucumis sativus [cucumbers]
ref|XP_010919980.1|  PREDICTED: uncharacterized protein LOC105043949    214   4e-63    
ref|XP_002276652.1|  PREDICTED: uncharacterized protein LOC100260823    214   4e-63    Vitis vinifera
ref|XP_010261560.1|  PREDICTED: uncharacterized protein LOC104600354    214   1e-62    Nelumbo nucifera [Indian lotus]
gb|KJB21160.1|  hypothetical protein B456_003G185600                    213   1e-62    Gossypium raimondii
ref|XP_008373529.1|  PREDICTED: uncharacterized protein LOC103436859    213   2e-62    
ref|XP_007040722.1|  Uncharacterized protein TCM_016604                 213   2e-62    
ref|XP_008238169.1|  PREDICTED: uncharacterized protein LOC103336834    212   3e-62    Prunus mume [ume]
ref|XP_008800079.1|  PREDICTED: uncharacterized protein LOC103714...    209   1e-61    Phoenix dactylifera
ref|XP_004300191.1|  PREDICTED: uncharacterized protein LOC101292798    211   1e-61    Fragaria vesca subsp. vesca
ref|XP_011081424.1|  PREDICTED: uncharacterized protein LOC105164476    210   2e-61    Sesamum indicum [beniseed]
ref|XP_008800078.1|  PREDICTED: uncharacterized protein LOC103714...    209   3e-61    
ref|XP_010055250.1|  PREDICTED: uncharacterized protein LOC104443499    209   4e-61    
ref|XP_008800077.1|  PREDICTED: uncharacterized protein LOC103714...    209   4e-61    Phoenix dactylifera
ref|XP_002518989.1|  conserved hypothetical protein                     208   1e-60    Ricinus communis
gb|KCW71713.1|  hypothetical protein EUGRSUZ_E00224                     209   2e-60    Eucalyptus grandis [rose gum]
ref|XP_003534296.1|  PREDICTED: uncharacterized protein LOC100802337    206   5e-60    Glycine max [soybeans]
emb|CDP11681.1|  unnamed protein product                                204   5e-59    Coffea canephora [robusta coffee]
ref|XP_009145204.1|  PREDICTED: uncharacterized protein LOC103868901    204   6e-59    Brassica rapa
ref|XP_009804854.1|  PREDICTED: uncharacterized protein LOC104250017    203   8e-59    Nicotiana sylvestris
gb|KHN40428.1|  hypothetical protein glysoja_000926                     203   1e-58    Glycine soja [wild soybean]
emb|CDY35549.1|  BnaA05g16370D                                          203   1e-58    Brassica napus [oilseed rape]
ref|XP_009413222.1|  PREDICTED: uncharacterized protein LOC103994...    202   1e-58    
ref|XP_009413223.1|  PREDICTED: uncharacterized protein LOC103994...    202   1e-58    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN34329.1|  unknown                                                 197   2e-58    Zea mays [maize]
emb|CDY29940.1|  BnaC05g28960D                                          202   2e-58    Brassica napus [oilseed rape]
ref|XP_006415245.1|  hypothetical protein EUTSA_v10007794mg             202   2e-58    Eutrema salsugineum [saltwater cress]
ref|XP_004245960.1|  PREDICTED: uncharacterized protein LOC101262445    202   2e-58    
ref|XP_006352932.1|  PREDICTED: uncharacterized protein LOC102595128    202   3e-58    Solanum tuberosum [potatoes]
ref|NP_001053731.1|  Os04g0595100                                       201   7e-58    
gb|EYU43718.1|  hypothetical protein MIMGU_mgv1a007450mg                201   8e-58    Erythranthe guttata [common monkey flower]
gb|EEC77902.1|  hypothetical protein OsI_17223                          201   9e-58    Oryza sativa Indica Group [Indian rice]
gb|KFK44959.1|  hypothetical protein AALP_AA1G325800                    200   1e-57    Arabis alpina [alpine rockcress]
ref|XP_004976664.1|  PREDICTED: uncharacterized protein LOC101761297    200   2e-57    Setaria italica
ref|XP_010540738.1|  PREDICTED: uncharacterized protein LOC104814412    200   2e-57    Tarenaya hassleriana [spider flower]
ref|XP_006854071.1|  hypothetical protein AMTR_s00048p00111750          199   2e-57    Amborella trichopoda
ref|NP_001242537.1|  uncharacterized protein LOC100810147               199   3e-57    
ref|XP_007158234.1|  hypothetical protein PHAVU_002G135300g             199   3e-57    Phaseolus vulgaris [French bean]
ref|XP_002448446.1|  hypothetical protein SORBIDRAFT_06g027240          198   5e-57    Sorghum bicolor [broomcorn]
ref|XP_006653725.1|  PREDICTED: uncharacterized protein LOC102702753    198   7e-57    Oryza brachyantha
gb|EMT04061.1|  hypothetical protein F775_32804                         197   8e-57    
gb|EPS63452.1|  hypothetical protein M569_11331                         196   8e-57    Genlisea aurea
ref|XP_004512464.1|  PREDICTED: uncharacterized protein LOC101507671    198   1e-56    Cicer arietinum [garbanzo]
gb|EMS68345.1|  hypothetical protein TRIUR3_07699                       197   1e-56    Triticum urartu
dbj|BAJ87444.1|  predicted protein                                      197   1e-56    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009607216.1|  PREDICTED: uncharacterized protein LOC104101473    198   1e-56    Nicotiana tomentosiformis
gb|AFW59314.1|  hypothetical protein ZEAMMB73_007794                    197   1e-56    
ref|NP_001145533.1|  uncharacterized protein LOC100278968               197   1e-56    Zea mays [maize]
ref|XP_003612708.1|  hypothetical protein MTR_5g028020                  196   5e-56    Medicago truncatula
ref|XP_010677383.1|  PREDICTED: uncharacterized protein LOC104893042    196   7e-56    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010240349.1|  PREDICTED: uncharacterized protein LOC104585415    192   8e-55    Brachypodium distachyon [annual false brome]
ref|XP_010499760.1|  PREDICTED: uncharacterized protein LOC104777247    192   2e-54    Camelina sativa [gold-of-pleasure]
ref|XP_010461033.1|  PREDICTED: uncharacterized protein LOC104741810    192   2e-54    Camelina sativa [gold-of-pleasure]
ref|XP_004253444.1|  PREDICTED: uncharacterized protein LOC101265814    188   2e-54    Solanum lycopersicum
ref|XP_002890970.1|  hypothetical protein ARALYDRAFT_473397             191   3e-54    Arabidopsis lyrata subsp. lyrata
ref|XP_010478637.1|  PREDICTED: uncharacterized protein LOC104757587    190   1e-53    Camelina sativa [gold-of-pleasure]
ref|XP_002981973.1|  hypothetical protein SELMODRAFT_233832             187   2e-53    
ref|XP_006307539.1|  hypothetical protein CARUB_v10009166mg             189   4e-53    
ref|XP_002982952.1|  hypothetical protein SELMODRAFT_234120             186   6e-53    
ref|NP_564389.1|  uncharacterized protein                               187   1e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    177   2e-50    Populus euphratica
emb|CBI33818.3|  unnamed protein product                                182   2e-50    Vitis vinifera
gb|ABR16101.1|  unknown                                                 177   1e-48    Picea sitchensis
ref|XP_002965311.1|  hypothetical protein SELMODRAFT_82738              174   2e-48    
ref|XP_002977160.1|  hypothetical protein SELMODRAFT_106276             174   2e-48    
gb|KDO57188.1|  hypothetical protein CISIN_1g036217mg                   170   3e-48    Citrus sinensis [apfelsine]
ref|XP_007036963.1|  Uncharacterized protein isoform 3                  173   7e-48    
emb|CAN66177.1|  hypothetical protein VITISV_005141                     162   8e-47    Vitis vinifera
dbj|BAD94862.1|  hypothetical protein                                   154   1e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK47814.1|  unknown                                                 154   1e-43    Lotus japonicus
ref|XP_006437251.1|  hypothetical protein CICLE_v10031774mg             148   4e-39    
gb|KDO46606.1|  hypothetical protein CISIN_1g015579mg                   147   7e-39    Citrus sinensis [apfelsine]
gb|KDO46604.1|  hypothetical protein CISIN_1g015579mg                   147   1e-38    Citrus sinensis [apfelsine]
gb|KDO46603.1|  hypothetical protein CISIN_1g015579mg                   147   1e-38    Citrus sinensis [apfelsine]
gb|KDO46602.1|  hypothetical protein CISIN_1g015579mg                   147   2e-38    Citrus sinensis [apfelsine]
ref|XP_007049654.1|  F21O3.2 protein                                    147   9e-38    
ref|XP_006437252.1|  hypothetical protein CICLE_v10031774mg             146   2e-37    Citrus clementina [clementine]
gb|KJB42555.1|  hypothetical protein B456_007G157400                    146   2e-37    Gossypium raimondii
ref|XP_002531072.1|  conserved hypothetical protein                     147   2e-37    Ricinus communis
ref|XP_006484801.1|  PREDICTED: uncharacterized protein LOC102613099    146   2e-37    Citrus sinensis [apfelsine]
gb|KDO46601.1|  hypothetical protein CISIN_1g015579mg                   145   5e-37    Citrus sinensis [apfelsine]
gb|KDO46600.1|  hypothetical protein CISIN_1g015579mg                   145   5e-37    Citrus sinensis [apfelsine]
gb|KHG02769.1|  Phosphoserine aminotransferase                          145   6e-37    Gossypium arboreum [tree cotton]
ref|XP_010069618.1|  PREDICTED: uncharacterized protein LOC104456510    144   2e-36    Eucalyptus grandis [rose gum]
ref|XP_006368347.1|  hypothetical protein POPTR_0001s01860g             139   5e-36    
ref|XP_007209264.1|  hypothetical protein PRUPE_ppa007392mg             141   1e-35    
gb|KDP45280.1|  hypothetical protein JCGZ_15145                         141   2e-35    Jatropha curcas
ref|XP_002272171.1|  PREDICTED: uncharacterized protein LOC100251038    140   3e-35    Vitis vinifera
ref|XP_006432689.1|  hypothetical protein CICLE_v10003247mg             132   9e-35    
ref|XP_010274079.1|  PREDICTED: uncharacterized protein LOC104609452    139   1e-34    Nelumbo nucifera [Indian lotus]
ref|XP_002303068.2|  hypothetical protein POPTR_0002s24910g             138   2e-34    Populus trichocarpa [western balsam poplar]
ref|XP_010247844.1|  PREDICTED: uncharacterized protein LOC104590798    137   5e-34    Nelumbo nucifera [Indian lotus]
ref|XP_006367000.1|  PREDICTED: uncharacterized protein LOC102582294    137   7e-34    Solanum tuberosum [potatoes]
ref|XP_011024597.1|  PREDICTED: uncharacterized protein LOC105125729    137   8e-34    Populus euphratica
ref|XP_010908555.1|  PREDICTED: uncharacterized protein LOC105034...    134   3e-33    
ref|XP_010908554.1|  PREDICTED: uncharacterized protein LOC105034...    134   6e-33    Elaeis guineensis
ref|XP_004247039.1|  PREDICTED: uncharacterized protein LOC101262953    132   2e-32    Solanum lycopersicum
ref|XP_004290164.1|  PREDICTED: uncharacterized protein LOC101305809    132   3e-32    Fragaria vesca subsp. vesca
ref|XP_009763079.1|  PREDICTED: uncharacterized protein LOC104215037    130   1e-31    Nicotiana sylvestris
ref|XP_010100787.1|  hypothetical protein L484_015816                   130   2e-31    Morus notabilis
gb|KFK38188.1|  hypothetical protein AALP_AA3G080700                    129   4e-31    Arabis alpina [alpine rockcress]
ref|XP_009587865.1|  PREDICTED: uncharacterized protein LOC104085515    129   4e-31    Nicotiana tomentosiformis
ref|XP_008776305.1|  PREDICTED: uncharacterized protein LOC103696450    129   7e-31    Phoenix dactylifera
ref|XP_006848511.1|  hypothetical protein AMTR_s00013p00260550          129   7e-31    Amborella trichopoda
ref|XP_011089045.1|  PREDICTED: uncharacterized protein LOC105170122    126   4e-30    Sesamum indicum [beniseed]
ref|XP_010547130.1|  PREDICTED: uncharacterized protein LOC104818981    126   5e-30    Tarenaya hassleriana [spider flower]
gb|ABR26180.1|  unknown                                                 117   2e-29    Oryza sativa Indica Group [Indian rice]
ref|NP_001031154.1|  uncharacterized protein                            124   2e-29    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407850.1|  hypothetical protein EUTSA_v10020977mg             124   2e-29    Eutrema salsugineum [saltwater cress]
dbj|BAH56904.1|  AT1G48450                                              122   5e-29    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185170.1|  uncharacterized protein                            122   8e-29    Arabidopsis thaliana [mouse-ear cress]
gb|EYU39191.1|  hypothetical protein MIMGU_mgv1a013058mg                119   2e-28    Erythranthe guttata [common monkey flower]
ref|XP_009793974.1|  PREDICTED: uncharacterized protein LOC104240787    121   3e-28    Nicotiana sylvestris
ref|XP_008382586.1|  PREDICTED: uncharacterized protein LOC103445364    121   3e-28    
ref|XP_009349111.1|  PREDICTED: uncharacterized protein LOC103940675    121   3e-28    Pyrus x bretschneideri [bai li]
ref|XP_002884641.1|  hypothetical protein ARALYDRAFT_896892             120   4e-28    Arabidopsis lyrata subsp. lyrata
emb|CDP03929.1|  unnamed protein product                                121   4e-28    Coffea canephora [robusta coffee]
gb|KHN21277.1|  hypothetical protein glysoja_038588                     119   5e-28    Glycine soja [wild soybean]
gb|AGT15907.1|  hypothetical protein SHCRBa_013_F04_R_50                120   5e-28    Saccharum hybrid cultivar R570
ref|XP_003520988.1|  PREDICTED: uncharacterized protein LOC100793365    120   5e-28    Glycine max [soybeans]
gb|KHN40722.1|  hypothetical protein glysoja_049851                     120   6e-28    Glycine soja [wild soybean]
ref|XP_006599165.1|  PREDICTED: uncharacterized protein LOC100804253    120   6e-28    Glycine max [soybeans]
gb|AGT16908.1|  hypothetical protein SHCRBa_217_A17_F_90                120   8e-28    Saccharum hybrid cultivar R570
ref|NP_566302.1|  uncharacterized protein                               119   8e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010685095.1|  PREDICTED: uncharacterized protein LOC104899578    119   9e-28    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010451051.1|  PREDICTED: uncharacterized protein LOC104733110    119   1e-27    Camelina sativa [gold-of-pleasure]
ref|XP_010464350.1|  PREDICTED: uncharacterized protein LOC104744916    119   1e-27    Camelina sativa [gold-of-pleasure]
ref|XP_008244677.1|  PREDICTED: uncharacterized protein LOC103342802    119   1e-27    Prunus mume [ume]
ref|XP_009147087.1|  PREDICTED: uncharacterized protein LOC103870681    119   1e-27    Brassica rapa
ref|XP_007201792.1|  hypothetical protein PRUPE_ppa007244mg             119   1e-27    Prunus persica
gb|AGT16639.1|  Protein of unknown function DUF760                      119   1e-27    Saccharum hybrid cultivar R570
gb|AGT16547.1|  hypothetical protein SHCRBa_093_N12_F_10                119   2e-27    Saccharum hybrid cultivar R570
ref|XP_008676966.1|  PREDICTED: uncharacterized protein LOC100276...    119   2e-27    Zea mays [maize]
ref|NP_001143759.1|  uncharacterized protein LOC100276521               119   2e-27    Zea mays [maize]
gb|ACF84114.1|  unknown                                                 119   2e-27    Zea mays [maize]
emb|CDY28064.1|  BnaC05g44660D                                          118   2e-27    Brassica napus [oilseed rape]
ref|XP_004170841.1|  PREDICTED: uncharacterized protein LOC101230760    116   2e-27    
ref|XP_008458049.1|  PREDICTED: uncharacterized protein LOC103497590    119   2e-27    Cucumis melo [Oriental melon]
ref|XP_009596731.1|  PREDICTED: uncharacterized protein LOC104092768    118   3e-27    Nicotiana tomentosiformis
ref|XP_004979240.1|  PREDICTED: uncharacterized protein LOC101761319    118   3e-27    Setaria italica
ref|XP_010486277.1|  PREDICTED: uncharacterized protein LOC104764444    118   3e-27    Camelina sativa [gold-of-pleasure]
ref|XP_003577586.1|  PREDICTED: uncharacterized protein LOC100826589    117   5e-27    Brachypodium distachyon [annual false brome]
ref|XP_007134152.1|  hypothetical protein PHAVU_010G023700g             117   7e-27    Phaseolus vulgaris [French bean]
ref|XP_004149773.1|  PREDICTED: uncharacterized protein LOC101209314    117   8e-27    Cucumis sativus [cucumbers]
ref|XP_006602471.1|  PREDICTED: uncharacterized protein LOC100794...    117   9e-27    
ref|XP_006297949.1|  hypothetical protein CARUB_v10013990mg             117   1e-26    
ref|XP_010552027.1|  PREDICTED: uncharacterized protein LOC104822482    116   2e-26    
ref|XP_001420115.1|  predicted protein                                  116   2e-26    
emb|CBI40011.3|  unnamed protein product                                114   2e-26    
emb|CEF99337.1|  Protein of unknown function DUF760                     116   2e-26    
ref|XP_009372204.1|  PREDICTED: uncharacterized protein LOC103961392    115   4e-26    
emb|CDY24630.1|  BnaA05g30290D                                          115   4e-26    
ref|XP_004510240.1|  PREDICTED: uncharacterized protein LOC101489146    115   5e-26    
gb|ACU18333.1|  unknown                                                 112   5e-26    
ref|XP_008372537.1|  PREDICTED: uncharacterized protein LOC103435886    114   1e-25    
ref|XP_007140787.1|  hypothetical protein PHAVU_008G142100g             114   1e-25    
gb|EMS63859.1|  hypothetical protein TRIUR3_07220                       112   1e-25    
gb|KHN10952.1|  hypothetical protein glysoja_026687                     112   2e-25    
ref|XP_003626951.1|  hypothetical protein MTR_8g012420                  113   2e-25    
ref|XP_006586216.1|  PREDICTED: uncharacterized protein LOC102662413    112   3e-25    
ref|XP_005649890.1|  DUF760-domain-containing protein                   112   3e-25    
ref|XP_008341108.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    112   6e-25    
ref|XP_007510107.1|  predicted protein                                  112   9e-25    
emb|CDY19857.1|  BnaC09g31230D                                          104   2e-24    
gb|EMT02013.1|  hypothetical protein F775_06929                         108   3e-24    
ref|XP_009124377.1|  PREDICTED: uncharacterized protein LOC103849349    109   4e-24    
emb|CDY34905.1|  BnaA01g32360D                                          108   6e-24    
emb|CDY60823.1|  BnaAnng17260D                                          108   8e-24    
ref|XP_005849975.1|  hypothetical protein CHLNCDRAFT_141875             108   7e-23    
dbj|BAK05587.1|  predicted protein                                      105   8e-23    
ref|XP_003055064.1|  predicted protein                                  105   2e-22    
ref|XP_006662927.1|  PREDICTED: uncharacterized protein LOC102711023    103   2e-22    
ref|XP_002503881.1|  predicted protein                                  105   3e-22    
gb|KFK31332.1|  hypothetical protein AALP_AA6G098300                    102   8e-22    
gb|ABA93505.2|  expressed protein                                       102   8e-22    
ref|NP_001067848.2|  Os11g0456100                                       102   8e-22    
ref|XP_006395162.1|  hypothetical protein EUTSA_v10004513mg             102   1e-21    
ref|XP_009151658.1|  PREDICTED: uncharacterized protein LOC103874970    102   1e-21    
ref|NP_199670.1|  uncharacterized protein                               101   1e-21    
emb|CDX85350.1|  BnaC07g26610D                                          100   3e-21    
gb|AEW07482.1|  hypothetical protein 0_2478_01                        95.1    4e-21    
ref|XP_002863907.1|  hypothetical protein ARALYDRAFT_917767             100   4e-21    
ref|XP_006280743.1|  hypothetical protein CARUB_v10026712mg             100   5e-21    
ref|XP_002863048.1|  hypothetical protein ARALYDRAFT_920669             100   5e-21    
dbj|BAD94536.1|  hypothetical protein                                 87.0    9e-18    
ref|XP_004240629.1|  PREDICTED: uncharacterized protein LOC101262317  83.2    3e-15    
ref|XP_001691046.1|  predicted protein                                82.4    1e-14    
ref|XP_002948306.1|  hypothetical protein VOLCADRAFT_88515            77.4    7e-13    
dbj|BAF63502.1|  hypothetical protein                                 71.6    2e-12    
gb|AAP45168.2|  hypothetical protein SBB1_14t00001                    71.2    5e-12    
gb|KEH22562.1|  DUF760 family protein                                 73.2    1e-11    
ref|XP_010271747.1|  PREDICTED: uncharacterized protein LOC104607751  69.3    2e-11    
ref|XP_011399310.1|  WD repeat-containing protein 89-like protein     73.2    3e-11    
ref|XP_004492297.1|  PREDICTED: uncharacterized protein LOC101488500  71.6    6e-11    
gb|KIY96176.1|  hypothetical protein MNEG_11787                       71.2    6e-11    
ref|XP_002444902.1|  hypothetical protein SORBIDRAFT_07g001113        64.7    2e-10    
ref|XP_010445948.1|  PREDICTED: uncharacterized protein LOC104728696  63.9    1e-08    
emb|CDY40232.1|  BnaA09g35140D                                        56.6    3e-06    
gb|EYU39226.1|  hypothetical protein MIMGU_mgv1a0220162mg             53.9    6e-06    
gb|EYU39189.1|  hypothetical protein MIMGU_mgv1a022366mg              50.4    6e-05    
gb|EPS72664.1|  hypothetical protein M569_02093                       52.8    8e-05    
ref|WP_015145832.1|  hypothetical protein                             48.1    6e-04    



>ref|XP_006363989.1| PREDICTED: uncharacterized protein LOC102601007 [Solanum tuberosum]
Length=421

 Score =   330 bits (847),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 184/219 (84%), Gaps = 7/219 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEA EMIQNHLSLILG+R   NS+V QI+KLRVGQVYAAS+MYGYFL+RVDQRFQLE
Sbjct  203  LHSPEANEMIQNHLSLILGSRLGDNSAVAQISKLRVGQVYAASIMYGYFLRRVDQRFQLE  262

Query  563  KNMKVLPQGLDKEDSGIQQVGGD------ssdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            K+MKVLPQG+D EDS IQQV G+      S  +   ++ +HPE+ SW  GG    GFG  
Sbjct  263  KSMKVLPQGVDDEDSSIQQVAGEDISGDRSDTSFRSTTQTHPELTSWSAGGASPGGFGQG  322

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLR YVMSFDGETLQRYATIRS+EAI +IEKHTEALFGRPEI ITPQGTIDSSKDE
Sbjct  323  IKPSRLRNYVMSFDGETLQRYATIRSREAIGMIEKHTEALFGRPEIVITPQGTIDSSKDE  382

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            LIKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  383  LIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  421



>ref|XP_009614692.1| PREDICTED: uncharacterized protein LOC104107561 [Nicotiana tomentosiformis]
Length=421

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/220 (78%), Positives = 184/220 (84%), Gaps = 7/220 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHS EA EMIQNHL+LILGNR   NS+V QI+K RVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  RLHSAEANEMIQNHLALILGNRLGDNSAVAQISKFRVGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQVGG------DssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MKVLPQG+D EDS I+QVGG      D SDTS   + SHPE+ SW  G  G+ GFG 
Sbjct  262  EKTMKVLPQGVDDEDSSIRQVGGEEIRSGDRSDTSFGVTQSHPELSSWSAGSAGTGGFGH  321

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLR YVMSFDGETLQRYATIRSKEAI IIEKHTEALFGRPEI ITPQGT+DSSKD
Sbjct  322  GIKPSRLRNYVMSFDGETLQRYATIRSKEAIGIIEKHTEALFGRPEIVITPQGTVDSSKD  381

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            EL+KISF  L RLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382  ELLKISFGGLSRLVLEAVTFGSFLWDVESYVDSRYHFVAN  421



>ref|XP_009780705.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
 ref|XP_009780706.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
Length=421

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/219 (78%), Positives = 184/219 (84%), Gaps = 7/219 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHS EA EMIQNHL+LILG+R   NS+V QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  203  LHSAEANEMIQNHLALILGSRLGDNSAVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  262

Query  563  KNMKVLPQGLDKEDSGIQQVGG------DssdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            K MKVLPQG+D ED   +QVGG      D SDTS R + SHPE+ SW  G  G+ GFG  
Sbjct  263  KTMKVLPQGVDDEDGSFRQVGGEEIRSGDRSDTSSRVTQSHPELSSWSAGSAGTGGFGHG  322

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLR YVMSFDGETLQRYATIRSKEAI IIEKHTEALFGRPEI ITPQGT+DSSKDE
Sbjct  323  IKPSRLRNYVMSFDGETLQRYATIRSKEAIGIIEKHTEALFGRPEIVITPQGTVDSSKDE  382

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            L+KISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  383  LLKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  421



>ref|XP_010091765.1| hypothetical protein L484_019353 [Morus notabilis]
 gb|EXB45128.1| hypothetical protein L484_019353 [Morus notabilis]
Length=431

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 185/217 (85%), Gaps = 7/217 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  214  QLHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  273

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssd-----tslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MK+LP  LD +D+ +QQ  GD S       S +++PSHPEV SW  GG    GFG  
Sbjct  274  EKTMKILPNTLDGDDTNVQQAVGDDSRPLGGGESFQAAPSHPEVSSWA-GGTSPGGFGHG  332

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            MKPSRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGT+DSSKDE
Sbjct  333  MKPSRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGTVDSSKDE  392

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            LIKISF+ L+RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  393  LIKISFAGLKRLVLEAVTFGSFLWDVESYVDARYHFV  429



>ref|XP_004235367.1| PREDICTED: uncharacterized protein LOC101248757 [Solanum lycopersicum]
Length=421

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 183/219 (84%), Gaps = 7/219 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHS EA EMIQNHLSLILG+R   +S+V QI+KLRVGQVYAAS+MYGYFL+RVDQRFQLE
Sbjct  203  LHSAEANEMIQNHLSLILGSRLGDDSAVAQISKLRVGQVYAASIMYGYFLRRVDQRFQLE  262

Query  563  KNMKVLPQGLDKEDSGIQQVGGD------ssdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            K+MKVLP G+D EDS IQQV G+      S  +   ++ +HPE+ SW  GG+   GFG  
Sbjct  263  KSMKVLPPGVDNEDSSIQQVAGEDISGDRSDTSFRSTTQTHPELTSWSAGGVSPGGFGQG  322

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLR YVMSFDGETLQRYATIRS+EAI +IEKHTEALFGRPEI ITPQGTIDSSKDE
Sbjct  323  IKPSRLRNYVMSFDGETLQRYATIRSREAIGMIEKHTEALFGRPEIVITPQGTIDSSKDE  382

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            LIKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  383  LIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  421



>ref|XP_008375017.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
 ref|XP_008375018.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
Length=429

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 181/220 (82%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  211  QLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG+ S GFG 
Sbjct  271  EKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSW-AGGISSGGFGN  329

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  330  AIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  389

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  390  DHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  429



>ref|XP_008375019.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
 ref|XP_008375020.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
Length=428

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 181/220 (82%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  210  QLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  269

Query  566  EKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG+ S GFG 
Sbjct  270  EKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSW-AGGISSGGFGN  328

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  329  AIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  388

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  389  DHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  428



>ref|XP_011073153.1| PREDICTED: uncharacterized protein LOC105158192 [Sesamum indicum]
Length=421

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 184/220 (84%), Gaps = 10/220 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR  ++NS  QI+KLRVGQVYAASVMYGYFL+RVDQRFQLE
Sbjct  204  LHSPEAYEMIQNHLALILGNRLGDSNSVAQISKLRVGQVYAASVMYGYFLRRVDQRFQLE  263

Query  563  KNMKVLPQGLDKEDSGIQQV-------GGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            K+MKVLPQ +D E++ I+QV        GD S+ SLR+   HPEV SW   G    G   
Sbjct  264  KSMKVLPQSIDNEENHIEQVIADDMRPSGDYSNESLRNPQPHPEVSSW--SGGLGAGGFG  321

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETLQRYATIRSKEAI+IIEKHTEALFGRPEI ITP+GT+DSSKD
Sbjct  322  RIKPSRLRTYVMSFDGETLQRYATIRSKEAISIIEKHTEALFGRPEIVITPEGTVDSSKD  381

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            ELIKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  382  ELIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  421



>ref|XP_008356699.1| PREDICTED: uncharacterized protein LOC103420417 isoform X1 [Malus 
domestica]
Length=429

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 181/220 (82%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  211  QLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG+ S GFG 
Sbjct  271  EKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSWA-GGISSGGFGN  329

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  330  AIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  389

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  390  DHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  429



>ref|XP_008356700.1| PREDICTED: uncharacterized protein LOC103420417 isoform X2 [Malus 
domestica]
Length=428

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 181/220 (82%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  210  QLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  269

Query  566  EKNMKVLPQGLDKEDSGIQ-QVGGDs-----sdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS IQ  VG D       DT    + SHPEV SW  GG+ S GFG 
Sbjct  270  EKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDTLQAGASSHPEVSSWA-GGISSGGFGN  328

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  329  AIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  388

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  389  DHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  428



>emb|CDO98647.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   315 bits (808),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 185/222 (83%), Gaps = 9/222 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHS EAYEMIQNHL+LILGNR   +SSV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  203  RLHSHEAYEMIQNHLALILGNRVADSSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  262

Query  566  EKNMKVLPQGLDKED-SGIQQV-------GGDssdtslrsspSHPEVVSWPDGGMGSRGF  411
            EK+M++LP+G D    S  Q++       G D +  + R++ SHPEV SW  GG+ + GF
Sbjct  263  EKSMRILPRGSDDGVLSNTQEMVGQEDGPGTDVAANTFRTAQSHPEVSSWSAGGVSAGGF  322

Query  410  GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  231
            G  MK SRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI ITP+GT+DSS
Sbjct  323  GHGMKSSRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPEGTVDSS  382

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            KDELIKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  383  KDELIKISFGGLRRLVLEAVTFGSFLWDVESHVDSRYHFVAN  424



>ref|XP_009355996.1| PREDICTED: uncharacterized protein LOC103946898 isoform X2 [Pyrus 
x bretschneideri]
Length=428

 Score =   315 bits (807),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 182/220 (83%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  210  QLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  269

Query  566  EKNMKVLPQGLDKEDSGIQ-QVG-----GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS IQ  VG     G   DT    +PSHPEV SW  GG+ S GFG 
Sbjct  270  EKTMKILPSAMGPEDSDIQTSVGQDVRPGGGEDTLQAGAPSHPEVSSW-AGGISSGGFGN  328

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  329  AIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  388

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  389  DHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  428



>ref|XP_009355995.1| PREDICTED: uncharacterized protein LOC103946898 isoform X1 [Pyrus 
x bretschneideri]
Length=429

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 182/220 (83%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  211  QLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQ-QVG-----GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS IQ  VG     G   DT    +PSHPEV SW  GG+ S GFG 
Sbjct  271  EKTMKILPSAMGPEDSDIQTSVGQDVRPGGGEDTLQAGAPSHPEVSSW-AGGISSGGFGN  329

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  330  AIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKD  389

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  390  DHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVAN  429



>ref|XP_007036962.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY21463.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 181/216 (84%), Gaps = 7/216 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  212  LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  271

Query  563  KNMKVLPQGLDKEDSGIQQ-VGGDssdt----slrsspSHPEVVSWPDGGMGSRGFGTEM  399
            K MK+LP   + E+SG++Q VG D        S ++  SHPEV SW  GG+   GFG  +
Sbjct  272  KTMKILPNASNGEESGVEQSVGEDMGTAGLGDSYKAVSSHPEVSSW-SGGISPGGFGHGI  330

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KP RLRTYVMSFDGETLQ++A IRSKEA++IIEKHTEALFGRPEI ITPQGT+DSSKDEL
Sbjct  331  KPCRLRTYVMSFDGETLQKFAAIRSKEAVSIIEKHTEALFGRPEIVITPQGTVDSSKDEL  390

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  391  IKISFNGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  426



>ref|XP_010069444.1| PREDICTED: uncharacterized protein LOC104456368 [Eucalyptus grandis]
 gb|KCW57801.1| hypothetical protein EUGRSUZ_H00558 [Eucalyptus grandis]
Length=423

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 184/218 (84%), Gaps = 8/218 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   N+SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  205  QLHSPEAYEMIQNHLALILGNRMGDNNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  264

Query  566  EKNMKVLPQGLDKED-SGIQQVGG-----DssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP   D ++ + +QQV G     D+ D + ++  SHPEV SW  GG+   GFG+
Sbjct  265  EKTMKILPSASDDDEVNNVQQVVGEDRKPDTGDDTFQTVQSHPEVSSW-SGGVSPGGFGS  323

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +KPSRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI ITP+GT+DSS+D
Sbjct  324  GIKPSRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPEGTVDSSRD  383

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            E IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  384  EHIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  421



>emb|CBI35458.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 174/212 (82%), Gaps = 6/212 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  QLHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP  LD +   +Q+   DS  T       HPEV SW  GG    GFG  +KPSR
Sbjct  262  EKTMKILPHALDGDKGSVQEAFDDSVQTVKS----HPEVSSWA-GGFTPGGFGHGIKPSR  316

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTIDSSKDELIKIS
Sbjct  317  LRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIIITPQGTIDSSKDELIKIS  376

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  377  FGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  408



>ref|XP_006493269.1| PREDICTED: uncharacterized protein LOC102611948 isoform X1 [Citrus 
sinensis]
 ref|XP_006493270.1| PREDICTED: uncharacterized protein LOC102611948 isoform X2 [Citrus 
sinensis]
Length=418

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 181/216 (84%), Gaps = 6/216 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  QLHSSEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdt----slrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK+MK+LP   D E SGIQQV GD + T    S  +  SHPEV S+  GG+   GFG  +
Sbjct  262  EKSMKILPDASDVEASGIQQVVGDVTPTGAEGSHEALSSHPEVSSF-SGGVSPGGFGHGI  320

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K SRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQGT+DSS DE 
Sbjct  321  KASRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPQGTVDSSNDEQ  380

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  381  IKISFAGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  416



>ref|XP_002267281.3| PREDICTED: uncharacterized protein LOC100262899 [Vitis vinifera]
Length=443

 Score =   310 bits (795),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 177/217 (82%), Gaps = 7/217 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  226  QLHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  285

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdts-----lrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MK+LP  LD +   +Q+   D    S     +++  SHPEV SW  GG    GFG  
Sbjct  286  EKTMKILPHALDGDKGSVQEALWDKMTPSGSDDSVQTVKSHPEVSSWA-GGFTPGGFGHG  344

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLR YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTIDSSKDE
Sbjct  345  IKPSRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIIITPQGTIDSSKDE  404

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            LIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  405  LIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  441



>gb|KHG11329.1| Alanine--tRNA ligase [Gossypium arboreum]
 gb|KHG12308.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=428

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 180/217 (83%), Gaps = 7/217 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EA+EMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFL+RVDQRFQL
Sbjct  211  QLHSAEAHEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLRRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdts-----lrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MKVLP   D + S I+Q  GD +  S      +++ SH EV SW  GG+   GFG+ 
Sbjct  271  EKTMKVLPSASDGDKSSIEQTVGDDTRPSGLGDSYQAASSHAEVSSW-SGGISPGGFGSG  329

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLRTYVMSFDGETLQRYA+IRSKEA+ IIEKHTEALFGRPEI+ITPQGT+DSS DE
Sbjct  330  IKPSRLRTYVMSFDGETLQRYASIRSKEAVGIIEKHTEALFGRPEIAITPQGTVDSSNDE  389

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            LIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  390  LIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  426



>ref|XP_006441318.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441319.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441320.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54558.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54559.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54560.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
Length=417

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 181/216 (84%), Gaps = 6/216 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  201  QLHSSEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  260

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdt----slrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK+MK+LP   D E+SGIQQV GD + T    S  +  SHPEV S+  GG+   GFG  +
Sbjct  261  EKSMKILPDASDVEESGIQQVVGDVTPTGAEGSHEALSSHPEVSSF-SGGVSPGGFGHGI  319

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K SRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQGT+DSS D  
Sbjct  320  KASRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPQGTVDSSNDVQ  379

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  380  IKISFAGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  415



>gb|EYU21849.1| hypothetical protein MIMGU_mgv1a007186mg [Erythranthe guttata]
Length=416

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 180/216 (83%), Gaps = 5/216 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHS EAYEMIQNHL+LILGNR +++NS  +I+KLRVGQVYAASVMYGYFLKR+DQRFQL
Sbjct  203  RLHSTEAYEMIQNHLALILGNRLADSNSLAEISKLRVGQVYAASVMYGYFLKRIDQRFQL  262

Query  566  EKNMKVLPQGLD-KEDSGIQQV-GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            EK MKVLPQG    E   I+QV   D  D+   +  SHPE  ++   G+G   F   +KP
Sbjct  263  EKTMKVLPQGTTVNEYENIEQVIADDKKDSVRSAQNSHPEASTF-SSGIGGMSFAG-VKP  320

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
            SRLRTYVMSFDGETLQRYATIRSKEAI+IIEKHTEALFGRPEI+ITPQGT+DSSKDELIK
Sbjct  321  SRLRTYVMSFDGETLQRYATIRSKEAISIIEKHTEALFGRPEIAITPQGTVDSSKDELIK  380

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            ISF  L+RLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  381  ISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFVAN  416



>gb|KDO47166.1| hypothetical protein CISIN_1g014467mg [Citrus sinensis]
Length=424

 Score =   307 bits (787),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 180/216 (83%), Gaps = 6/216 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  208  QLHSSEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  267

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdt----slrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK+MK+LP   D E SGIQQV GD + T    S  +  SHPEV S+  GG+   GFG  +
Sbjct  268  EKSMKILPDASDVEASGIQQVVGDVTPTGAEGSHEALSSHPEVSSF-SGGVSPGGFGHGI  326

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K SRLRTYVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQGT+DSS D  
Sbjct  327  KASRLRTYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPQGTVDSSNDVQ  386

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF+ L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  387  IKISFAGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  422



>ref|XP_002885230.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61489.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=426

 Score =   307 bits (787),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 179/212 (84%), Gaps = 5/212 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  217  RLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  276

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP GLD+  + ++Q       T+ ++  SHPEV S+  GG+ ++GFG+E+KPSR
Sbjct  277  EKTMKILPGGLDESKTSVEQT---EEKTTYQAVSSHPEVGSFA-GGVSAKGFGSEIKPSR  332

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  333  LRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  392

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  393  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  424



>ref|NP_001078173.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76009.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=427

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  217  RLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  276

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+KPSR
Sbjct  277  EKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEIKPSR  333

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  334  LRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  393

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  394  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  425



>dbj|BAF01343.1| hypothetical protein [Arabidopsis thaliana]
Length=421

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  211  RLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+KPSR
Sbjct  271  EKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEIKPSR  327

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  328  LRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  387

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  388  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>gb|AAL32564.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13275.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  211  RLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+KPSR
Sbjct  271  EKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEIKPSR  327

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  328  LRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  387

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  388  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>ref|NP_566588.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02703.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20406.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76008.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=421

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  211  RLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG+ ++GFG+E+KPSR
Sbjct  271  EKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GGVSAKGFGSEIKPSR  327

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  328  LRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  387

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  388  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>ref|XP_008466989.1| PREDICTED: uncharacterized protein LOC103504355 [Cucumis melo]
Length=422

 Score =   305 bits (781),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR  ++ S VQI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  205  LHSPEAYEMIQNHLALILGNRVGDSTSVVQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  264

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGS-RGFGTEM  399
            K MKVLP+  + EDS IQQ  G+        +      HPE+ SWPD    S  GF   +
Sbjct  265  KTMKVLPKASNSEDSIIQQAIGEDVRPYVGENSPPVSPHPEITSWPDRDENSIGGFSQGL  324

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K SRLR YVM+FDGETLQRYATIRSKEA+ IIEKHTEALFGRPEI+ITPQGTID SKDE 
Sbjct  325  KASRLRNYVMAFDGETLQRYATIRSKEAVGIIEKHTEALFGRPEIAITPQGTIDPSKDEQ  384

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +KISF  L+ LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  385  LKISFGGLKGLVLEAVTFGSFLWDVESYVDSRYHFV  420



>ref|XP_008798412.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
 ref|XP_008798421.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
Length=418

 Score =   304 bits (779),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSP+AYEMI+NHL+LILG R  ++NS   I+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  205  RLHSPDAYEMIKNHLALILGQRLGDSNSVAPISKLRVGQVYAASVMYGYFLKRVDQRFQL  264

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK LP G D+E+  I+Q   D S  S +   SHPE            GFG  +KP R
Sbjct  265  EKSMKSLPWGTDEEEDAIKQAMPDESRPSAQIGNSHPEASLGSSPSFSQGGFGHNVKPCR  324

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYAT+RSKEA +IIEKHTEALFGRPEI ITPQGTIDSSKDELIKIS
Sbjct  325  LRSYVMSFDSETLQRYATVRSKEAFSIIEKHTEALFGRPEIVITPQGTIDSSKDELIKIS  384

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  385  FAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  418



>ref|XP_010241168.1| PREDICTED: uncharacterized protein LOC104585831 [Nelumbo nucifera]
Length=424

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 179/221 (81%), Gaps = 9/221 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR  ++ +  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  205  QLHSSEAYEMIQNHLALILGNRVGDSRTVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  264

Query  566  EKNMKVLPQGLDKEDSGIQQV-------GGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK MK+LP   D++++ I+QV       GG+  + S ++  +HPEV SW  G  G  GFG
Sbjct  265  EKTMKILPYASDEQETDIEQVMAEQTPSGGEGIEASSQTEQTHPEVSSWL-GNFGPGGFG  323

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
               K S+LRTYVMSFD E LQRYATIRSKEA++IIEKHTEALFGRPEI ITP GTIDSSK
Sbjct  324  HGYKSSKLRTYVMSFDAEMLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPHGTIDSSK  383

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            DELI+ISF  L+RLVLEAVTFGSFLWDVES VDSRYHFVA+
Sbjct  384  DELIRISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVAN  424



>emb|CAL07981.1| hypothetical protein [Platanus x acerifolia]
Length=273

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 171/213 (80%), Gaps = 7/213 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR +N+N+  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  62   QLHSPEAYEMIQNHLALILGNRVANSNTVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  121

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDss-----dtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MK+LP   D+E S I+Q   +         S  +  +HPEV S P G     GFG  
Sbjct  122  EKTMKILPFASDEEKSDIEQSVAEEMRPGGGKASAYAEQTHPEVSSQP-GNFSPGGFGHG  180

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLRTYVM+FD ETLQ YATIRSKEA+ IIEKHTEALFGRPEI ITPQGTIDSSKDE
Sbjct  181  IKPSRLRTYVMAFDAETLQSYATIRSKEAVTIIEKHTEALFGRPEIVITPQGTIDSSKDE  240

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  123
            L++ISF  L+RLVLEAVTFGSFLWDVES VDSR
Sbjct  241  LVRISFGGLKRLVLEAVTFGSFLWDVESYVDSR  273



>gb|KDP30111.1| hypothetical protein JCGZ_18399 [Jatropha curcas]
Length=431

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/220 (71%), Positives = 182/220 (83%), Gaps = 14/220 (6%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGN+   +++V QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  215  QLHSPEAYEMIQNHLALILGNKIGDSTTVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  274

Query  566  EKNMKVLPQGLDKEDSGIQQV--------GGDssdtslrsspSHPEVVSWPDGGMGSRGF  411
            EK+MK+LP  +D+ED  +QQ         GG+ +  ++ S   HPE +S   GG+   GF
Sbjct  275  EKSMKILPNVMDEEDDNLQQAAMQDMKSSGGEDAFEAMSS---HPEGLSA--GGISPGGF  329

Query  410  GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  231
            G  ++ SRLR+YVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGT+DSS
Sbjct  330  GHGVRASRLRSYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGTVDSS  389

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            KDEL+KISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  390  KDELMKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  429



>ref|XP_007036961.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21462.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 176/211 (83%), Gaps = 7/211 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  212  LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  271

Query  563  KNMKVLPQGLDKEDSGIQQ-VGGDssdt----slrsspSHPEVVSWPDGGMGSRGFGTEM  399
            K MK+LP   + E+SG++Q VG D        S ++  SHPEV SW  GG+   GFG  +
Sbjct  272  KTMKILPNASNGEESGVEQSVGEDMGTAGLGDSYKAVSSHPEVSSW-SGGISPGGFGHGI  330

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KP RLRTYVMSFDGETLQ++A IRSKEA++IIEKHTEALFGRPEI ITPQGT+DSSKDEL
Sbjct  331  KPCRLRTYVMSFDGETLQKFAAIRSKEAVSIIEKHTEALFGRPEIVITPQGTVDSSKDEL  390

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDS  126
            IKISF+ L+RLVLEAVTFGSFLWDVES VDS
Sbjct  391  IKISFNGLKRLVLEAVTFGSFLWDVESYVDS  421



>ref|XP_011047792.1| PREDICTED: uncharacterized protein LOC105142042 [Populus euphratica]
Length=418

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 176/217 (81%), Gaps = 9/217 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   ++ V QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  203  QLHSPEAYEMIQNHLTLILGNRVGDSTVVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MK LP G+D+ +S I + VG D        S ++  SHPE +S   GG+   GFG  
Sbjct  263  EKTMKTLPNGVDERESDIHKAVGQDVKPGGRGLSYQALSSHPEAIS---GGISPGGFGNG  319

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +K SRLR YVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTID+SKDE
Sbjct  320  LKASRLRNYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGTIDTSKDE  379

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            L+KIS   L+RL LEAVTFGSFLWDVES VDSRYHFV
Sbjct  380  LVKISLGGLKRLALEAVTFGSFLWDVESYVDSRYHFV  416



>ref|XP_009360040.1| PREDICTED: uncharacterized protein LOC103950540 isoform X2 [Pyrus 
x bretschneideri]
Length=430

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 179/220 (81%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR   +SS+ +I+KL++GQVYAASVMYGYFLKRVDQRFQL
Sbjct  212  QLHSPEAYEMIQNHLSLILGNRLGDSSSLAKISKLKIGQVYAASVMYGYFLKRVDQRFQL  271

Query  566  EKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  +DS I + VG     G   +T      SHPEV S   GG+   GFG 
Sbjct  272  EKTMKILPGAMGAKDSDIHKSVGEDMRPGSGGETLQAGVSSHPEVPSL-AGGISPGGFGN  330

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  331  ALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTVDSSKD  390

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            +LIKISF  LRRLVLE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  391  DLIKISFGGLRRLVLESVTFGSFLWDVESYVDSRYHFVAN  430



>ref|XP_009360039.1| PREDICTED: uncharacterized protein LOC103950540 isoform X1 [Pyrus 
x bretschneideri]
Length=431

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/220 (72%), Positives = 179/220 (81%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHLSLILGNR   +SS+ +I+KL++GQVYAASVMYGYFLKRVDQRFQL
Sbjct  213  QLHSPEAYEMIQNHLSLILGNRLGDSSSLAKISKLKIGQVYAASVMYGYFLKRVDQRFQL  272

Query  566  EKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  +DS I + VG     G   +T      SHPEV S   GG+   GFG 
Sbjct  273  EKTMKILPGAMGAKDSDIHKSVGEDMRPGSGGETLQAGVSSHPEVPSL-AGGISPGGFGN  331

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  332  ALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTVDSSKD  391

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            +LIKISF  LRRLVLE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  392  DLIKISFGGLRRLVLESVTFGSFLWDVESYVDSRYHFVAN  431



>ref|XP_010936872.1| PREDICTED: uncharacterized protein LOC105056391 [Elaeis guineensis]
Length=418

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 171/214 (80%), Gaps = 1/214 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSP+AYEMI++HL+LILG R  ++NS   I+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  205  RLHSPDAYEMIKSHLALILGQRLGDSNSVAPISKLRVGQVYAASVMYGYFLKRVDQRFQL  264

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK LP G D+E+  I+Q   D S  S +   SHPE             FG  +KP R
Sbjct  265  EKSMKSLPWGTDEEEDAIKQAMPDESRPSAQIGNSHPEASLESSPSFSQGAFGHSIKPCR  324

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYAT+RSKEA +IIEKHTEALFGRPEI ITPQGTIDSSKDELIKIS
Sbjct  325  LRSYVMSFDSETLQRYATVRSKEAFSIIEKHTEALFGRPEIVITPQGTIDSSKDELIKIS  384

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  385  FAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  418



>ref|XP_008393456.1| PREDICTED: uncharacterized protein LOC103455652 isoform X1 [Malus 
domestica]
Length=432

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 179/220 (81%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMI+NHLSLILGNR  ++ S  +I+KL+VGQVYAASVMYGYFLKRVDQRFQL
Sbjct  214  QLHSPEAYEMIRNHLSLILGNRLGDSTSLAKISKLKVGQVYAASVMYGYFLKRVDQRFQL  273

Query  566  EKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS I + VG     G   + S   + SHPEV S   GG+   GFG 
Sbjct  274  EKTMKILPGAMGAEDSDIHKSVGEDVRPGSGGEASQAGASSHPEVXSLA-GGVSPGGFGN  332

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  333  ALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTVDSSKD  392

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            +LIKISF  LRRL+LE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  393  DLIKISFGGLRRLILESVTFGSFLWDVESYVDSRYHFVAN  432



>ref|XP_008393457.1| PREDICTED: uncharacterized protein LOC103455652 isoform X2 [Malus 
domestica]
Length=431

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 179/220 (81%), Gaps = 8/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMI+NHLSLILGNR  ++ S  +I+KL+VGQVYAASVMYGYFLKRVDQRFQL
Sbjct  213  QLHSPEAYEMIRNHLSLILGNRLGDSTSLAKISKLKVGQVYAASVMYGYFLKRVDQRFQL  272

Query  566  EKNMKVLPQGLDKEDSGIQQ-VG-----GDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            EK MK+LP  +  EDS I + VG     G   + S   + SHPEV S   GG+   GFG 
Sbjct  273  EKTMKILPGAMGAEDSDIHKSVGEDVRPGSGGEASQAGASSHPEVXSLA-GGVSPGGFGN  331

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
             +K SRLRTYVMSFDGETL RYATIRS+EAI+IIEKHTEALFGRP+I ITPQGT+DSSKD
Sbjct  332  ALKHSRLRTYVMSFDGETLHRYATIRSREAISIIEKHTEALFGRPDIVITPQGTVDSSKD  391

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            +LIKISF  LRRL+LE+VTFGSFLWDVES VDSRYHFVA+
Sbjct  392  DLIKISFGGLRRLILESVTFGSFLWDVESYVDSRYHFVAN  431



>ref|XP_009408547.1| PREDICTED: uncharacterized protein LOC103990949 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHS EAYEMI+NHL+LILG R S+ N    I+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  201  RLHSAEAYEMIKNHLALILGQRTSDTNLVAPISKLRVGQVYAASVMYGYFLKRVDQRFQL  260

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK LP G D E+S I+Q   D S  S++    HPEV SW     G  G    MKP R
Sbjct  261  EKSMKTLPWGSDVEESAIKQAMIDESVPSVQPEIPHPEVSSWSSPSFGQGG----MKPCR  316

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD +TLQR+ATIRSKEA +IIEKHTEALFGRPEI ITP+G IDSSKDELIKIS
Sbjct  317  LRSYVMSFDSDTLQRHATIRSKEAFSIIEKHTEALFGRPEIVITPEGAIDSSKDELIKIS  376

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  377  FAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  410



>ref|XP_009408539.1| PREDICTED: uncharacterized protein LOC103990949 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=413

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 171/214 (80%), Gaps = 5/214 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHS EAYEMI+NHL+LILG R S+ N    I+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  204  RLHSAEAYEMIKNHLALILGQRTSDTNLVAPISKLRVGQVYAASVMYGYFLKRVDQRFQL  263

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK LP G D E+S I+Q   D S  S++    HPEV SW     G  G    MKP R
Sbjct  264  EKSMKTLPWGSDVEESAIKQAMIDESVPSVQPEIPHPEVSSWSSPSFGQGG----MKPCR  319

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD +TLQR+ATIRSKEA +IIEKHTEALFGRPEI ITP+G IDSSKDELIKIS
Sbjct  320  LRSYVMSFDSDTLQRHATIRSKEAFSIIEKHTEALFGRPEIVITPEGAIDSSKDELIKIS  379

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  380  FAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  413



>gb|AAK30572.1|AF346660_1 unknown [Brassica napus]
Length=256

 Score =   295 bits (754),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 177/212 (83%), Gaps = 6/212 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS E YEMI NHL+LILG R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  48   KLHSSEMYEMIHNHLALILGPRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  107

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK+L  GLD+  + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+KPSR
Sbjct  108  EKSMKLLTGGLDESKTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEIKPSR  162

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  163  LRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  222

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  223  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  254



>ref|XP_006374245.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52042.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=354

 Score =   298 bits (762),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 176/217 (81%), Gaps = 9/217 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   +++V QI+KLR+GQVYAASVMYGYFLKRVDQRFQL
Sbjct  139  QLHSPEAYEMIQNHLTLILGNRVGDSTAVAQISKLRIGQVYAASVMYGYFLKRVDQRFQL  198

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MK+LP G+D+ +S I + VG D        S ++  SHPE +S   GG+   GFG  
Sbjct  199  EKTMKILPNGVDETESDIHKAVGQDVKPGGRGLSYQALSSHPEAIS---GGISPGGFGHG  255

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +K SRLR YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTID+SKDE
Sbjct  256  LKASRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGTIDTSKDE  315

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            ++ IS   L+RL LEAVTFGSFLWDVES VDSRYHFV
Sbjct  316  VVTISLGGLKRLALEAVTFGSFLWDVESYVDSRYHFV  352



>ref|XP_009414789.1| PREDICTED: uncharacterized protein LOC103995816 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAYEMI+NHL+LILG R S++NS   I+KLR+GQVYAASVMYGYFLKRVDQRFQL
Sbjct  203  RLHSPEAYEMIKNHLALILGQRLSDSNSVAPISKLRIGQVYAASVMYGYFLKRVDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK LP G DKE+  I+Q   D S     S  S+PE+ SW   G      G   K S 
Sbjct  263  EKSMKTLPWGSDKEEIAIKQAMPDESRPFTESRISNPELPSWSSPGFNKGAVGNGAKSSL  322

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD +TLQRY TIRSKEA  IIEKHTEALFGRPEI ITPQGTIDSSKDELIKIS
Sbjct  323  LRSYVMSFDSDTLQRYVTIRSKEAFTIIEKHTEALFGRPEIVITPQGTIDSSKDELIKIS  382

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F  LRRL+LEA+TFGSFLWDVE  VDSRYHFV +
Sbjct  383  FGGLRRLILEAITFGSFLWDVEGYVDSRYHFVTN  416



>ref|XP_004137518.1| PREDICTED: uncharacterized protein LOC101203627 [Cucumis sativus]
 ref|XP_004167487.1| PREDICTED: uncharacterized protein LOC101228590 [Cucumis sativus]
Length=422

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHLSLILGNR S++ S VQI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  205  LHSPEAYEMIQNHLSLILGNRVSDSTSVVQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  264

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGS-RGFGTEM  399
            K +KVLP+  + EDS IQQ  G+        +      HPE+ SWPD    S  G    +
Sbjct  265  KTVKVLPKASNSEDSIIQQAIGEDVRPYVGENSPPVSPHPEIASWPDHDENSFGGVSQSV  324

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K SRLR YVM+FDGETLQRYATIRSKEA+ IIEKHTEALFGR EI ITPQGTID SKDE 
Sbjct  325  KASRLRNYVMAFDGETLQRYATIRSKEAVGIIEKHTEALFGRAEIVITPQGTIDPSKDEQ  384

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +KISF  L+ LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  385  LKISFGGLKGLVLEAVTFGSFLWDVESYVDSRYHFV  420



>ref|XP_009414790.1| PREDICTED: uncharacterized protein LOC103995816 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=407

 Score =   299 bits (765),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAYEMI+NHL+LILG R S++NS   I+KLR+GQVYAASVMYGYFLKRVDQRFQL
Sbjct  194  RLHSPEAYEMIKNHLALILGQRLSDSNSVAPISKLRIGQVYAASVMYGYFLKRVDQRFQL  253

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK LP G DKE+  I+Q   D S     S  S+PE+ SW   G      G   K S 
Sbjct  254  EKSMKTLPWGSDKEEIAIKQAMPDESRPFTESRISNPELPSWSSPGFNKGAVGNGAKSSL  313

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD +TLQRY TIRSKEA  IIEKHTEALFGRPEI ITPQGTIDSSKDELIKIS
Sbjct  314  LRSYVMSFDSDTLQRYVTIRSKEAFTIIEKHTEALFGRPEIVITPQGTIDSSKDELIKIS  373

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F  LRRL+LEA+TFGSFLWDVE  VDSRYHFV +
Sbjct  374  FGGLRRLILEAITFGSFLWDVEGYVDSRYHFVTN  407



>ref|XP_006374246.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374247.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ABK96147.1| unknown [Populus trichocarpa]
 gb|ERP52043.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52044.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=417

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 176/217 (81%), Gaps = 9/217 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   +++V QI+KLR+GQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  QLHSPEAYEMIQNHLTLILGNRVGDSTAVAQISKLRIGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MK+LP G+D+ +S I + VG D        S ++  SHPE +S   GG+   GFG  
Sbjct  262  EKTMKILPNGVDETESDIHKAVGQDVKPGGRGLSYQALSSHPEAIS---GGISPGGFGHG  318

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +K SRLR YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTID+SKDE
Sbjct  319  LKASRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGTIDTSKDE  378

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            ++ IS   L+RL LEAVTFGSFLWDVES VDSRYHFV
Sbjct  379  VVTISLGGLKRLALEAVTFGSFLWDVESYVDSRYHFV  415



>ref|XP_002533448.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28932.1| conserved hypothetical protein [Ricinus communis]
Length=392

 Score =   296 bits (758),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 171/214 (80%), Gaps = 24/214 (11%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAYEMIQNHL+LILGNR   +++V QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  RLHSPEAYEMIQNHLALILGNRVGDSTTVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK+LP  +D+ D+                       V+W  G + + GFG  +K SR
Sbjct  262  EKSMKILPSAVDEGDNN----------------------VAW-SGDVSAGGFGHGIKASR  298

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFDGETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGT+DSSKDELIKIS
Sbjct  299  LRSYVMSFDGETLQRYATIRSKEAVSIIEKHTEALFGRPEIIITPQGTVDSSKDELIKIS  358

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F  L+RLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  359  FGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVTN  392



>ref|XP_004981974.1| PREDICTED: uncharacterized protein LOC101781190 isoform X2 [Setaria 
italica]
Length=410

 Score =   296 bits (759),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHSPEAYEMI+NHL LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  198  RLHSPEAYEMIENHLDLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  257

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +KP RL
Sbjct  258  KSMKSLPWGSEEEDDALNQVMTTDSMPSTQASSSHPEMASWTSPNFSTGGPSQSIKPCRL  317

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+PE+ ITP+GT+DSSKDE I+ISF
Sbjct  318  RSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEALFGKPEVVITPEGTVDSSKDEHIRISF  377

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  378  AGLRRLILEAVTFGSFLWDVESFVDSRYHFVTN  410



>ref|XP_004981973.1| PREDICTED: uncharacterized protein LOC101781190 isoform X1 [Setaria 
italica]
Length=411

 Score =   296 bits (759),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHSPEAYEMI+NHL LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  199  RLHSPEAYEMIENHLDLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  258

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +KP RL
Sbjct  259  KSMKSLPWGSEEEDDALNQVMTTDSMPSTQASSSHPEMASWTSPNFSTGGPSQSIKPCRL  318

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+PE+ ITP+GT+DSSKDE I+ISF
Sbjct  319  RSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEALFGKPEVVITPEGTVDSSKDEHIRISF  378

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  379  AGLRRLILEAVTFGSFLWDVESFVDSRYHFVTN  411



>ref|XP_010465837.1| PREDICTED: uncharacterized protein LOC104746127 [Camelina sativa]
Length=410

 Score =   296 bits (759),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 173/212 (82%), Gaps = 8/212 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  204  QLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  263

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP GLD   + + Q           +  SHPEV ++  GG+ ++GFG+E+KPSR
Sbjct  264  EKTMKILPGGLDDSKTSVDQT------ERPSAVSSHPEVGAF-AGGVSAKGFGSEIKPSR  316

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI +TP+GT+DSSKDE I IS
Sbjct  317  LRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPEIVLTPEGTVDSSKDEQINIS  376

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  377  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  408



>dbj|BAJ34170.1| unnamed protein product [Thellungiella halophila]
Length=419

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 177/213 (83%), Gaps = 7/213 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMI NHL+LILG+R    SSV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  210  RLHSPEMYEMIHNHLALILGSRMGDLSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  269

Query  566  EKNMKVLPQGL-DKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            EK MK+LP G  D+  + ++Q      D + ++  SHPEV S+  GG+ ++GFG+E+KPS
Sbjct  270  EKTMKILPGGSSDESKTSVEQ----PEDMTYKAVSSHPEVGSFA-GGVSAKGFGSEIKPS  324

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITPQGT+DSSKDE IKI
Sbjct  325  RLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPQGTVDSSKDEQIKI  384

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            SF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  385  SFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  417



>ref|XP_010487675.1| PREDICTED: uncharacterized protein LOC104765624 [Camelina sativa]
Length=409

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 173/212 (82%), Gaps = 8/212 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  203  QLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP GLD   + + Q           +  SHPEV ++  GG+ ++GFG+E+KPSR
Sbjct  263  EKTMKILPGGLDDSKTSVDQT------ERPSAVSSHPEVGAFA-GGVSAKGFGSEIKPSR  315

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI +TP+GT+DSSKDE I IS
Sbjct  316  LRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPEIVLTPEGTVDSSKDEQINIS  375

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  376  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  407



>ref|XP_010271178.1| PREDICTED: uncharacterized protein LOC104607271 [Nelumbo nucifera]
Length=424

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 175/221 (79%), Gaps = 9/221 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR   +S++ QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  205  QLHSTEAYEMIQNHLALILGNRVADSSTIAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  264

Query  566  EKNMKVLPQGLDKEDSGIQQVGGD-------ssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK MK+LP   D+E    Q V G        SS+ S  +  +HPEV S P G   S GFG
Sbjct  265  EKTMKILPYASDEESDTEQAVAGQMNPSGNKSSEASSHAEQTHPEVSSSP-GNFSSGGFG  323

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
              +K SRLRTYVMSFD +TLQRYATIRSKE ++IIEKHTEALFGRPEI ITPQGT+DSSK
Sbjct  324  YGVKSSRLRTYVMSFDADTLQRYATIRSKEGVSIIEKHTEALFGRPEIVITPQGTVDSSK  383

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            DE I+ISF  L+RLVLEAVTFGSFLWDVES VD RYHFVA+
Sbjct  384  DEQIRISFGGLKRLVLEAVTFGSFLWDVESYVDLRYHFVAN  424



>emb|CDX95820.1| BnaC05g35710D [Brassica napus]
Length=415

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 176/212 (83%), Gaps = 6/212 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS E YEMI NHL+LILG R    +S+ QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  207  KLHSSEMYEMIHNHLALILGPRMGDLASIAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  266

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK+LP GLD   + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+KPSR
Sbjct  267  EKSMKILPGGLDDSKTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEIKPSR  321

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LRTYVMSFD ETLQRYATIRS+E + IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  322  LRTYVMSFDSETLQRYATIRSREGVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  381

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  382  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>ref|XP_006406690.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
 gb|ESQ48143.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
Length=466

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 177/213 (83%), Gaps = 7/213 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMI NHL+LILG+R    SSV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  257  RLHSPEMYEMIHNHLALILGSRMGDLSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  316

Query  566  EKNMKVLPQGL-DKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            EK MK+LP G  D+  + ++Q      D + ++  SHPEV S+  GG+ ++GFG+E+KPS
Sbjct  317  EKTMKILPGGSSDESKTSVEQ----PEDMTYKAVSSHPEVGSF-AGGVSAKGFGSEIKPS  371

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITPQGT+DSSKDE IKI
Sbjct  372  RLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPQGTVDSSKDEQIKI  431

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            SF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  432  SFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  464



>ref|XP_006297794.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
 gb|EOA30692.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
Length=412

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 177/212 (83%), Gaps = 5/212 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMI NHL+LILG+R    +SV +I+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  203  QLHSPEMYEMIHNHLALILGSRIGDLASVARISKLRVGQVYAASVMYGYFLKRVDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP GLD+ ++ + Q  G  +  ++ S   HPEV S+  GG+ ++GFG+E+KPSR
Sbjct  263  EKTMKILPGGLDESNASVDQTEGPKTYQAVSS---HPEVGSF-AGGVSAKGFGSEIKPSR  318

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQ+YATIRS+EA+ IIEKHTEALFG+PEI +TP+GT+DSSKDE I IS
Sbjct  319  LRSYVMSFDAETLQKYATIRSREAVKIIEKHTEALFGKPEIVLTPEGTVDSSKDEQINIS  378

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  379  FGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  410



>gb|KJB53076.1| hypothetical protein B456_008G292100 [Gossypium raimondii]
Length=411

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 173/219 (79%), Gaps = 19/219 (9%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQ+HL+LILGNR N + SV QI+KLRVGQVYAASVMYGYFLKRVD+RFQL
Sbjct  202  QLHSPEAYEMIQSHLALILGNRLNDSKSVAQISKLRVGQVYAASVMYGYFLKRVDERFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQV-------GGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK MK+LP G D E S I++         GD    S      H EV SW      S GFG
Sbjct  262  EKTMKILPNGSDSEGSSIEKAVREDIRPAGDYLAVSS-----HLEVSSW------SGGFG  310

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
              +KPSRLRTY+MSFDG+TLQR+ATIRSKEA++IIEK TEALFGRPEI +TPQGT+DSSK
Sbjct  311  NRIKPSRLRTYLMSFDGDTLQRFATIRSKEAVSIIEKQTEALFGRPEIVLTPQGTVDSSK  370

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DELIKISF  LR+LVLEA+TFGSFLWD ES VDSRYHFV
Sbjct  371  DELIKISFGGLRKLVLEAITFGSFLWDGESFVDSRYHFV  409



>gb|KFK39108.1| hypothetical protein AALP_AA3G202000 [Arabis alpina]
Length=418

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 175/212 (83%), Gaps = 6/212 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHS E YEMI NHL+LILG+R    +SV +I+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  210  RLHSTEMYEMIHNHLALILGSRMGDLTSVAEISKLRVGQVYAASVMYGYFLKRVDQRFQL  269

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP GLD   + ++Q      + + ++  SHPEV S+  GG+  +GFG+E+KPSR
Sbjct  270  EKTMKILPGGLDDSKTSVEQA----EEVTKKTVSSHPEVGSFA-GGVSPKGFGSEIKPSR  324

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LRTYVMSFDGETLQ+YATIRS+EA+ IIEKHTEALFG+PEI I+P GT+DSSKDE IKIS
Sbjct  325  LRTYVMSFDGETLQKYATIRSREAVGIIEKHTEALFGKPEIVISPDGTVDSSKDEQIKIS  384

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  385  FGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  416



>ref|XP_002317709.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 ref|XP_006376704.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ABK95039.1| unknown [Populus trichocarpa]
 gb|EEE95929.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ERP54501.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
Length=401

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 169/212 (80%), Gaps = 15/212 (7%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAY+MIQNHL+LILGNR   +++V QINKLR GQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  RLHSPEAYDMIQNHLALILGNRMGDSTAVAQINKLRAGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP  +D+ ++ I++V             SHPE  S    G+   G G  +K SR
Sbjct  262  EKTMKILPNAVDEGETDIRKV-----------VSSHPEAFS---DGVSPGGLGHGLKASR  307

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR YVMSFDGETLQRYATIRSKEA+++IEKHTEALFGRPEI I  QGTIDSSKDEL+KIS
Sbjct  308  LRNYVMSFDGETLQRYATIRSKEAVSLIEKHTEALFGRPEIVIALQGTIDSSKDELVKIS  367

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  368  FGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  399



>ref|XP_010505920.1| PREDICTED: uncharacterized protein LOC104782624 [Camelina sativa]
Length=409

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 173/212 (82%), Gaps = 8/212 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  203  QLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP GLD   + + Q           +  SHPEV ++  GG+ ++GFG+E+KPSR
Sbjct  263  EKTMKILPGGLDDNKTSVDQT------ERPSAVSSHPEVGAFA-GGVSAKGFGSEIKPSR  315

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+P+I +TP+GT+DSSKDE I IS
Sbjct  316  LRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPDIVLTPEGTVDSSKDEQINIS  375

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  376  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  407



>gb|KGN64195.1| hypothetical protein Csa_1G042990 [Cucumis sativus]
Length=588

 Score =   300 bits (767),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 170/216 (79%), Gaps = 6/216 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHLSLILGNR S++ S VQI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  371  LHSPEAYEMIQNHLSLILGNRVSDSTSVVQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  430

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGSRG-FGTEM  399
            K +KVLP+  + EDS IQQ  G+        +      HPE+ SWPD    S G     +
Sbjct  431  KTVKVLPKASNSEDSIIQQAIGEDVRPYVGENSPPVSPHPEIASWPDHDENSFGGVSQSV  490

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K SRLR YVM+FDGETLQRYATIRSKEA+ IIEKHTEALFGR EI ITPQGTID SKDE 
Sbjct  491  KASRLRNYVMAFDGETLQRYATIRSKEAVGIIEKHTEALFGRAEIVITPQGTIDPSKDEQ  550

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +KISF  L+ LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  551  LKISFGGLKGLVLEAVTFGSFLWDVESYVDSRYHFV  586



>emb|CDX92162.1| BnaA05g22450D [Brassica napus]
Length=415

 Score =   294 bits (753),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 177/212 (83%), Gaps = 6/212 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS E YEMI NHL+LILG R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  207  KLHSSEMYEMIHNHLALILGPRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  266

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK+L  GLD+  + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+KPSR
Sbjct  267  EKSMKLLTGGLDESKTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEIKPSR  321

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  322  LRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  381

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  382  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>gb|KHG07714.1| Ribosomal L11 methyltransferase [Gossypium arboreum]
Length=340

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 172/219 (79%), Gaps = 19/219 (9%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQ+HL+LILGNR N + SV QI+K+RVGQVYAASVMYGYFLKRVD+RFQL
Sbjct  131  QLHSPEAYEMIQSHLALILGNRLNDSKSVAQISKIRVGQVYAASVMYGYFLKRVDERFQL  190

Query  566  EKNMKVLPQGLDKEDSGIQQV-------GGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK MK+LP G D E S I++         GD    S      H EV SW      S GFG
Sbjct  191  EKTMKILPNGSDSEGSSIEKAIREDIRPAGDYLVVSS-----HLEVSSW------SGGFG  239

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
              +KPSRLRTY+MSFDG+ LQR+ATIRSKEA++IIEK TEALFGRPEI +TPQGT+DSSK
Sbjct  240  NRIKPSRLRTYLMSFDGDILQRFATIRSKEAVSIIEKQTEALFGRPEIVLTPQGTVDSSK  299

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DELIKISF  L++LVLEA+TFGSFLWD ES VDSRYHFV
Sbjct  300  DELIKISFGGLKKLVLEAITFGSFLWDGESFVDSRYHFV  338



>ref|XP_009145975.1| PREDICTED: uncharacterized protein LOC103869650 [Brassica rapa]
Length=415

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 176/212 (83%), Gaps = 6/212 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LH  E YEMI NHL+LILG R    +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  207  KLHPSEMYEMIHNHLALILGPRMGDLASVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  266

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK+MK+L  GLD+  + ++Q      + + ++  SHPEV S+  GG+ ++GFG+E+KPSR
Sbjct  267  EKSMKLLSGGLDESKTSVEQ----PENVTFKAVSSHPEVGSFA-GGVSAKGFGSEIKPSR  321

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKIS
Sbjct  322  LRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKIS  381

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  382  FGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>ref|XP_011464472.1| PREDICTED: uncharacterized protein LOC101299089 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=412

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 176/215 (82%), Gaps = 3/215 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAYEMIQNHLSLILGNR + ++S+ QI+KL+VGQVYAASVMYGYFLKRVDQRFQL
Sbjct  199  RLHSPEAYEMIQNHLSLILGNRLDDSTSLAQISKLKVGQVYAASVMYGYFLKRVDQRFQL  258

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            EK MK+LP  L  EDS I++ VG D     + +S SHPEV SW  G          +KPS
Sbjct  259  EKTMKILPGSLGGEDSDIEKAVGEDKRLGGVDNSASHPEVSSWSGGLGSGGFGNL-IKPS  317

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLRTYVMS DGETLQRYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSS DE IKI
Sbjct  318  RLRTYVMSVDGETLQRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSNDEHIKI  377

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            SF  L+RLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  378  SFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVTN  412



>ref|XP_004299503.1| PREDICTED: uncharacterized protein LOC101299089 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=413

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 176/215 (82%), Gaps = 3/215 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAYEMIQNHLSLILGNR + ++S+ QI+KL+VGQVYAASVMYGYFLKRVDQRFQL
Sbjct  200  RLHSPEAYEMIQNHLSLILGNRLDDSTSLAQISKLKVGQVYAASVMYGYFLKRVDQRFQL  259

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            EK MK+LP  L  EDS I++ VG D     + +S SHPEV SW  G          +KPS
Sbjct  260  EKTMKILPGSLGGEDSDIEKAVGEDKRLGGVDNSASHPEVSSWSGGLGSGGFGNL-IKPS  318

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLRTYVMS DGETLQRYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSS DE IKI
Sbjct  319  RLRTYVMSVDGETLQRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSNDEHIKI  378

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            SF  L+RLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  379  SFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVTN  413



>ref|NP_175278.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79715.1|AC020889_23 T1N15.6 [Arabidopsis thaliana]
 gb|AAL57686.1| At1g48450/T1N15_5 [Arabidopsis thaliana]
 gb|AAN41342.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32293.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=423

 Score =   292 bits (748),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 178/219 (81%), Gaps = 8/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  203  RLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGD-------ssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK M++LP G D+ ++ I+Q G D        ++ + ++  S+ +V S+  G   S GF 
Sbjct  263  EKTMRILPGGSDEGETSIEQAGRDVERNFYEEAEETYQAVSSNQDVGSFVGGINASGGFS  322

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            ++MK SRL+TYVMSFDGETLQRYATIRS+E++ IIEKHTEALFGRPEI ITPQGTIDSSK
Sbjct  323  SDMKQSRLKTYVMSFDGETLQRYATIRSRESVGIIEKHTEALFGRPEIVITPQGTIDSSK  382

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  383  DEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  421



>emb|CDX75937.1| BnaC03g40200D [Brassica napus]
Length=414

 Score =   292 bits (747),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 172/214 (80%), Gaps = 12/214 (6%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMI NHL+LILG+R  +  S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  208  QLHSPEMYEMIHNHLALILGSRIGDLTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  267

Query  566  EKNMKVLPQ--GLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            EK MK+LP   G D+  S ++Q            +  HPEV S+  GG+ ++GFG+E+KP
Sbjct  268  EKTMKLLPGSGGADESKSSVEQ--------PEDVTSIHPEVGSF-AGGVSAKGFGSEIKP  318

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
            SRLRTYVMSFD ETLQRYATIRS+EA+ I+EKHTEALFG+PEI ITPQGT+DSSK+E IK
Sbjct  319  SRLRTYVMSFDSETLQRYATIRSREAVGIVEKHTEALFGKPEIVITPQGTVDSSKEEQIK  378

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            ISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  379  ISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  412



>gb|AFK42768.1| unknown [Lotus japonicus]
Length=412

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 171/216 (79%), Gaps = 7/216 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHLSLILGNR+   +S+ QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  197  QLHSYEAYEMIQNHLSLILGNRAGDLTSIAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  256

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK MKVLP     EDS + +   D +      +     SHPE+  W  G +   GFG+ +
Sbjct  257  EKTMKVLPNA--AEDSSVHKPVKDDARPGNGENTSQVMSHPELSPWLGGDVSPGGFGSGI  314

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPE +ITP+G IDSSKDE 
Sbjct  315  KPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEFAITPEGAIDSSKDEN  374

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF  L+RLVLEAVTFGSFLWDVES V+S YHFV
Sbjct  375  IKISFGGLKRLVLEAVTFGSFLWDVESYVESSYHFV  410



>ref|XP_006393405.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
 gb|ESQ30691.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
Length=426

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 176/219 (80%), Gaps = 8/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR    ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  206  RLHSPEVYEMIQNHLSIILKNRVGDLTTVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  265

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK MK+LP G D+ ++ I+Q G ++       ++ + ++  S+ EV S+  G   S GF 
Sbjct  266  EKTMKILPGGSDEGETSIEQAGRETERSFYEEAEETYQAVSSNREVGSFVGGINASGGFS  325

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            +E K SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSSK
Sbjct  326  SETKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIVITPQGTIDSSK  385

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  386  DEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  424



>ref|XP_011003767.1| PREDICTED: uncharacterized protein LOC105110429 [Populus euphratica]
Length=401

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 168/212 (79%), Gaps = 15/212 (7%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAY+MIQNHL+LILGNR   +++V QINKLR GQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  RLHSPEAYDMIQNHLALILGNRMGDSTAVAQINKLRAGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP  +D+ ++ I++V             SHPE  S    G+   G G  +K SR
Sbjct  262  EKTMKILPNAVDEGETDIRKV-----------VSSHPEAFS---DGISPGGSGHGLKASR  307

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR YVMSFDGETLQRYATIRSKEA+++IEKHTEALFGRPEI I  QGT DSSKDEL+KIS
Sbjct  308  LRNYVMSFDGETLQRYATIRSKEAVSLIEKHTEALFGRPEIVIALQGTTDSSKDELVKIS  367

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  368  FGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  399



>gb|ACF87802.1| unknown [Zea mays]
 tpg|DAA51042.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=423

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 167/211 (79%), Gaps = 0/211 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  211  RLHSHEAYEMIENHLTLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  270

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K MK LP G ++EDS + QV       S ++S SHPE+ SW      + G    +KP RL
Sbjct  271  KTMKGLPWGSEEEDSALNQVMMTDLMPSAQTSSSHPEMGSWTAPAFSTGGPSQSIKPCRL  330

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE I+ISF
Sbjct  331  RSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEALFGKPEIVITPEGTLDSSKDEHIRISF  390

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            + LRRL+LEAVTFGSFLWDVES VDSRYHFV
Sbjct  391  AGLRRLILEAVTFGSFLWDVESFVDSRYHFV  421



>ref|NP_001143815.1| uncharacterized protein LOC100276591 [Zea mays]
 gb|ACG35630.1| hypothetical protein [Zea mays]
Length=424

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 167/211 (79%), Gaps = 0/211 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  212  RLHSHEAYEMIENHLTLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  271

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K MK LP G ++EDS + QV       S ++S SHPE+ SW      + G    +KP RL
Sbjct  272  KTMKGLPWGSEEEDSALNQVMMTDLMPSAQTSSSHPEMGSWTAPAFSTGGPSQSIKPCRL  331

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE I+ISF
Sbjct  332  RSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEALFGKPEIVITPEGTLDSSKDEHIRISF  391

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            + LRRL+LEAVTFGSFLWDVES VDSRYHFV
Sbjct  392  AGLRRLILEAVTFGSFLWDVESFVDSRYHFV  422



>gb|ABF98565.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG87500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 169/213 (79%), Gaps = 1/213 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            ++HS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  117  KMHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  176

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +KP RL
Sbjct  177  KSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTSTSHPEMASWTSPNFSAGGPSQSVKPCRL  235

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD ETLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF
Sbjct  236  RSYVMSFDSETLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHVRISF  295

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  296  AGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  328



>ref|XP_007209930.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
 gb|EMJ11129.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
Length=502

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 182/219 (83%), Gaps = 7/219 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILG+R  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  285  QLHSPEAYEMIQNHLALILGSRLGDSASLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  344

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDs----sdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK +K+LP  L  EDS +Q+ VG D      + SL++  SHPEV SW  GG+   GFG  
Sbjct  345  EKTVKILPNALGAEDSNVQKSVGEDMRPGGEEESLQAGASHPEVTSW-GGGISPGGFGNG  403

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD+
Sbjct  404  IKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKDD  463

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
             +KISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  464  HVKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVTN  502



>ref|XP_008240405.1| PREDICTED: uncharacterized protein LOC103338912 [Prunus mume]
Length=428

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 183/219 (84%), Gaps = 7/219 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR  ++ S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  211  QLHSPEAYEMIQNHLALILGNRLGDSASLAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  270

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDs----sdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK +K+LP  L  EDS +Q+ VG D      + SL++  SHPEV S   GG+G+ GFG  
Sbjct  271  EKTVKILPNALGAEDSNVQKSVGEDMRPGGEEESLQAGASHPEVTSS-AGGIGAGGFGNG  329

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLRTYVMSFDGETL RYATIRS+EA++IIEKHTEALFGRP+I ITPQGT+DSSKD+
Sbjct  330  IKPSRLRTYVMSFDGETLHRYATIRSREAVSIIEKHTEALFGRPDIVITPQGTVDSSKDD  389

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
             +KISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  390  HVKISFGGLRRLVLEAVTFGSFLWDVESYVDSRYHFVTN  428



>ref|XP_010549033.1| PREDICTED: uncharacterized protein LOC104820333 isoform X1 [Tarenaya 
hassleriana]
Length=413

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 176/213 (83%), Gaps = 3/213 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAYEMIQNHL++ILGNR    SSV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  200  RLHSPEAYEMIQNHLTIILGNRLGDPSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  259

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            EK MK+LP G D+ +  I+Q   G    ++      HPEV S+  GG+   GFG+ +KPS
Sbjct  260  EKTMKILPGGSDEGEGSIEQSAPGTERISNGDGGTYHPEVGSF-AGGISGGGFGSGLKPS  318

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLRTYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITP+GT+DSS+DE IKI
Sbjct  319  RLRTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIMITPEGTVDSSRDEHIKI  378

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            SF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  379  SFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  411



>ref|XP_010549034.1| PREDICTED: uncharacterized protein LOC104820333 isoform X2 [Tarenaya 
hassleriana]
Length=412

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 176/213 (83%), Gaps = 3/213 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPEAYEMIQNHL++ILGNR    SSV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  199  RLHSPEAYEMIQNHLTIILGNRLGDPSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  258

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            EK MK+LP G D+ +  I+Q   G    ++      HPEV S+  GG+   GFG+ +KPS
Sbjct  259  EKTMKILPGGSDEGEGSIEQSAPGTERISNGDGGTYHPEVGSF-AGGISGGGFGSGLKPS  317

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLRTYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITP+GT+DSS+DE IKI
Sbjct  318  RLRTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIMITPEGTVDSSRDEHIKI  377

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            SF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  378  SFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  410



>ref|XP_002894114.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70373.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 179/219 (82%), Gaps = 8/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  206  RLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  265

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK+M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV S+  G   S GF 
Sbjct  266  EKSMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGSFVGGINASGGFS  325

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            ++MK SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSSK
Sbjct  326  SDMKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIVITPQGTIDSSK  385

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  386  DEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  424



>ref|XP_010500371.1| PREDICTED: uncharacterized protein LOC104777762 [Camelina sativa]
Length=429

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 177/219 (81%), Gaps = 8/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  209  RLHSPEVYEMIQNHLSIILKNRTDDLAAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  268

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV S+  G   S GF 
Sbjct  269  EKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGSFVGGINASGGFS  328

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSSK
Sbjct  329  SEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEILITPQGTIDSSK  388

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  389  DEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  427



>ref|XP_010461662.1| PREDICTED: uncharacterized protein LOC104742359 isoform X1 [Camelina 
sativa]
 ref|XP_010461663.1| PREDICTED: uncharacterized protein LOC104742359 isoform X2 [Camelina 
sativa]
 ref|XP_010461664.1| PREDICTED: uncharacterized protein LOC104742359 isoform X3 [Camelina 
sativa]
Length=428

 Score =   290 bits (741),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 177/219 (81%), Gaps = 8/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  208  RLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  267

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV S+  G   S GF 
Sbjct  268  EKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGSFVGGINASGGFS  327

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSSK
Sbjct  328  SEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEILITPQGTIDSSK  387

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  388  DEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  426



>gb|KJB30250.1| hypothetical protein B456_005G134400 [Gossypium raimondii]
Length=422

 Score =   289 bits (740),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 182/217 (84%), Gaps = 7/217 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            ++HS EA+EMIQNH++LILGNR   ++SV QI+KLRVGQVYAASVMYGYFL+RVDQRFQL
Sbjct  205  QIHSAEAHEMIQNHVALILGNRLGESTSVAQISKLRVGQVYAASVMYGYFLRRVDQRFQL  264

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssd-----tslrsspSHPEVVSWPDGGMGSRGFGTE  402
            E+ MKVLP   D + S I+Q  GD +       S +++ SHPEV SW  GG+ S GFG+ 
Sbjct  265  ERTMKVLPSASDDDKSSIEQTVGDDTRPSGLGDSYQAASSHPEVSSW-SGGISSGGFGSG  323

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLRTYVMSFDGETLQRYA+IRSKEA+ IIEKHTEALFGRPEI+ITPQGT+DSS DE
Sbjct  324  IKPSRLRTYVMSFDGETLQRYASIRSKEAVGIIEKHTEALFGRPEIAITPQGTVDSSNDE  383

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            LIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  384  LIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  420



>ref|XP_010479269.1| PREDICTED: uncharacterized protein LOC104758146 [Camelina sativa]
Length=429

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 176/219 (80%), Gaps = 8/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  + V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  209  RLHSPEVYEMIQNHLSIILKNRTDDLTGVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  268

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK M++LP G  + ++ I+Q G ++       ++ + ++  S+ EV S+  G   S GF 
Sbjct  269  EKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGSFVGGINASGGFS  328

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSSK
Sbjct  329  SEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEILITPQGTIDSSK  388

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  389  DEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  427



>dbj|BAJ85118.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 167/213 (78%), Gaps = 2/213 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVD+RFQLE
Sbjct  198  RLHSHEAYEMIENHLNLILGQRQADGTVAAISKLRVGQVYAASVMYGYFLKRVDKRFQLE  257

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G   ED  + QV    S  S ++  SHPEV SW    + + G G  +KPSRL
Sbjct  258  KSMKSLPWG--SEDDTLNQVMTTDSRPSDQTYSSHPEVESWTSPDLSAGGLGQSVKPSRL  315

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQ YATIRSK A  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF
Sbjct  316  RSYVMSFDSDTLQTYATIRSKVAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEYVRISF  375

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            S LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  376  SGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  408



>ref|XP_006306266.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
 gb|EOA39164.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
Length=421

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 176/219 (80%), Gaps = 8/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  201  RLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  260

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK M++LP G    ++ I+Q G ++       ++ + ++  S+ EV S+  G   S GF 
Sbjct  261  EKTMRILPGGSYDGETSIEQAGPETERSFYEEAEETYQAVSSNQEVGSFVGGINASGGFS  320

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            +E+  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSSK
Sbjct  321  SEINQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEILITPQGTIDSSK  380

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  381  DEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  419



>gb|EAY91660.1| hypothetical protein OsI_13299 [Oryza sativa Indica Group]
 gb|EAZ28380.1| hypothetical protein OsJ_12360 [Oryza sativa Japonica Group]
Length=413

 Score =   286 bits (733),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 169/213 (79%), Gaps = 1/213 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            ++HS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  202  KMHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  261

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +KP RL
Sbjct  262  KSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTSTSHPEMASWTSPNFSAGGPSQSVKPCRL  320

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD ETLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF
Sbjct  321  RSYVMSFDSETLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHVRISF  380

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  381  AGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  413



>ref|XP_006374243.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374244.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52040.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52041.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=424

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 171/212 (81%), Gaps = 9/212 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPEAYEMIQNHL+LILGNR   +++V QI+KLR+GQVYAASVMYGYFLKRVDQRFQL
Sbjct  202  QLHSPEAYEMIQNHLTLILGNRVGDSTAVAQISKLRIGQVYAASVMYGYFLKRVDQRFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQ-VGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTE  402
            EK MK+LP G+D+ +S I + VG D        S ++  SHPE +S   GG+   GFG  
Sbjct  262  EKTMKILPNGVDETESDIHKAVGQDVKPGGRGLSYQALSSHPEAIS---GGISPGGFGHG  318

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +K SRLR YVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTID+SKDE
Sbjct  319  LKASRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIVITPQGTIDTSKDE  378

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  126
            ++ IS   L+RL LEAVTFGSFLWDVES VDS
Sbjct  379  VVTISLGGLKRLALEAVTFGSFLWDVESYVDS  410



>gb|KFK36092.1| hypothetical protein AALP_AA4G076400 [Arabis alpina]
Length=424

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 171/220 (78%), Gaps = 9/220 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR    S+V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  203  RLHSPEVYEMIQNHLSIILKNRVGDLSTVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrs--------spSHPEVVSWPDGGMGSRGF  411
            EK MK+LP   D+ ++ I+Q G ++  +              S+ EV S+  G   S GF
Sbjct  263  EKTMKILPGWSDEGETSIEQAGRETERSRSYEEAEETYEAVSSNQEVGSFVGGINASGGF  322

Query  410  GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  231
             ++MK SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQGTIDSS
Sbjct  323  SSDMKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIMITPQGTIDSS  382

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  383  NDEHIKISFHGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  422



>ref|NP_001051084.1| Os03g0717900 [Oryza sativa Japonica Group]
 gb|ABF98564.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12998.1| Os03g0717900 [Oryza sativa Japonica Group]
 dbj|BAG94154.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 169/213 (79%), Gaps = 1/213 (0%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            ++HS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  244  KMHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  303

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G ++ED  + QV    S  S ++S SHPE+ SW      + G    +KP RL
Sbjct  304  KSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTSTSHPEMASWTSPNFSAGGPSQSVKPCRL  362

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD ETLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF
Sbjct  363  RSYVMSFDSETLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHVRISF  422

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  423  AGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  455



>emb|CDX82345.1| BnaA03g34760D [Brassica napus]
Length=406

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 166/212 (78%), Gaps = 14/212 (7%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMI NHL+LILG+R  +  S  QI+KLRVGQVYAASV+YGYFLKRVDQRFQL
Sbjct  206  QLHSPEMYEMIHNHLALILGSRIGDLTSVAQISKLRVGQVYAASVIYGYFLKRVDQRFQL  265

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP     E+   + V              HPEV S+  GG+ ++GFG+E+KPSR
Sbjct  266  EKTMKLLPGSGGAEEKQPEDVSS------------HPEVGSF-AGGVSAKGFGSEIKPSR  312

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITPQG +DSS DE IKIS
Sbjct  313  LRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPQGIVDSSNDEQIKIS  372

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  373  FGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  404



>ref|XP_003530975.1| PREDICTED: uncharacterized protein LOC100793300 [Glycine max]
 gb|KHN00132.1| hypothetical protein glysoja_028660 [Glycine soja]
Length=404

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 169/214 (79%), Gaps = 6/214 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHS EAYEMIQNHL+LILGNR+   +S+ +I+K RVGQVYAASVMYGYFL+RVDQRFQLE
Sbjct  191  LHSHEAYEMIQNHLALILGNRAGDLTSIAEISKFRVGQVYAASVMYGYFLRRVDQRFQLE  250

Query  563  KNMKVLPQGLDKEDSGIQQVGGDss---dtslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            K MKVLP   +KE+S  Q    ++    +       SHPEV +WP G +   GFG  +K 
Sbjct  251  KTMKVLPNATEKENSAHQTTMDNARPSIEEDTSQVMSHPEVSTWPGGDVRPGGFGYGVKA  310

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
            +RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPEI +TP+G +  SKDE IK
Sbjct  311  TRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPEGAV--SKDENIK  368

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            ISF  L++LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  369  ISFGGLKKLVLEAVTFGSFLWDVESYVDSRYHFV  402



>ref|XP_004503251.1| PREDICTED: uncharacterized protein LOC101489103 [Cicer arietinum]
Length=401

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 170/216 (79%), Gaps = 7/216 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR+   +SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  186  QLHSTEAYEMIQNHLALILGNRAGDLTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  245

Query  566  EKNMKVLPQGLDKEDSGIQQV----GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK++K+LP     E+S + Q         S+       SHPEV +W  G +   GFG+ +
Sbjct  246  EKSIKILPNS--AEESSVHQTIINDARPHSEVDTSQVKSHPEVSTWLGGDVSPGGFGSGI  303

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPE+ ITP+G ID SKDE 
Sbjct  304  KPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEMVITPEGAIDRSKDEN  363

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF  L+RLVLEAVTFG FLWDVES V+SRY FV
Sbjct  364  IKISFGGLKRLVLEAVTFGCFLWDVESYVESRYQFV  399



>ref|XP_003560595.1| PREDICTED: uncharacterized protein LOC100829350 [Brachypodium 
distachyon]
Length=413

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 165/213 (77%), Gaps = 2/213 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  203  RLHSHEAYEMIENHLNLILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  262

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G   +D  + QV    S  S  +  SHPE+ SW    + + G G  +KP RL
Sbjct  263  KSMKSLPWG--SQDDALNQVMMTDSRPSTEAYSSHPEMESWTSSDLSAGGLGQSIKPCRL  320

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQ YATIRSK A  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF
Sbjct  321  RSYVMSFDSDTLQSYATIRSKVAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHVRISF  380

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  381  AGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  413



>tpg|DAA51043.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=204

 Score =   276 bits (705),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = -2

Query  716  MIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQG  537
            MI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G
Sbjct  1    MIENHLTLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKGLPWG  60

Query  536  LDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDG  357
             ++EDS + QV       S ++S SHPE+ SW      + G    +KP RLR+YVMSFD 
Sbjct  61   SEEEDSALNQVMMTDLMPSAQTSSSHPEMGSWTAPAFSTGGPSQSIKPCRLRSYVMSFDS  120

Query  356  ETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLE  177
            +TLQRYAT+RSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE I+ISF+ LRRL+LE
Sbjct  121  DTLQRYATVRSKEAFGIIEKHTEALFGKPEIVITPEGTLDSSKDEHIRISFAGLRRLILE  180

Query  176  AVTFGSFLWDVESSVDSRYHFV  111
            AVTFGSFLWDVES VDSRYHFV
Sbjct  181  AVTFGSFLWDVESFVDSRYHFV  202



>ref|XP_009135549.1| PREDICTED: uncharacterized protein LOC103859727 [Brassica rapa]
Length=408

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 165/212 (78%), Gaps = 14/212 (7%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMI NHL+LILG+R  +  S  Q +KLRVGQVYAASV+YGYFLKRVDQRFQL
Sbjct  208  QLHSPEMYEMIHNHLALILGSRIGDLTSVAQTSKLRVGQVYAASVIYGYFLKRVDQRFQL  267

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK+LP     E+   + V              HPEV S+  GG+ ++GFG+E+KPSR
Sbjct  268  EKTMKLLPGSGGAEEKQPEDVSS------------HPEVGSF-AGGVSAKGFGSEIKPSR  314

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITPQG +DSS DE IKIS
Sbjct  315  LRTYVMSFDSETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPQGIVDSSNDEQIKIS  374

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  375  FGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  406



>ref|XP_006650499.1| PREDICTED: uncharacterized protein LOC102715191 [Oryza brachyantha]
Length=327

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 165/213 (77%), Gaps = 2/213 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            +LHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVD+RFQLE
Sbjct  117  KLHSQEAYEMIENHLALILGQRQADATVAAISKLRVGQVYAASVMYGYFLKRVDKRFQLE  176

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G   E   + QV    S  S ++S SHPE+ SW      + G    +KP RL
Sbjct  177  KSMKTLPWG--SEGDMLNQVMTTDSRPSAQTSTSHPEMASWTSPNFSAGGPSQSVKPCRL  234

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQ YATIRSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF
Sbjct  235  RSYVMSFDSDTLQSYATIRSKEAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEHVRISF  294

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  295  AGLRRLILEAVTFGSFLWDVESFVDSRYHFVVN  327



>gb|AFK36208.1| unknown [Medicago truncatula]
Length=421

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 167/216 (77%), Gaps = 7/216 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR+   SSV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  206  QLHSNEAYEMIQNHLALILGNRAGELSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  265

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK+MKVL    D  DS I Q   D +    +       SHPEV +WP G +   GFG  +
Sbjct  266  EKSMKVLTSASD--DSSIHQTIVDDARPGSEVDTSQVTSHPEVSTWPGGDVSPGGFGYGI  323

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRP + IT +G ID S+DE 
Sbjct  324  KPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPGMVITHEGGIDYSEDET  383

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF  L RLVLEAVTFG FLWDVES VDSRY FV
Sbjct  384  IKISFGGLMRLVLEAVTFGCFLWDVESYVDSRYRFV  419



>gb|ACJ84884.1| unknown [Medicago truncatula]
Length=421

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 167/216 (77%), Gaps = 7/216 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHL+LILGNR+   SSV QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  206  QLHSNEAYEMIQNHLALILGNRAGDLSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  265

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK+MKVL    D  DS I Q   D +    +       SHPEV +WP G +   GFG  +
Sbjct  266  EKSMKVLTSASD--DSSIHQTIVDDARPGSEVDTSQVTSHPEVSTWPGGDVSPGGFGYGI  323

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRP + IT +G ID S+DE 
Sbjct  324  KPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPGMVITHEGGIDYSEDET  383

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF  L RLVLEAVTFG FLWDVES VDSRY FV
Sbjct  384  IKISFGGLMRLVLEAVTFGCFLWDVESYVDSRYRFV  419



>gb|AGV54799.1| hypothetical protein [Phaseolus vulgaris]
Length=409

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 173/216 (80%), Gaps = 8/216 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILG+R   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QR+QLE
Sbjct  194  LHSPEAYEMIQNHLALILGSRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRYQLE  253

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssd----tslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
            K MK+LP     E++ IQQ   D S      S     SHPE+ + P G + SRGFG   K
Sbjct  254  KTMKILPNV--AEENSIQQTVIDESRISGGMSPSHVMSHPEISNLPGGSISSRGFGYGSK  311

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP-EISITPQGTIDSSKDEL  219
             SRLRTYVMSFD +TLQRYAT+RSKE++++IEKHTEALFGRP EI +TP+G IDSSKDE 
Sbjct  312  VSRLRTYVMSFDTDTLQRYATLRSKESLSLIEKHTEALFGRPDEIVVTPEGVIDSSKDES  371

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF SL+RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  372  IKISFGSLKRLVLEAVTFGSFLWDVESYVDARYHFV  407



>ref|XP_010687245.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687246.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   281 bits (720),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 173/217 (80%), Gaps = 8/217 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            +HSPEAYEMIQNHL+LILGNRS  ++SV QI+KLRVGQVYAASVM+GYFLKR+DQRFQLE
Sbjct  203  VHSPEAYEMIQNHLALILGNRSGDSTSVAQISKLRVGQVYAASVMFGYFLKRIDQRFQLE  262

Query  563  KNMKVLPQGLD-KEDSGIQQVGG-----DssdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            K MK+LP+ +D +E+  + + GG     DS+      +  HPEV S+   G+   GF   
Sbjct  263  KAMKILPEQMDARENELMIEDGGSMASEDSTSYYQDHAQVHPEVSSF-TSGINDGGFDQG  321

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
            +KPSRLR+YVM+FD ETL +YATIRSKEA+ IIEKHTEALFG+P+I +T QGTID S+DE
Sbjct  322  VKPSRLRSYVMAFDAETLAKYATIRSKEAVTIIEKHTEALFGKPDIVLTAQGTIDPSRDE  381

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             IKI FS LRRLVLEAVTFGSFLWDVES VDSR+H V
Sbjct  382  HIKIGFSGLRRLVLEAVTFGSFLWDVESYVDSRHHLV  418



>ref|NP_001169730.1| hypothetical protein [Zea mays]
 gb|ACN34695.1| unknown [Zea mays]
 gb|AFW67799.1| hypothetical protein ZEAMMB73_826524 [Zea mays]
Length=416

 Score =   281 bits (720),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 167/214 (78%), Gaps = 5/214 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHSPEAYEMI+NHL+LILG R +  +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  203  RLHSPEAYEMIENHLALILGQRQSDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLE  262

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSW---PDGGMGSRGFGTEMKP  393
            K MK LP G ++ED  + QV    S  S +SS SHPE+ SW   PD   G  G    +KP
Sbjct  263  KTMKSLPWGSEEEDGALYQVMTTDSMPSAQSSSSHPEMGSWTAAPDFNAG--GPSESIKP  320

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
             RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEALFG+ EI +TP GT+ SSKDE I+
Sbjct  321  CRLRSYVMSFDPDTLQRYATVRSKEAFGIIEKHTEALFGKAEIVVTPGGTVGSSKDEHIR  380

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            ISF+ LRRLVLEAVTFGSFLWDVES VDS YHFV
Sbjct  381  ISFAGLRRLVLEAVTFGSFLWDVESFVDSSYHFV  414



>ref|XP_006580389.1| PREDICTED: uncharacterized protein LOC100817892 isoform X2 [Glycine 
max]
Length=400

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 171/216 (79%), Gaps = 8/216 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHLSLILGN++   +SV +I+K RVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  186  QLHSDEAYEMIQNHLSLILGNKAGDLTSVAEISKFRVGQVYAASVMYGYFLKRVDQRFQL  245

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK MKVLP   ++E+ G+ +   D++    +       SHPEV +WP G +   GFG  +
Sbjct  246  EKTMKVLPNATEEEN-GVHRNTMDNARPSIEQDTSQVMSHPEVSAWPGGDVSPGGFGYGI  304

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K +RLR YVMSFDG+TLQRYA IRSKEA++IIEKHTEALFGRPEI +TP+G +  SKDE 
Sbjct  305  KATRLRNYVMSFDGDTLQRYAAIRSKEAVSIIEKHTEALFGRPEIVVTPEGAV--SKDEN  362

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF  L++LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  363  IKISFGGLKKLVLEAVTFGSFLWDVESYVDSRYHFV  398



>ref|XP_003525180.1| PREDICTED: uncharacterized protein LOC100817892 isoform X1 [Glycine 
max]
 gb|KHN10526.1| hypothetical protein glysoja_040681 [Glycine soja]
Length=399

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 171/216 (79%), Gaps = 8/216 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMIQNHLSLILGN++   +SV +I+K RVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  185  QLHSDEAYEMIQNHLSLILGNKAGDLTSVAEISKFRVGQVYAASVMYGYFLKRVDQRFQL  244

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDss----dtslrsspSHPEVVSWPDGGMGSRGFGTEM  399
            EK MKVLP   ++E+ G+ +   D++    +       SHPEV +WP G +   GFG  +
Sbjct  245  EKTMKVLPNATEEEN-GVHRNTMDNARPSIEQDTSQVMSHPEVSAWPGGDVSPGGFGYGI  303

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K +RLR YVMSFDG+TLQRYA IRSKEA++IIEKHTEALFGRPEI +TP+G +  SKDE 
Sbjct  304  KATRLRNYVMSFDGDTLQRYAAIRSKEAVSIIEKHTEALFGRPEIVVTPEGAV--SKDEN  361

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF  L++LVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  362  IKISFGGLKKLVLEAVTFGSFLWDVESYVDSRYHFV  397



>emb|CDY58279.1| BnaCnng32840D [Brassica napus]
Length=425

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 174/219 (79%), Gaps = 9/219 (4%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMIQNHLS+IL NR    S+V QI+KL +GQVYAASVMYGYFLKR+DQRFQL
Sbjct  206  QLHSPEVYEMIQNHLSIILKNREGDLSTVAQISKLGIGQVYAASVMYGYFLKRIDQRFQL  265

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK MK+LP G D+ ++ I+Q G ++       ++ + ++  S+ EV S+  G   S G  
Sbjct  266  EKTMKILPGGSDEGETSIEQAGRETQRSFYEEAEETYQAVSSNQEVGSFVGGINASGGSS  325

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
            +E K SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQG IDSSK
Sbjct  326  SETKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIVITPQG-IDSSK  384

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  385  DEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  423



>gb|EPS73872.1| hypothetical protein M569_00881 [Genlisea aurea]
Length=411

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 175/223 (78%), Gaps = 20/223 (9%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            ++HS EAYEMIQNHL+LI+GNR S++++  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  197  KIHSAEAYEMIQNHLALIIGNRMSDSDAIAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  256

Query  566  EKNMKVLPQGLDKEDSGI---------QQVGGDssdtslrsspSHPEVV-SWPDGGMGSR  417
            EK MK+LPQG D + S           ++ GGD S  + +    HPEV  SW   G    
Sbjct  257  EKTMKILPQGGDTKASNSIGEEVIASERRPGGDESFINSQP---HPEVPPSWSSNG---S  310

Query  416  GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTID  237
             FG  +KPSRLRTYVMS DGET+QRYATIRSKEAI IIEKHTEALFGRPEI +TP+G++D
Sbjct  311  PFG--IKPSRLRTYVMSLDGETIQRYATIRSKEAIGIIEKHTEALFGRPEIVLTPEGSVD  368

Query  236  SSKDE-LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            SSKDE  I I F++L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  369  SSKDEAAITIRFAALKRLVLEAVTFGSFLWDVESFVDSRYHFV  411



>ref|XP_009145005.1| PREDICTED: uncharacterized protein LOC103868678 [Brassica rapa]
 emb|CDY23684.1| BnaA05g17450D [Brassica napus]
Length=407

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 170/215 (79%), Gaps = 5/215 (2%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHSPE YEMIQNHLS+IL NR    S+V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  192  QLHSPEVYEMIQNHLSIILKNREGDLSTVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  251

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD--GGM-GSRGFGTEMK  396
            EK MK+LP G D+ ++ I+Q G ++  +    +    + VS     GG+  S G  +E K
Sbjct  252  EKTMKILPGGSDEGETSIEQAGRETERSFYEEAEETYQAVSSNQEVGGINASGGSSSETK  311

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
             SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGRPEI ITPQG IDSSKDE +
Sbjct  312  QSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGRPEIVITPQG-IDSSKDEHM  370

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            KISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  371  KISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHFV  405



>ref|XP_003528983.1| PREDICTED: uncharacterized protein LOC100777314 isoform X1 [Glycine 
max]
 ref|XP_006583474.1| PREDICTED: uncharacterized protein LOC100777314 isoform X2 [Glycine 
max]
 ref|XP_006583475.1| PREDICTED: uncharacterized protein LOC100777314 isoform X3 [Glycine 
max]
 ref|XP_006583476.1| PREDICTED: uncharacterized protein LOC100777314 isoform X4 [Glycine 
max]
 gb|KHN25098.1| hypothetical protein glysoja_027512 [Glycine soja]
Length=408

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 170/215 (79%), Gaps = 7/215 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QRFQLE
Sbjct  194  LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRFQLE  253

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdts----lrsspSHPEVVSWPDGGMGSRGFGTEMK  396
            + MK+LP     E++ IQQ   D S            SHPEV + P GG+ S GFG   K
Sbjct  254  RTMKILPNA--TEENSIQQTVVDDSRIRGGEGHSHVMSHPEVSTLPGGGISSGGFGYGSK  311

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
             SRLRTYVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQG IDSS D+ I
Sbjct  312  VSRLRTYVMSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPQGVIDSSTDDNI  371

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            KISF  L+RLVLEA+TFGSFLWDVES VDSRYHFV
Sbjct  372  KISFGGLKRLVLEAITFGSFLWDVESYVDSRYHFV  406



>gb|ACU24516.1| unknown [Glycine max]
Length=408

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 170/215 (79%), Gaps = 7/215 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QRFQLE
Sbjct  194  LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRFQLE  253

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdts----lrsspSHPEVVSWPDGGMGSRGFGTEMK  396
            + MK+LP     E++ IQQ   D S            SHPEV + P GG+ S GFG   K
Sbjct  254  RTMKILPNA--TEENSIQQTVVDDSRIRGGEGHSHVMSHPEVSTLPGGGISSGGFGHGSK  311

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
             SRLRTYVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI +TPQG IDSS D+ I
Sbjct  312  VSRLRTYVMSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPQGVIDSSTDDNI  371

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            KISF  L+RLVLEA+TFGSFLWDVES VDSRYHFV
Sbjct  372  KISFGGLKRLVLEAITFGSFLWDVESYVDSRYHFV  406



>gb|KHN43658.1| hypothetical protein glysoja_027724, partial [Glycine soja]
Length=370

 Score =   275 bits (703),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 170/219 (78%), Gaps = 15/219 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QRFQLE
Sbjct  156  LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRFQLE  215

Query  563  KNMKVLPQGLDKEDSGIQQV--------GGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            K MK+LP G   E++ IQ          GGD     +     HPEV + P GG+ S GFG
Sbjct  216  KTMKILPNG--AEENSIQHTVVDDSRISGGDGRSHVMS----HPEVSTLPGGGISSGGFG  269

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
               K SRLRTYVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI +TP+G IDS  
Sbjct  270  YGSKVSRLRTYVMSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPEGVIDSLT  329

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            D+ IKISF  L+RLVLEA+TFGSFLWDVES VDSRYHFV
Sbjct  330  DQSIKISFGGLKRLVLEAITFGSFLWDVESYVDSRYHFV  368



>ref|XP_003534126.1| PREDICTED: uncharacterized protein LOC100802697 isoformX1 [Glycine 
max]
 ref|XP_003534127.1| PREDICTED: uncharacterized protein LOC100802697 isoformX2 [Glycine 
max]
 ref|XP_006587458.1| PREDICTED: uncharacterized protein LOC100802697 isoform X3 [Glycine 
max]
Length=414

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 170/219 (78%), Gaps = 15/219 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR   ++SV QI+K+RVGQVYAAS+MYGYFLK V QRFQLE
Sbjct  200  LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKIRVGQVYAASIMYGYFLKWVVQRFQLE  259

Query  563  KNMKVLPQGLDKEDSGIQQV--------GGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            K MK+LP G   E++ IQ          GGD     +     HPEV + P GG+ S GFG
Sbjct  260  KTMKILPNG--AEENSIQHTVVDDSRISGGDGRSHVMS----HPEVSTLPGGGISSGGFG  313

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
               K SRLRTYVMSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI +TP+G IDS  
Sbjct  314  YGSKVSRLRTYVMSFDSETLQRYATIRSKEALSIIEKHTEALFGRPEIVVTPEGVIDSLT  373

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE IKISFS L+RLVLEA+TFGSFLWDVES VDSRYHFV
Sbjct  374  DESIKISFSGLKRLVLEAITFGSFLWDVESYVDSRYHFV  412



>ref|XP_004513343.1| PREDICTED: uncharacterized protein LOC101494659 isoform X1 [Cicer 
arietinum]
 ref|XP_004513344.1| PREDICTED: uncharacterized protein LOC101494659 isoform X2 [Cicer 
arietinum]
Length=418

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 167/215 (78%), Gaps = 7/215 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQ+HL+L+LGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRV QRFQLE
Sbjct  204  LHSPEAYEMIQSHLALLLGNRIGDSASVAQISKLRVGQVYAASVMYGYFLKRVVQRFQLE  263

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdts----lrsspSHPEVVSWPDGGMGSRGFGTEMK  396
            K MK+LP    +E+S I Q   D +  +          HPEV +W   G+ S  FG E  
Sbjct  264  KTMKILPDA--EEESTIGQTMEDETRIAGLEMPSQVTPHPEVPTWSGSGISSGAFGQETT  321

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
             SRLR+Y+MSFD ETLQRYATIRSKE+++IIEKHT+ALFG PEI++T +  I+SSKDE+I
Sbjct  322  VSRLRSYMMSFDLETLQRYATIRSKESVSIIEKHTDALFGIPEIAVTAEEKINSSKDEII  381

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            KIS   L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  382  KISIGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  416



>gb|EMT10781.1| hypothetical protein F775_30852 [Aegilops tauschii]
Length=493

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 161/206 (78%), Gaps = 2/206 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            RLHS EAYEMI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVD+RFQLE
Sbjct  247  RLHSHEAYEMIENHLNLILGQRQADGTVAAISKLRVGQVYAASVMYGYFLKRVDKRFQLE  306

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K+MK LP G   ED  + QV    S  S ++  SHPEV SW    + + G G  +KPSRL
Sbjct  307  KSMKSLPWG--SEDDALNQVMTTDSRPSDQTYSSHPEVESWTSPDLSAGGLGQSVKPSRL  364

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R+YVMSFD +TLQ YATIRSK A  IIEKHTEALFG+PEI ITP+GT+DSSKDE ++ISF
Sbjct  365  RSYVMSFDSDTLQTYATIRSKVAFGIIEKHTEALFGKPEIVITPEGTVDSSKDEYVRISF  424

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDS  126
            S LRRL+LEAVTFGSFLWDVES VDS
Sbjct  425  SGLRRLILEAVTFGSFLWDVESYVDS  450



>gb|KEH26747.1| plant/T1N15-5 protein [Medicago truncatula]
Length=418

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 166/215 (77%), Gaps = 7/215 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYE+IQ+HL+L+LGNRS  + SV QI+KLRVGQVYAASVMYGYFLKRV QRFQLE
Sbjct  204  LHSPEAYELIQSHLALLLGNRSGDSKSVAQISKLRVGQVYAASVMYGYFLKRVVQRFQLE  263

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdts----lrsspSHPEVVSWPDGGMGSRGFGTEMK  396
            K +K LP     E++ I Q   D +  +         SHPEV +W + G+ S     E+ 
Sbjct  264  KTIKNLPDA--AEENTISQTLEDETRNAGLEFPSQVMSHPEVPAWLESGISSGANDQEIT  321

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
             SRLR+Y+MSFD ETLQRYATIRSKEA++IIE HTEALFGRPEI ITP+G I+SSKDE+I
Sbjct  322  VSRLRSYMMSFDIETLQRYATIRSKEAVSIIENHTEALFGRPEIVITPEGKINSSKDEII  381

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            KI    L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  382  KIRIGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  416



>ref|XP_006849427.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
 gb|ERN11008.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
Length=439

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 171/236 (72%), Gaps = 23/236 (10%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            ++HSPEA +MI+NHL+LILGNR S+ +S  QI+KLRVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  204  KMHSPEALQMIRNHLALILGNRLSDLSSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQL  263

Query  566  EKNMKVLPQGLDKEDSGIQQVGGD---------ssdtslrsspSHPEVVSWPDGGMGSR-  417
            EK MKVLP G+D  +  ++QV  D          +     +  ++    +W +   GS  
Sbjct  264  EKAMKVLPFGVDSGNLSMEQVLADDSGPKDLNNQTKNLKPNDQAYSGNPTWYEASHGSEQ  323

Query  416  ------------GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  273
                        GFG  +K  +LR+YVMSFD ETLQRYATIRSKE+++IIEKHTEALFGR
Sbjct  324  DGVDMGVNFSPGGFGYGLKSYKLRSYVMSFDAETLQRYATIRSKESVSIIEKHTEALFGR  383

Query  272  PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            PE+ ITPQGT+DSSKDE IKISF  L  LVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  384  PELRITPQGTVDSSKDENIKISFGGLTTLVLEAVTFGSFLWDVESYVDSRYHFVTN  439



>ref|XP_007160560.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
 gb|ESW32554.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
Length=405

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 166/215 (77%), Gaps = 6/215 (3%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +LHS EAYEMI+NHLSLILGN+  +  S  +I+K RVGQVYAASVMYGYFLKRVDQRFQL
Sbjct  191  KLHSHEAYEMIENHLSLILGNKVGDLTSIAEISKFRVGQVYAASVMYGYFLKRVDQRFQL  250

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDs---sdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
            EK +KVL    ++E+S  Q    ++    +       SHPEV +WP G +   G G  +K
Sbjct  251  EKTVKVLTNETEEENSFHQTTMDNARPGVEEDTSQGTSHPEVFNWPGGDVSPGGVGYGVK  310

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
             +RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPEI +TP+G +  SKDE +
Sbjct  311  ATRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEIVVTPEGAV--SKDENV  368

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            KISF  L++LVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  369  KISFGGLQKLVLEAVTFGSFLWDVESYVDARYHFV  403



>ref|XP_007152648.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
 gb|ESW24642.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
Length=403

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 172/216 (80%), Gaps = 8/216 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILG+R   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QR+QLE
Sbjct  188  LHSPEAYEMIQNHLALILGSRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRYQLE  247

Query  563  KNMKVLPQGLDKEDSGIQQV----GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
            K MK+LP     E++ IQQ      G S   S     SHPE+ + P G + S GFG   K
Sbjct  248  KTMKILPNV--AEENSIQQTVIDESGISGGKSPSHVMSHPEISNLPGGSISSGGFGYGSK  305

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP-EISITPQGTIDSSKDEL  219
             SRLRTYVMSFD +TLQRYAT+RSKE+++IIEKHTEALFGRP EI +TP+G IDSSKDE 
Sbjct  306  VSRLRTYVMSFDTDTLQRYATLRSKESLSIIEKHTEALFGRPDEIVVTPEGVIDSSKDES  365

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            IKISF SL+RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  366  IKISFGSLKRLVLEAVTFGSFLWDVESYVDARYHFV  401



>gb|AFK35334.1| unknown [Lotus japonicus]
Length=207

 Score =   259 bits (661),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = -2

Query  716  MIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  540
            MI+NHL L+LG+R   +++V QI+K+R GQVYAASVMYGYFLKRV QRFQLEK +K+LP 
Sbjct  1    MIENHLGLLLGSRQGDSTAVAQISKIRAGQVYAASVMYGYFLKRVVQRFQLEKAIKILPN  60

Query  539  GLDKEDSGIQQVGGDssdtsl--rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMS  366
              ++ +S    V             +  HPEV +WP  G+ S  FG     SRL TY+MS
Sbjct  61   AAEENNSHRTIVDDTRVSIEEFPSQAMPHPEVSAWPGSGISSGAFGQGTTVSRLHTYMMS  120

Query  365  FDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRL  186
            FDGETLQRYATIRSKE+++IIEKHTEALFGRP+  ITP+G I+SSKDE+IKISF  L+RL
Sbjct  121  FDGETLQRYATIRSKESVSIIEKHTEALFGRPDAVITPEGKINSSKDEIIKISFGGLKRL  180

Query  185  VLEAVTFGSFLWDVESSVDSRYHFV  111
            VLEAVTFGSFLWDVES VDSRYHFV
Sbjct  181  VLEAVTFGSFLWDVESYVDSRYHFV  205



>gb|EYU24493.1| hypothetical protein MIMGU_mgv1a007418mg [Erythranthe guttata]
Length=408

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 160/213 (75%), Gaps = 12/213 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHS EAY+MIQ HLSLILG R +++ S  QI+KLRVGQVYAASVMYGYFLKR+DQR QLE
Sbjct  207  LHSTEAYQMIQKHLSLILGKRLADSKSVAQISKLRVGQVYAASVMYGYFLKRIDQRLQLE  266

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRL  384
            K MK+LPQ    E   I+ V   +++  +          S  DG   SR  G  +  SRL
Sbjct  267  KMMKILPQ----EKMDIEHVTYSAAEKRVPMLNE-----SLEDGINLSRFDGINL--SRL  315

Query  383  RTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISF  204
            R YVM FDGETLQRYATIRSKEA N+IEKHTEALFGRPEI ITP GTIDSS DELIKISF
Sbjct  316  RNYVMLFDGETLQRYATIRSKEAFNVIEKHTEALFGRPEIVITPDGTIDSSNDELIKISF  375

Query  203  SSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
              LRRLVLEAVTFGSFLWD ES VDSRYHFVA+
Sbjct  376  GGLRRLVLEAVTFGSFLWDSESYVDSRYHFVAN  408



>ref|XP_010939981.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939982.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939983.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939984.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
Length=422

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 157/215 (73%), Gaps = 3/215 (1%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGN-RSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYE+I+NHL+LILG    ++NS   ++KLRV  VYAASV+YGYFLKRVDQRFQLE
Sbjct  208  LHSPEAYEVIKNHLALILGQGLGDSNSVASVSKLRVVLVYAASVIYGYFLKRVDQRFQLE  267

Query  563  KNMKVLPQGL--DKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            K+MK LP G   + E+  ++Q   D S    +   SHP             G G  +KP 
Sbjct  268  KSMKTLPWGSVEENEEDAVKQAMPDESRPLTQIGNSHPVASLGSSPSFNHGGVGHSVKPC  327

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR+Y  +FD + LQRY  +RSKEA +IIEKHTEALFGRPEI I PQGTIDSSKDE++KI
Sbjct  328  RLRSYFKAFDSQMLQRYVKVRSKEAFHIIEKHTEALFGRPEIVIAPQGTIDSSKDEIVKI  387

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            SF+ LRRL+LEAVTFGSFLWD ES VD+RYHF+ +
Sbjct  388  SFAGLRRLILEAVTFGSFLWDTESYVDTRYHFMTN  422



>gb|ABR17692.1| unknown [Picea sitchensis]
 gb|ACN40252.1| unknown [Picea sitchensis]
Length=434

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 167/226 (74%), Gaps = 18/226 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            +HS EA+EMI+NHLSL+LGNR   +SS+ QI+KLRVGQVYAASVMYGYFL+RVDQRFQLE
Sbjct  213  VHSSEAFEMIKNHLSLVLGNRLLDSSSIAQISKLRVGQVYAASVMYGYFLRRVDQRFQLE  272

Query  563  KNMKVLPQGLDKEDSGIQQVGGDssdt-slrsspSHPEVVSWPDGGMGSRGFGTE-----  402
            K+MK LP GL++E    Q +G DS      ++  S P+V S     M S G  +E     
Sbjct  273  KSMKTLPSGLNEESDAEQTLGSDSKTKGEFQTRYSSPQVAS---AAMPSIGTPSEPEFNP  329

Query  401  -------MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  243
                   +KP +LR YVMSF+ ETLQRYAT+RSKE ++IIEKH+EALFGRPE+ +   G+
Sbjct  330  TVNGRRGVKPCKLRAYVMSFEPETLQRYATMRSKEGVSIIEKHSEALFGRPEVQVV-GGS  388

Query  242  IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            + ++ DE+IKISFS L  LVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  389  VAATNDEIIKISFSGLTSLVLEAVTFGSFLWDVESYVDSRYHFVTN  434



>ref|XP_010661178.1| PREDICTED: uncharacterized protein LOC100245443 isoform X2 [Vitis 
vinifera]
Length=365

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 159/222 (72%), Gaps = 14/222 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEA EMIQNHL+ ILGNR   ++SV +++KLRVGQVYAASVMYGYFLKRVD+RFQLE
Sbjct  148  LHSPEATEMIQNHLAFILGNRFGDSTSVAKMSKLRVGQVYAASVMYGYFLKRVDERFQLE  207

Query  563  KNMKVLPQGLD------KEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            K MK+LP  LD      +E  G+   G D S   + S    PE   W  GG+    FG  
Sbjct  208  KTMKILPYALDGDKGYVEEAMGMSPFGSDDSVQGVES---QPEASCWA-GGLTIGSFGHW  263

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ---GTIDSS  231
             KPS L +YV   D ETL RY TIRS EA++II+KHT+ALFGR +++I P     T+DSS
Sbjct  264  KKPSSLGSYVKLIDAETLMRYTTIRSMEAVSIIQKHTQALFGRRDVAIIPNIPMWTLDSS  323

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            +DELIK+SF  L+RLVLEA+TFGSFLWDVES VDSR HFV +
Sbjct  324  EDELIKMSFGGLKRLVLEALTFGSFLWDVESFVDSRLHFVVN  365



>emb|CAN79123.1| hypothetical protein VITISV_030635 [Vitis vinifera]
Length=411

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 159/222 (72%), Gaps = 14/222 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEA EMIQNHL+ ILGNR   ++SV +++KLRVGQVYAASVMYGYFLKRVD+RFQLE
Sbjct  194  LHSPEATEMIQNHLAFILGNRFGDSTSVAKMSKLRVGQVYAASVMYGYFLKRVDERFQLE  253

Query  563  KNMKVLPQGLD------KEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            K MK+LP  LD      +E  G+   G D S   + S    PE   W  GG+    FG  
Sbjct  254  KTMKILPYALDGDKGYVEEAMGMSPFGSDDSVQGVES---QPEASCWA-GGLTIGSFGHW  309

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ---GTIDSS  231
             KPS L +YV   D ETL RY TIRS EA++II+KHT+ALFGR +++I P     T+DSS
Sbjct  310  KKPSSLGSYVKLIDAETLMRYTTIRSMEAVSIIQKHTQALFGRRDVAIIPNIPMWTLDSS  369

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            +DELIK+SF  L+RLVLEA+TFGSFLWDVES VDSR HFV +
Sbjct  370  EDELIKMSFGGLKRLVLEALTFGSFLWDVESFVDSRLHFVVN  411



>ref|XP_002273280.1| PREDICTED: uncharacterized protein LOC100245443 isoform X1 [Vitis 
vinifera]
Length=411

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 159/222 (72%), Gaps = 14/222 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEA EMIQNHL+ ILGNR   ++SV +++KLRVGQVYAASVMYGYFLKRVD+RFQLE
Sbjct  194  LHSPEATEMIQNHLAFILGNRFGDSTSVAKMSKLRVGQVYAASVMYGYFLKRVDERFQLE  253

Query  563  KNMKVLPQGLD------KEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTE  402
            K MK+LP  LD      +E  G+   G D S   + S    PE   W  GG+    FG  
Sbjct  254  KTMKILPYALDGDKGYVEEAMGMSPFGSDDSVQGVES---QPEASCWA-GGLTIGSFGHW  309

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ---GTIDSS  231
             KPS L +YV   D ETL RY TIRS EA++II+KHT+ALFGR +++I P     T+DSS
Sbjct  310  KKPSSLGSYVKLIDAETLMRYTTIRSMEAVSIIQKHTQALFGRRDVAIIPNIPMWTLDSS  369

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            +DELIK+SF  L+RLVLEA+TFGSFLWDVES VDSR HFV +
Sbjct  370  EDELIKMSFGGLKRLVLEALTFGSFLWDVESFVDSRLHFVVN  411



>gb|ADE77481.1| unknown [Picea sitchensis]
Length=435

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 160/241 (66%), Gaps = 43/241 (18%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR---SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS EA EMI+ HLSL+LGNR   S++N+  +I+KLRVGQVYAASVMYGYFL+RVD+ FQ
Sbjct  205  VHSIEAVEMIKEHLSLVLGNRNAGSDSNTVAEISKLRVGQVYAASVMYGYFLRRVDKHFQ  264

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEV--VSWPDGGMGSRG------  414
            LEK+MK+LP   ++E    Q             + +HPE+  V+W D      G      
Sbjct  265  LEKSMKMLPFASNEEIDAEQ------------LNSTHPELEGVNWQDNSAVQGGAAIAAA  312

Query  413  -------------------FG-TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  294
                               FG    KP +LR YVMSFD ETLQRYAT+RSKE +NIIE+H
Sbjct  313  VAAMAGAAGPAGQDFNPIVFGQIGAKPCKLRAYVMSFDPETLQRYATMRSKEGVNIIERH  372

Query  293  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
             EALFGRPEI ITP G++  +KDE+++ISF+ L  +VLEAVTFGSFLWDVES VDSRYHF
Sbjct  373  AEALFGRPEIHITPDGSMAVTKDEILRISFTGLTSMVLEAVTFGSFLWDVESHVDSRYHF  432

Query  113  V  111
            V
Sbjct  433  V  433



>ref|XP_010461665.1| PREDICTED: uncharacterized protein LOC104742360 [Camelina sativa]
Length=176

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 7/174 (4%)
 Frame = -2

Query  611  MYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPE  453
            MYGYFLKR+DQRFQLEK M++LP G  + ++ I+Q G ++       ++ + ++  S+ E
Sbjct  1    MYGYFLKRIDQRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQE  60

Query  452  VVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  273
            V S+  G   S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGR
Sbjct  61   VGSFVGGINASGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGR  120

Query  272  PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            PEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  121  PEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  174



>ref|XP_002304357.2| hypothetical protein POPTR_0003s09600g [Populus trichocarpa]
 gb|EEE79336.2| hypothetical protein POPTR_0003s09600g [Populus trichocarpa]
Length=250

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 149/211 (71%), Gaps = 5/211 (2%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLS++LG R      ++VQI+K+++G++YAAS+MYGYFL+RVDQR+QL
Sbjct  40   VHSPEAFEMIQSHLSIVLGERLVGPLETTVQISKIKLGKLYAASLMYGYFLRRVDQRYQL  99

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ M  LP+G D++ +  +     +      S          PDG     G   E K  R
Sbjct  100  ERAMNTLPKGFDEDRARFEDPSPANRLWDPDSLIRILPDSGEPDGDFTDTG---EEKSYR  156

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I I   G+I+++ DE++ I+
Sbjct  157  LRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDIRIAGDGSIETANDEVVSIT  216

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
            FS L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  217  FSGLTMLVLEAVGFGSFLWDAESYVESKYHF  247



>ref|XP_006471483.1| PREDICTED: uncharacterized protein LOC102623998 [Citrus sinensis]
Length=408

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 158/217 (73%), Gaps = 12/217 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG R     ++ +QI+K+++G++YAAS+MYGYFL+RVDQRFQL
Sbjct  195  VHSPEAFEMIQSHLSLVLGERLVGPLDTIIQISKIKLGKLYAASIMYGYFLRRVDQRFQL  254

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPE-VVSWP---DGGMGSRGF-GTE  402
            E+ MK LP+G D++     +V  +  + S  +    P+ ++  P   DG +G     G E
Sbjct  255  ERTMKTLPEGFDED-----KVRYEEREPSPMNRLWDPDSLIRIPPNDDGTVGESFMDGGE  309

Query  401  MKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE  222
             K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP++ +   G+ID+SKDE
Sbjct  310  GKSYRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDVRVLEDGSIDTSKDE  369

Query  221  LIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +I ++F  L  LVLEAV FGSF+WD ES V+S+Y F+
Sbjct  370  VISVTFLGLTMLVLEAVAFGSFMWDSESYVESKYPFI  406



>gb|KDP30713.1| hypothetical protein JCGZ_15541 [Jatropha curcas]
Length=405

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 154/226 (68%), Gaps = 31/226 (14%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HL+L+LG+R     ++ VQI+K+++G++YAAS+MYGYFL+RVDQRFQL
Sbjct  193  VHSPEAFEMIQSHLTLVLGDRLVGPIDTIVQISKIKLGKLYAASIMYGYFLRRVDQRFQL  252

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSW------------PDGGMG  423
            E+ M  LP+G D+     +++  D            P  V+W             DG   
Sbjct  253  ERTMNTLPKGFDES----RRIYDD-----------DPSPVNWFWDSDSLIRIQPDDGDYS  297

Query  422  SRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  249
              GF   +  K +RLR+YVM  D ETLQRYATIRSKE +++IEK T+ALFGRP+I +   
Sbjct  298  DEGFIDTSREKSNRLRSYVMYLDAETLQRYATIRSKEVMSLIEKQTQALFGRPDIRVMED  357

Query  248  GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            G+ID++ DE+I ++FS L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  358  GSIDTANDEVISMTFSGLTMLVLEAVAFGSFLWDAESYVESKYHFL  403



>ref|XP_008466020.1| PREDICTED: uncharacterized protein LOC103503577 isoform X2 [Cucumis 
melo]
Length=335

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 152/215 (71%), Gaps = 12/215 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R     +S V+++K+++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  126  VHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMSKIKLGKLYAASIMYGYFLKRVDQRFQL  185

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG-SRGF--GTEMK  396
            E+ MK LP+   K+    + +  +            P+     D G G SRG     + K
Sbjct  186  ERTMKTLPEAFTKDFD--EPIPANQLWDPDSLIRIAPD-----DEGFGDSRGLIDAGDGK  238

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              RLR+YVM  D ETLQRYAT+RSKEAI++IEK T+ALFG+P+I I   G+ID+  DE+I
Sbjct  239  SYRLRSYVMYLDSETLQRYATLRSKEAISLIEKQTQALFGKPDIRIAADGSIDTLNDEVI  298

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             ++FS L  LVLEAV FGSFLWD ES V+S+Y+F+
Sbjct  299  SLTFSGLTMLVLEAVAFGSFLWDAESYVESKYNFI  333



>ref|XP_011028101.1| PREDICTED: uncharacterized protein LOC105128231 [Populus euphratica]
Length=413

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 149/211 (71%), Gaps = 5/211 (2%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLS++LG R      +++QI+K+++G++YAAS+MYGYFL+RVDQR+QL
Sbjct  203  VHSPEAFEMIQSHLSIVLGERLVGPLETTIQISKIKLGKLYAASLMYGYFLRRVDQRYQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ M  LP+G D++ +  +     +      S          PDG     G   E K  R
Sbjct  263  ERTMNTLPKGFDEDRARFEDPSPANRLWDPDSLIRILPNSGDPDGDFTDTG---EEKSYR  319

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I I   G+I+++ DE++ I+
Sbjct  320  LRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDIRIADDGSIETANDEVVSIT  379

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
            FS L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  380  FSGLTMLVLEAVGFGSFLWDAESYVESKYHF  410



>emb|CAN68920.1| hypothetical protein VITISV_039448 [Vitis vinifera]
Length=299

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 151/212 (71%), Gaps = 6/212 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG R     ++ VQI+K+++G++YAAS+MYGYFLKRVD+R+QL
Sbjct  90   IHSPEAFEMIQSHLSLVLGERLVGPLDTIVQISKIKLGKLYAASIMYGYFLKRVDERYQL  149

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP+G ++     +  G  +      S    P       G + S   G+     R
Sbjct  150  ERTMKTLPEGFNENRLSFEDPGPANRLWDPDSLIRIPADDDDDGGMLDSVEGGS----YR  205

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFG+P++ ++  G++D+S DE++ I+
Sbjct  206  LRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGKPDVRVSEDGSLDTSNDEVVSIT  265

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            FS L  LVLEAV FGSFLWD E+ V+S+YHF+
Sbjct  266  FSGLTMLVLEAVAFGSFLWDSETYVESKYHFL  297



>gb|KHG08376.1| Beta-casein [Gossypium arboreum]
Length=399

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 8/213 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+K+++G++YAAS+MYGYFL+RVDQRFQL
Sbjct  190  VHSPEAFEMIQSHLSLVLGDRMVGPLSTIVQISKIKLGKLYAASIMYGYFLRRVDQRFQL  249

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF-GTEMKPS  390
            E+ MK LP+   K  +  +            S    P     P       G+   E K  
Sbjct  250  ERTMKTLPEDFTKSQARFEDPNPGKQLWDPDSLIRIP-----PHDDDDGGGYEDAEGKQY  304

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I I   G++D+S DE++ +
Sbjct  305  RLRSYVMYLDSETLQRYATIRSKEAISLIEKQTQALFGRPDIQILDDGSLDTSNDEVVSL  364

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +FS L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  365  TFSGLTMLVLEAVAFGSFLWDAESYVESKYHFL  397



>ref|XP_008466019.1| PREDICTED: uncharacterized protein LOC103503577 isoform X1 [Cucumis 
melo]
Length=405

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 152/215 (71%), Gaps = 12/215 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R     +S V+++K+++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  196  VHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMSKIKLGKLYAASIMYGYFLKRVDQRFQL  255

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG-SRGF--GTEMK  396
            E+ MK LP+   K+    + +  +            P+     D G G SRG     + K
Sbjct  256  ERTMKTLPEAFTKDFD--EPIPANQLWDPDSLIRIAPD-----DEGFGDSRGLIDAGDGK  308

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              RLR+YVM  D ETLQRYAT+RSKEAI++IEK T+ALFG+P+I I   G+ID+  DE+I
Sbjct  309  SYRLRSYVMYLDSETLQRYATLRSKEAISLIEKQTQALFGKPDIRIAADGSIDTLNDEVI  368

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             ++FS L  LVLEAV FGSFLWD ES V+S+Y+F+
Sbjct  369  SLTFSGLTMLVLEAVAFGSFLWDAESYVESKYNFI  403



>ref|XP_009373461.1| PREDICTED: uncharacterized protein LOC103962488 [Pyrus x bretschneideri]
Length=403

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 149/212 (70%), Gaps = 16/212 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEAYEMIQ+HLSL+LG R     +S V+I+K+++G++YAAS+MYGYFLKRVD+RFQL
Sbjct  204  VHSPEAYEMIQSHLSLVLGERLVGPLSSMVEISKIKLGKLYAASIMYGYFLKRVDERFQL  263

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E++M  LP+G   + +   Q+    S   +      PE         G+    ++ K  R
Sbjct  264  ERSMNTLPEGFTADPAPANQLWDPDSLIRIA-----PE---------GASDSDSDSKSYR  309

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D ETLQRYATIRSKEAI++IE  T+ALFG+P+I I   G+ID+S DE+I ++
Sbjct  310  LRSYVTYLDAETLQRYATIRSKEAISLIENQTQALFGKPDIRIAADGSIDTSNDEVIALT  369

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            FS L  L+LEAV FGSFLWD E+ V+SRYHFV
Sbjct  370  FSGLTMLILEAVAFGSFLWDAETYVESRYHFV  401



>ref|XP_004136206.1| PREDICTED: uncharacterized protein LOC101213975 [Cucumis sativus]
 ref|XP_004163203.1| PREDICTED: uncharacterized LOC101213975 [Cucumis sativus]
 gb|KGN60350.1| hypothetical protein Csa_3G895960 [Cucumis sativus]
Length=405

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 152/215 (71%), Gaps = 12/215 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R     +S V+++K+++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  196  VHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMSKIKLGKLYAASIMYGYFLKRVDQRFQL  255

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG-SRGF--GTEMK  396
            E+ MK LP+   K+    + +  +            P+     D G G SRG     + K
Sbjct  256  ERTMKTLPEAFTKDFD--EPIPANQLWDPDSLIRIAPD-----DEGFGDSRGLIDADDGK  308

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              RLR+YVM  D ETLQRYAT+RSKEAI++IEK T++LFG+P+I I   G+ID+  DE+I
Sbjct  309  SYRLRSYVMYLDSETLQRYATLRSKEAISLIEKQTQSLFGKPDIRIAADGSIDTLNDEVI  368

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             ++FS L  LVLEAV FGSFLWD ES V+S+Y+F+
Sbjct  369  SLTFSGLTMLVLEAVAFGSFLWDAESYVESKYNFI  403



>ref|XP_010919980.1| PREDICTED: uncharacterized protein LOC105043949 [Elaeis guineensis]
Length=404

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 152/225 (68%), Gaps = 12/225 (5%)
 Frame = -2

Query  773  YXAKQR*AAARLHSPEAYEMIQNHLSLILGNRS--NANSSVQINKLRVGQVYAASVMYGY  600
            Y   Q      +HSP+A EMIQ+HL+LILG R+    N+ VQI+KL++G++YAAS+MYGY
Sbjct  190  YWPNQEHKLEAIHSPDALEMIQSHLTLILGERAVGPLNAIVQISKLKLGKLYAASIMYGY  249

Query  599  FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS  420
            FLKRVDQRFQLE+ MK LP      D+  Q+V  D     L    S  ++ S        
Sbjct  250  FLKRVDQRFQLERTMKTLPT-----DTRQQRVFDDLKPNPLWDLESMVQISS-----DDD  299

Query  419  RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  240
               G + K  RLR+YVM  D E LQRYATIRSKE+I++IEK T+ALFGRP+I I   G++
Sbjct  300  GSDGEDSKSYRLRSYVMYLDAEALQRYATIRSKESISLIEKQTQALFGRPDIRIAEDGSL  359

Query  239  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            D+S DEL+ I+FS L  LVLEAV FGSFLW+ ES V+S+YHFV +
Sbjct  360  DTSNDELVGITFSGLTMLVLEAVAFGSFLWEAESYVESKYHFVTN  404



>ref|XP_002276652.1| PREDICTED: uncharacterized protein LOC100260823 [Vitis vinifera]
Length=403

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 151/212 (71%), Gaps = 6/212 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG R     ++ VQI+K+++G++YAAS+MYGYFLKRVD+R+QL
Sbjct  194  IHSPEAFEMIQSHLSLVLGERLVGPLDTIVQISKIKLGKLYAASIMYGYFLKRVDERYQL  253

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP+G ++     +  G  +      S    P       G + S   G+     R
Sbjct  254  ERTMKTLPEGFNENRLSFEDPGPANRLWDPDSLIRIPADDDDDGGMLDSVEGGS----YR  309

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFG+P++ ++  G++D+S DE++ I+
Sbjct  310  LRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGKPDVRVSEDGSLDTSNDEVVSIT  369

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            FS L  LVLEAV FGSFLWD E+ V+S+YHF+
Sbjct  370  FSGLTMLVLEAVAFGSFLWDSETYVESKYHFL  401



>ref|XP_010261560.1| PREDICTED: uncharacterized protein LOC104600354 [Nelumbo nucifera]
Length=409

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 148/208 (71%), Gaps = 4/208 (2%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+KL++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  198  VHSPEAFEMIQSHLSLVLGDRLVGPLDTIVQISKLKLGKLYAASIMYGYFLKRVDQRFQL  257

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP G D ED  ++    ++      S           DG     G G E K  R
Sbjct  258  ERTMKTLPDGFD-EDQVLKDPAPENQLWDADSLIRISPDDGDSDGDGDILGSG-ETKSYR  315

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYAT+R+KEAI++IEK T+ALFGRP+I I   G++D+S DE+I ++
Sbjct  316  LRSYVMYLDAETLQRYATVRTKEAISLIEKQTQALFGRPDIRIAEDGSLDTSNDEMIGLT  375

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSR  123
            FS L  LVLEAV FGSFLWD ES V+S+
Sbjct  376  FSGLTMLVLEAVAFGSFLWDAESYVESK  403



>gb|KJB21160.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
 gb|KJB21161.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
Length=400

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 146/213 (69%), Gaps = 8/213 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+K+++G++YAAS+MYGYFL+RVDQRFQL
Sbjct  191  VHSPEAFEMIQSHLSLVLGDRMVGPLSTIVQISKIKLGKLYAASIMYGYFLRRVDQRFQL  250

Query  566  EKNMKVLPQGLDKEDSGIQQVG-GDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            E+ MK LP+   K  +  +    G             P          G      E K  
Sbjct  251  ERTMKTLPEDFTKSQARFEDPNPGKQLWDPDSLIRIPPHDDD-----DGGGYGDAEGKQY  305

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I I   G++D+S DE++ +
Sbjct  306  RLRSYVMYLDSETLQRYATIRSKEAISLIEKQTQALFGRPDIRILDDGSLDTSNDEVVSL  365

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +FS L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  366  TFSGLTMLVLEAVAFGSFLWDAESYVESKYHFL  398



>ref|XP_008373529.1| PREDICTED: uncharacterized protein LOC103436859 [Malus domestica]
Length=403

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 147/212 (69%), Gaps = 16/212 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEAYEMIQ+HLSL+LG R     +S V+I+K+++G++YAAS+MYGYFLKRVD+RFQL
Sbjct  204  VHSPEAYEMIQSHLSLVLGERLVGPLSSMVEISKIKLGKLYAASIMYGYFLKRVDERFQL  263

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ M  LP+G   + +   Q+    S   +      PE         G+    ++ K  R
Sbjct  264  ERTMNTLPEGFTADPAPANQLWDPDSLIRIA-----PE---------GASDSDSDSKSYR  309

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D ETLQRYATIRSKEAI++IE  T+ALFG+P+I I   G+ID+  DE+I ++
Sbjct  310  LRSYVTYLDAETLQRYATIRSKEAISLIENQTQALFGKPDIRIAADGSIDAPNDEVIALT  369

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            FS L  L+LEAV FGSFLWD E+ V+SRYHFV
Sbjct  370  FSGLTMLILEAVAFGSFLWDAETYVESRYHFV  401



>ref|XP_007040722.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
 gb|EOY25223.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
Length=402

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 152/219 (69%), Gaps = 17/219 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ HLSL+LG+R     ++ V+I+K+++G++YAAS+MYGYFL+RVDQRFQL
Sbjct  190  VHSPEAFEMIQGHLSLVLGDRVVGPLSTIVEISKIKLGKLYAASIMYGYFLRRVDQRFQL  249

Query  566  EKNMKVLPQGLDKE-------DSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            E+ M+ LP+  +K+       + G Q    DS      +  +  +   + D   G     
Sbjct  250  ERTMRTLPEDFNKDQARFEDPNPGKQMWDPDSWIRIPPNDDNDGDGGGYMDTLEG-----  304

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
               K  RLR+YVM  D ETLQRYATIRS+EAI++IEK T+ALFGRP+I I   G++D+S 
Sbjct  305  ---KSYRLRSYVMYLDSETLQRYATIRSREAISLIEKQTQALFGRPDIRILDDGSLDTSN  361

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE++ I+F+ L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  362  DEVVSITFTGLTMLVLEAVAFGSFLWDAESYVESKYHFL  400



>ref|XP_008238169.1| PREDICTED: uncharacterized protein LOC103336834 [Prunus mume]
Length=405

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 11/213 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA EMIQ+HLSL+LG R     +S V+I+K+++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  199  VHSPEALEMIQSHLSLVLGERLVGPLSSIVEISKIKLGKLYAASIMYGYFLKRVDQRFQL  258

Query  566  EKNMKVLPQGLDKEDSGIQQV-GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            E+ M  LP G   + +   Q+   DS         S  +  S+ + G        + K  
Sbjct  259  ERTMNTLPDGFTPDAAPANQLWDPDSLIRIPPDGGSDGDGGSYMNNG--------DDKSY  310

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR+YVM  D ETLQRYATIRSKEAI++IE  T+ALFGRP++ IT  G+ID+S DE+I +
Sbjct  311  RLRSYVMYLDAETLQRYATIRSKEAISLIENQTQALFGRPDVRITDDGSIDASNDEVIAL  370

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +FS L  LVLEAV FGSFLWD E+ ++S YHF+
Sbjct  371  TFSGLTMLVLEAVAFGSFLWDAETYIESNYHFL  403



>ref|XP_008800079.1| PREDICTED: uncharacterized protein LOC103714566 isoform X3 [Phoenix 
dactylifera]
Length=372

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 12/213 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A +MIQ+HL+LILG R     N+ VQI++L++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  169  IHSPDALDMIQSHLTLILGERVVGPLNTIVQISRLKLGKLYAASIMYGYFLKRVDQRFQL  228

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP      D+  Q++  D     L    S  ++ S           G + K  R
Sbjct  229  ERTMKTLPT-----DTRQQRIFDDLKPNPLWDLESMVQISS-----DDDGSDGEDSKSYR  278

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++D+S DEL+ I+
Sbjct  279  LRSYVMYLDAETLQRYATIRSKESISLIEKQTQALFGRPDIRIAEDGSLDTSNDELVGIT  338

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
            F+ L  LVLEAV FGS LW+ ES V+S+YHFV 
Sbjct  339  FTGLTMLVLEAVAFGSILWEAESYVESKYHFVT  371



>ref|XP_004300191.1| PREDICTED: uncharacterized protein LOC101292798 [Fragaria vesca 
subsp. vesca]
Length=405

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 145/216 (67%), Gaps = 16/216 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR----SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRF  573
            +HS EA+EMIQ+HLSL+LG R       +S V+I+K+++G++YAAS+MYGYFLKRVDQRF
Sbjct  198  VHSSEAFEMIQSHLSLVLGERLVGVGPLSSLVEISKIKLGKLYAASIMYGYFLKRVDQRF  257

Query  572  QLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF--GTEM  399
            QLE+ M +LP+          +V  D              +   P  G    GF    E 
Sbjct  258  QLERTMNILPK----------RVTQDPDPAPANQLWDPDSLFRIPPDGGDEAGFIDKEES  307

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K  RLR+YVM  D ETLQRYATIRSKEAI++IE  T+ALFG+P+I I   G+ID+S DE+
Sbjct  308  KSYRLRSYVMYLDAETLQRYATIRSKEAISLIESQTQALFGKPDIRIAGDGSIDTSNDEV  367

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            I ++FS L  LVLEAV FGSFLWD E+ V+S+Y+FV
Sbjct  368  ISLTFSGLTMLVLEAVAFGSFLWDAETDVESKYNFV  403



>ref|XP_011081424.1| PREDICTED: uncharacterized protein LOC105164476 [Sesamum indicum]
Length=408

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 153/214 (71%), Gaps = 9/214 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS EA+EMI +HLSL+LG R     ++ +QI+K+++G++YAAS+MYGYFL+RVD+R+QL
Sbjct  198  VHSAEAFEMILSHLSLVLGERVVGPLDTIIQISKIKLGKLYAASIMYGYFLRRVDERYQL  257

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS--RGFGTEMKP  393
            E++M  LP+G  +E    ++   +       S      +  +PD G G       +E K 
Sbjct  258  ERSMNTLPEGFGEERVRFEEPTPEKQLWDPDSL-----IRIYPDEGDGGGIVDSSSEEKS  312

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
             +LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFG+P+I++T  G++D+S DEL+ 
Sbjct  313  YKLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGQPDITVTQDGSLDASNDELVS  372

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            ++FS L  LVLEAVTFGSFLWD E+ V+S+Y F+
Sbjct  373  LTFSGLTMLVLEAVTFGSFLWDTENYVESKYPFI  406



>ref|XP_008800078.1| PREDICTED: uncharacterized protein LOC103714566 isoform X2 [Phoenix 
dactylifera]
Length=390

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 12/213 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A +MIQ+HL+LILG R     N+ VQI++L++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  187  IHSPDALDMIQSHLTLILGERVVGPLNTIVQISRLKLGKLYAASIMYGYFLKRVDQRFQL  246

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP      D+  Q++  D     L    S  ++ S           G + K  R
Sbjct  247  ERTMKTLP-----TDTRQQRIFDDLKPNPLWDLESMVQISS-----DDDGSDGEDSKSYR  296

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++D+S DEL+ I+
Sbjct  297  LRSYVMYLDAETLQRYATIRSKESISLIEKQTQALFGRPDIRIAEDGSLDTSNDELVGIT  356

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
            F+ L  LVLEAV FGS LW+ ES V+S+YHFV 
Sbjct  357  FTGLTMLVLEAVAFGSILWEAESYVESKYHFVT  389



>ref|XP_010055250.1| PREDICTED: uncharacterized protein LOC104443499 [Eucalyptus grandis]
Length=408

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 150/224 (67%), Gaps = 8/224 (4%)
 Frame = -2

Query  773  YXAKQR*AAARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGY  600
            Y   Q      +HSPEA+EMIQ+HLSL++G+R     +S +Q +K+++G++YAAS+MYGY
Sbjct  188  YWPNQEEKLESVHSPEAFEMIQSHLSLVVGDRVVGPLDSIIQSSKIKLGKLYAASIMYGY  247

Query  599  FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS  420
            FL+RVD+RFQLE+ M  LP+G  +    ++     S      S    P     PD G G 
Sbjct  248  FLRRVDERFQLERTMNTLPKGYTENRVRLEDSIPTSPFWDPDSLIRIP-----PDDGDGG  302

Query  419  RGFGTEM-KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  243
                +E  K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I +   G+
Sbjct  303  SFLDSEEGKLYRLRSYVMYLDPETLQRYATIRSKEAISLIEKQTQALFGRPDIRVAEDGS  362

Query  242  IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            ID+S DE+I +S S L  L+LEAV FGSFLWD E+ V+S+Y FV
Sbjct  363  IDTSSDEVISLSVSGLTMLILEAVAFGSFLWDAENFVESKYQFV  406



>ref|XP_008800077.1| PREDICTED: uncharacterized protein LOC103714566 isoform X1 [Phoenix 
dactylifera]
Length=405

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 150/224 (67%), Gaps = 12/224 (5%)
 Frame = -2

Query  773  YXAKQR*AAARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGY  600
            Y   Q      +HSP+A +MIQ+HL+LILG R     N+ VQI++L++G++YAAS+MYGY
Sbjct  191  YWPNQEQKLEAIHSPDALDMIQSHLTLILGERVVGPLNTIVQISRLKLGKLYAASIMYGY  250

Query  599  FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS  420
            FLKRVDQRFQLE+ MK LP      D+  Q++  D     L    S  ++ S        
Sbjct  251  FLKRVDQRFQLERTMKTLP-----TDTRQQRIFDDLKPNPLWDLESMVQISS-----DDD  300

Query  419  RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  240
               G + K  RLR+YVM  D ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++
Sbjct  301  GSDGEDSKSYRLRSYVMYLDAETLQRYATIRSKESISLIEKQTQALFGRPDIRIAEDGSL  360

Query  239  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
            D+S DEL+ I+F+ L  LVLEAV FGS LW+ ES V+S+YHFV 
Sbjct  361  DTSNDELVGITFTGLTMLVLEAVAFGSILWEAESYVESKYHFVT  404



>ref|XP_002518989.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43522.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 148/215 (69%), Gaps = 13/215 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMI +HL+L+LG R      + VQI+K+++G++YAAS+MYGYFL+RVD+RFQL
Sbjct  202  VHSPEAFEMILSHLTLVLGERVVGPLETIVQISKIKLGKLYAASIMYGYFLRRVDERFQL  261

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF--GTEMKP  393
            E+ M  LP+  D+      +   D      R       +   PD G    GF    E K 
Sbjct  262  ERTMNTLPKDYDE-----NRARYDEPSPMNRLWDPDSLIRIQPDNG----GFMDTVEGKS  312

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
             RLR+YVM  D ETLQRYATIRSKEA+++IEK T+ALFGRP+I I   G+ID++ DE+I 
Sbjct  313  YRLRSYVMYLDVETLQRYATIRSKEAMSLIEKQTQALFGRPDIRIAEDGSIDTANDEVIS  372

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
            I+FS L  LVLEAV FGSFLW+ ES V+S+YHF++
Sbjct  373  ITFSGLTMLVLEAVAFGSFLWEGESYVESKYHFIS  407



>gb|KCW71713.1| hypothetical protein EUGRSUZ_E00224 [Eucalyptus grandis]
Length=465

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 148/213 (69%), Gaps = 8/213 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL++G+R     +S +Q +K+++G++YAAS+MYGYFL+RVD+RFQL
Sbjct  256  VHSPEAFEMIQSHLSLVVGDRVVGPLDSIIQSSKIKLGKLYAASIMYGYFLRRVDERFQL  315

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM-KPS  390
            E+ M  LP+G  +    ++     S      S    P     PD G G     +E  K  
Sbjct  316  ERTMNTLPKGYTENRVRLEDSIPTSPFWDPDSLIRIP-----PDDGDGGSFLDSEEGKLY  370

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I +   G+ID+S DE+I +
Sbjct  371  RLRSYVMYLDPETLQRYATIRSKEAISLIEKQTQALFGRPDIRVAEDGSIDTSSDEVISL  430

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            S S L  L+LEAV FGSFLWD E+ V+S+Y FV
Sbjct  431  SVSGLTMLILEAVAFGSFLWDAENFVESKYQFV  463



>ref|XP_003534296.1| PREDICTED: uncharacterized protein LOC100802337 [Glycine max]
Length=408

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 150/220 (68%), Gaps = 20/220 (9%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKRVD+RFQL
Sbjct  197  VHSPEALEMIQSHLSLVLGDRLVGPLQTVVQISKIKLGKLYAASIMYGYFLKRVDERFQL  256

Query  566  EKNMKVLPQGLDKEDS------GIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF--  411
            E++M +LP+   K  S      GI+    DS  T          V  + D G     +  
Sbjct  257  ERSMGILPKDFGKAKSYDEPSPGIKLWDPDSLIT----------VQDYDDEGYNDSDYMD  306

Query  410  GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  231
              E K  RLR YVM  D ETLQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I++S
Sbjct  307  TDEDKSFRLRAYVMQLDAETLQRLATVRSKEAISLIEKQTQALFGRPDIRVSDDGSIETS  366

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             DEL+ ++FS L  LVLEA+ FGSFLWD E+ V+S+Y F+
Sbjct  367  NDELLSLTFSGLTMLVLEAIAFGSFLWDKENYVESKYPFL  406



>emb|CDP11681.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 144/213 (68%), Gaps = 9/213 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMI +HLSL+LG R     ++ VQI+K+++G++YAAS+MYGYFL+RVD+R+QL
Sbjct  195  VHSPEAFEMILSHLSLVLGERVVGPLDTIVQISKIKLGKLYAASIMYGYFLRRVDERYQL  254

Query  566  EKNMKVLPQGLDKEDSGIQ-QVGGDssdtslrsspSHPEVVSWPDGGMG-SRGFGTEMKP  393
            E++M  LP+  +K     +    G             P+     D   G     G + K 
Sbjct  255  ERSMNTLPEKPNKGQPFFRGPTPGKQLWAPESLIQIPPD-----DADDGEPMDLGGDGKS  309

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
             RLR+YVM  D ETLQRYATIRSKEA+++IEK T+ALFGRP+I I   G++D+S+DE+  
Sbjct  310  YRLRSYVMYLDAETLQRYATIRSKEAVSLIEKQTQALFGRPDIRIAEDGSVDASRDEVTS  369

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
            ++FS L  LVLEAV FGSFLWD E   +S+YHF
Sbjct  370  LTFSGLTMLVLEAVAFGSFLWDAEGYAESKYHF  402



>ref|XP_009145204.1| PREDICTED: uncharacterized protein LOC103868901 [Brassica rapa]
Length=401

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 145/214 (68%), Gaps = 6/214 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+DQR+Q
Sbjct  188  IHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRIDQRYQ  247

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            LE+ M  LP+  DK     ++                 PE    PD     R  G E   
Sbjct  248  LERTMNTLPKRPDKTRERYEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRNEG-ESSS  305

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
              LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  306  YGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSNDEVLS  365

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +SFS L  LVLEAVTFGSFLWD ES V+S+YHF+
Sbjct  366  LSFSGLAMLVLEAVTFGSFLWDAESYVESKYHFL  399



>ref|XP_009804854.1| PREDICTED: uncharacterized protein LOC104250017 [Nicotiana sylvestris]
Length=405

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 149/216 (69%), Gaps = 14/216 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRS--NANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A+EMI +H+S++LG R     +S VQI+K+++G++YAAS+MYGYFLKRVD+R+QL
Sbjct  196  IHSADAFEMIVSHISIVLGEREVGPLDSIVQISKVKLGKLYAASIMYGYFLKRVDERYQL  255

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPE--VVSWPDGG--MGSRGFGTEM  399
            E++M   P+          Q+  +  + +       PE  +  +P+ G   G   F  E 
Sbjct  256  ERSMSKPPKSF--------QISTNPDEPAAPRQLWDPESLIEIYPEDGDREGLADFDIED  307

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK T+ALFGRP+I ++  GT+D S DE+
Sbjct  308  KSQRLRSYVMYLDAETLQRYATLRSKEAISVIEKQTQALFGRPDIKVSDDGTLDVSNDEV  367

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            + +++S L  LVLEAV FGSFLW+ ES V+S+YH +
Sbjct  368  LSVTYSGLTMLVLEAVAFGSFLWEAESYVESKYHII  403



>gb|KHN40428.1| hypothetical protein glysoja_000926 [Glycine soja]
Length=406

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 145/213 (68%), Gaps = 10/213 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKR+D+RFQL
Sbjct  198  VHSPEAFEMIQSHLSLVLGDRLVGPLQTVVQISKIKLGKLYAASIMYGYFLKRIDERFQL  257

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT-EMKPS  390
            E++M  LP+   K  S  +   G            H       D    S    T E +  
Sbjct  258  ERSMGTLPKDFGKAKSFDEPSPGIKLWDPDSLIIVH-------DYDNDSDHMDTDEGRSF  310

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR YVM  D ETLQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I++S DEL+ +
Sbjct  311  RLRAYVMQLDAETLQRLATVRSKEAISLIEKQTQALFGRPDIRVSEDGSIETSNDELLSL  370

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +FS L  LVLEA+ FGSFLWD E+ V+S+Y F+
Sbjct  371  TFSGLTMLVLEALAFGSFLWDKENYVESKYPFL  403



>emb|CDY35549.1| BnaA05g16370D [Brassica napus]
Length=402

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 143/214 (67%), Gaps = 5/214 (2%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+DQR+Q
Sbjct  188  IHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRIDQRYQ  247

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            LE+ M  LP+  DK     ++                 PE    PD     R        
Sbjct  248  LERTMNTLPKRPDKTRERYEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRNEEESSSS  306

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
              LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  307  YGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSNDEVLS  366

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +SFS L  LVLEAVTFGSFLWD ES V+S+YHF+
Sbjct  367  LSFSGLAMLVLEAVTFGSFLWDAESYVESKYHFL  400



>ref|XP_009413222.1| PREDICTED: uncharacterized protein LOC103994576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=406

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 148/213 (69%), Gaps = 12/213 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A EMIQ+HL+LILG R     N+  QI+KL++G++YAAS+MYGYFLKRVD+R+QL
Sbjct  203  MHSPDALEMIQSHLTLILGERVGGPLNTVAQISKLKLGKLYAASIMYGYFLKRVDERYQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP     +  G Q++  +     L    S  ++ S           G E KP R
Sbjct  263  ERTMKTLP----TKPRG-QRIFDELKPNPLWDLESMVQISS-----DDDDFDGDETKPYR  312

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++++  DE++ I+
Sbjct  313  LRSYVMYLDAETLQRYATIRSKESISLIEKQTQALFGRPDIRIADDGSLETPNDEVVGIT  372

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
            FS L  LVLEAV FG+FLW+ E  V+S++HF++
Sbjct  373  FSGLTMLVLEAVAFGTFLWEAEGYVESKFHFLS  405



>ref|XP_009413223.1| PREDICTED: uncharacterized protein LOC103994576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=402

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 148/213 (69%), Gaps = 12/213 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A EMIQ+HL+LILG R     N+  QI+KL++G++YAAS+MYGYFLKRVD+R+QL
Sbjct  199  MHSPDALEMIQSHLTLILGERVGGPLNTVAQISKLKLGKLYAASIMYGYFLKRVDERYQL  258

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP     +  G Q++  +     L    S  ++ S           G E KP R
Sbjct  259  ERTMKTLP----TKPRG-QRIFDELKPNPLWDLESMVQISS-----DDDDFDGDETKPYR  308

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKE+I++IEK T+ALFGRP+I I   G++++  DE++ I+
Sbjct  309  LRSYVMYLDAETLQRYATIRSKESISLIEKQTQALFGRPDIRIADDGSLETPNDEVVGIT  368

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
            FS L  LVLEAV FG+FLW+ E  V+S++HF++
Sbjct  369  FSGLTMLVLEAVAFGTFLWEAEGYVESKFHFLS  401



>gb|ACN34329.1| unknown [Zea mays]
Length=239

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 146/212 (69%), Gaps = 10/212 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A+EMIQNHL+LI+G +  S  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  34   IHSADAFEMIQNHLNLIMGEKIASPPDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  93

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK LP   +      QQ+  ++   +          ++ PDG   S     +  P++
Sbjct  94   EKTMKTLPPKPN------QQIVFENLQPNPFWDMESLVQIT-PDGEEISLD-DEKSNPNK  145

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G++++    +I I+
Sbjct  146  LRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGRMITIT  205

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F+ L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  206  FTELNHLVLEAVAFGSFLWEAESYVESKYHFV  237



>emb|CDY29940.1| BnaC05g28960D [Brassica napus]
Length=401

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 148/219 (68%), Gaps = 16/219 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+DQR+Q
Sbjct  188  IHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRIDQRYQ  247

Query  569  LEKNMKVLPQGLDK------EDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            LE+ M  LP+  DK      E S    +    S   ++     P+  +       S  +G
Sbjct  248  LERTMNTLPKRPDKTRERYEEPSPPYPLWDPDSLIRIQPEEYDPDEYAIQRNEDESSSYG  307

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
                   LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S 
Sbjct  308  -------LRSYVTYLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSN  360

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF+
Sbjct  361  DEVLSLSFSGLATLVLEAVTFGSFLWDAESYVESKYHFL  399



>ref|XP_006415245.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
 gb|ESQ33598.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
Length=405

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 145/214 (68%), Gaps = 6/214 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+DQR+Q
Sbjct  192  IHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRIDQRYQ  251

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            LE+ M  LP+  +K     ++                 PE    PDG    R    E   
Sbjct  252  LERTMNTLPKRPEKTRERYEEPSPPYPLWDPDSLIRIQPEEYD-PDGYAIERD-ENESSS  309

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
              LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  310  YGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSNDEVLS  369

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +SFS L  LVLEAVTFGSFLWD ES V+S+YHF+
Sbjct  370  LSFSGLAMLVLEAVTFGSFLWDAESYVESKYHFL  403



>ref|XP_004245960.1| PREDICTED: uncharacterized protein LOC101262445 [Solanum lycopersicum]
Length=402

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 153/228 (67%), Gaps = 16/228 (7%)
 Frame = -2

Query  773  YXAKQR*AAARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGY  600
            Y   Q      +HSP+A+EMI +H++++LG R+    +S VQ++K+++G++YAAS+MYGY
Sbjct  182  YWPNQEQKLESVHSPDAFEMIISHITIVLGERAVGPLDSIVQMSKIKLGKLYAASIMYGY  241

Query  599  FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPE--VVSWPDGGM  426
            FLKRVD+R+QLE+++   P+          Q+  +  + +       P+  +  +P+ G 
Sbjct  242  FLKRVDERYQLERSVSKPPESF--------QISTNPDEPAAPRQLWDPDSLIEIYPEDG-  292

Query  425  GSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  255
               GF     E KP RLR+YVM  D +TLQRYAT+RSKEA+ +IEK T+ALFGRP+I +T
Sbjct  293  DREGFAVSDIEGKPERLRSYVMYLDADTLQRYATLRSKEAVTVIEKQTQALFGRPDIKVT  352

Query  254  PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
              GT+D S DE++ +++S L  LVLEAV+FGSFLW+ E  V+S+YH +
Sbjct  353  GDGTLDVSNDEVLSVTYSGLTMLVLEAVSFGSFLWETEGYVESKYHII  400



>ref|XP_006352932.1| PREDICTED: uncharacterized protein LOC102595128 [Solanum tuberosum]
Length=402

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 153/228 (67%), Gaps = 16/228 (7%)
 Frame = -2

Query  773  YXAKQR*AAARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGY  600
            Y   Q      +HSP+A+EMI +H++++LG R+    +S VQ++K+++G++YAAS+MYGY
Sbjct  182  YWPNQEQKLESVHSPDAFEMIISHITIVLGERAVGPLDSIVQMSKIKLGKLYAASIMYGY  241

Query  599  FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPE--VVSWPDGGM  426
            FLKRVD+R+QLE+++   P+          Q+  +  + +       P+  +  +P+ G 
Sbjct  242  FLKRVDERYQLERSVSKPPESF--------QISTNPDEPAAPRQLWDPDSLIEIYPEDG-  292

Query  425  GSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  255
               GF     E KP RLR+YVM  D +TLQRYAT+RSKEA+ +IEK T+ALFGRP+I ++
Sbjct  293  DREGFAVSDIEGKPERLRSYVMYLDADTLQRYATLRSKEAVTVIEKQTQALFGRPDIKVS  352

Query  254  PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
              GT+D S DE++ +++S L  LVLEAV FGSFLW+ ES V+S+YH +
Sbjct  353  GDGTLDVSNDEVLSVTYSGLTMLVLEAVAFGSFLWETESYVESKYHII  400



>ref|NP_001053731.1| Os04g0595100 [Oryza sativa Japonica Group]
 emb|CAE03929.1| OSJNba0093F12.3 [Oryza sativa Japonica Group]
 emb|CAD41566.3| OSJNBa0006A01.21 [Oryza sativa Japonica Group]
 dbj|BAF15645.1| Os04g0595100 [Oryza sativa Japonica Group]
 gb|EAZ31841.1| hypothetical protein OsJ_16003 [Oryza sativa Japonica Group]
 dbj|BAG90593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=405

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 143/212 (67%), Gaps = 10/212 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  200  IHSPDALEMIQNHLNLIMGEKVAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  259

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EKNMK LP    K+   ++ +  +              V   PDG         E  P++
Sbjct  260  EKNMKTLPPN-PKQQIVLENLKPNPFWDMESL------VQITPDGEEIDLD-DEESNPNK  311

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G++++   ++I I+
Sbjct  312  LRSYVSRLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGQMITIT  371

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  L  LVLEA  FGSFLW+ ES V+S+YHFV
Sbjct  372  FIELTHLVLEAAAFGSFLWEAESHVESKYHFV  403



>gb|EYU43718.1| hypothetical protein MIMGU_mgv1a007450mg [Erythranthe guttata]
Length=407

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 151/227 (67%), Gaps = 29/227 (13%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS EA+EMI +HL+L+LG R     ++ +Q++K+++G++YAASVMYGYFL+RVD+R+QL
Sbjct  191  VHSAEAFEMILSHLALVLGERVVGPPDTIIQMSKIKLGKLYAASVMYGYFLRRVDERYQL  250

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSW-PDGGM-------GSRGF  411
            E++M  LP+G  + +  ++                 P+   W PD  +       G  G 
Sbjct  251  ERSMNTLPEGFGEFEDRVR------------FEEPTPDKQQWDPDSLIRIYPNEDGEYGA  298

Query  410  GT-------EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITP  252
             T       E K  +LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I +T 
Sbjct  299  STVEDSSTNEDKSYKLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDIKVTE  358

Query  251  QGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             G++D+S DE++ ++FS L  LVLEAV FGSFLWD E+ V+S+Y F+
Sbjct  359  DGSLDASNDEIVSLTFSGLTMLVLEAVAFGSFLWDNENFVESKYPFI  405



>gb|EEC77902.1| hypothetical protein OsI_17223 [Oryza sativa Indica Group]
Length=420

 Score =   201 bits (511),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 143/214 (67%), Gaps = 14/214 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  215  IHSPDALEMIQNHLNLIMGEKVAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  274

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHP--EVVSWPDGGMGSRGFGTEMKP  393
            EKNMK LP    K+   ++ +  +            P  E +   D          E  P
Sbjct  275  EKNMKTLPPN-PKQQIVLENLKPNPFWDMESLVQITPDGEEIDLDD---------EESNP  324

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
            ++LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G++++   ++I 
Sbjct  325  NKLRSYVSRLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGQMIT  384

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            I+F  L  LVLEA  FGSFLW+ ES V+S+YHFV
Sbjct  385  ITFIELTHLVLEAAAFGSFLWEAESHVESKYHFV  418



>gb|KFK44959.1| hypothetical protein AALP_AA1G325800 [Arabis alpina]
Length=405

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 144/214 (67%), Gaps = 6/214 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS EA+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAASVMYGYFL+R+D R+Q
Sbjct  192  IHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASVMYGYFLRRIDSRYQ  251

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            LE+ MK LP+  +K     ++                 PE    PD     R    E   
Sbjct  252  LERTMKTLPKRSEKTRERFEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRN-EDESSS  309

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
            S LR YVM  D +TLQRYATIRSKEA+++IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  310  SGLRAYVMQLDSDTLQRYATIRSKEAMSLIEKQTQALFGRPDIRILEDGKLDTSNDEILS  369

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +S S L  LVLEAV+FGSFLWD E+ V+S+YHF+
Sbjct  370  LSVSGLAMLVLEAVSFGSFLWDAETYVESKYHFL  403



>ref|XP_004976664.1| PREDICTED: uncharacterized protein LOC101761297 [Setaria italica]
Length=402

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 144/214 (67%), Gaps = 14/214 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A+EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  197  IHSPDAFEMIQNHLNLIMGEKIAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  256

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHP--EVVSWPDGGMGSRGFGTEMKP  393
            EK MK LP    K+    + +  +            P  E +S  D          E  P
Sbjct  257  EKTMKTLPPN-PKQQIVFENLKPNPFWDMESLVQITPDGEEISLDD---------EESNP  306

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
            ++LR+YV   D +TLQRYATIRSKEA+++IEK T++LFGRP+I +   G++++   ++I 
Sbjct  307  NKLRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQSLFGRPDIKVLDDGSVNARDGQMIT  366

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            I+F  L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  367  ITFIELNHLVLEAVAFGSFLWEAESYVESKYHFV  400



>ref|XP_010540738.1| PREDICTED: uncharacterized protein LOC104814412 [Tarenaya hassleriana]
Length=407

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 147/215 (68%), Gaps = 6/215 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS EA+EMIQ+HL+L+LG+R     NS VQI+K+++G++YAASVMYGYFL+RVDQR+QL
Sbjct  192  VHSAEAFEMIQSHLTLVLGDRMVGPLNSIVQISKIKLGKLYAASVMYGYFLRRVDQRYQL  251

Query  566  EKNMKVLP-QGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            E+ M  LP +  +K     ++                 PE    PD     R    E + 
Sbjct  252  ERKMNTLPSKRQEKTRERYEEPSPPYPLWDPDSLIRIQPEDYD-PDEYAMDREAEEEGES  310

Query  392  S-RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
            S RLR+YVM  D ETLQRYATIRSKEA+++IE+ T+ALFGRP+I I   G +++S DE++
Sbjct  311  SYRLRSYVMYLDPETLQRYATIRSKEAMSLIERQTQALFGRPDIRILEDGKLNTSNDEVL  370

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             ++FS L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  371  SLTFSGLAMLVLEAVAFGSFLWDAESYVESKYHFL  405



>ref|XP_006854071.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
 gb|ERN15538.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
Length=383

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 145/214 (68%), Gaps = 19/214 (9%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS EA+EMI+NHL+L+LG R  +     ++I+KLR+G++YAAS+MYGYFL+RVDQRFQL
Sbjct  187  IHSNEAFEMIENHLALVLGGRWPNPTQPRIEISKLRIGKLYAASIMYGYFLRRVDQRFQL  246

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E++M  L   ++ ED   Q   G+  D           +V+  D          + K   
Sbjct  247  ERSMGTLSLEVE-EDESDQVTEGEFFDAEF--------LVTESDS--------DDPKSYL  289

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  + E+LQRYATIRSKEA+++IEK T+ALFGRP+I +   G++D+  DE+I +S
Sbjct  290  LRSYVMHLNSESLQRYATIRSKEAVSVIEKQTQALFGRPDIRMAEDGSLDALNDEVIAVS  349

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  105
            F SL  LVLEAV FGSFLWDVE   DS+YHF+ +
Sbjct  350  FESLNALVLEAVAFGSFLWDVEGYADSKYHFLTN  383



>ref|NP_001242537.1| uncharacterized protein LOC100810147 [Glycine max]
 gb|ACU21518.1| unknown [Glycine max]
Length=406

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 143/213 (67%), Gaps = 10/213 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKR+D+RFQL
Sbjct  198  VHSPEAFEMIQSHLSLVLGDRLVGPLQTVVQISKIKLGKLYAASIMYGYFLKRIDERFQL  257

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT-EMKPS  390
            E++M  LP+   K  S  +   G            H       D    S    T E +  
Sbjct  258  ERSMGTLPKDFGKAKSFDEPSPGIKLWDPDSLIIVH-------DYDNDSDHMDTDEGRSF  310

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR YVM  D ETLQR AT+RSKEAI++IEK T+AL GRP+I ++  G+I++S DEL+ +
Sbjct  311  RLRAYVMQLDAETLQRLATVRSKEAISLIEKQTQALVGRPDIRVSEDGSIETSNDELLSL  370

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +FS L  LVLEA+ FGSFLWD E+ V+S Y F+
Sbjct  371  TFSGLTMLVLEALAFGSFLWDKENYVESEYPFL  403



>ref|XP_007158234.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
 gb|ESW30228.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
Length=408

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 147/218 (67%), Gaps = 17/218 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG+R      + VQI+K+++G++YAAS+MYGYFLKRVD+RFQL
Sbjct  198  VHSPEAFEMIQSHLSLVLGDRLVGPLQAIVQISKIKLGKLYAASIMYGYFLKRVDERFQL  257

Query  566  EKNMKVLPQGLDKEDS------GIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            E+++  LP+ L K  S      GI+    DS                + D         T
Sbjct  258  ERSVGTLPKDLGKTKSFEEPSPGIKLWDPDSLIIVQDYDDDSYSDSDYMD---------T  308

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
            E K  RLR YVM  D ++LQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I++S D
Sbjct  309  EGKSFRLRAYVMQLDPDSLQRLATVRSKEAISLIEKQTQALFGRPDIRVSNDGSIETSND  368

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            EL+ ++FS +  L+LEAV FGSFLWD E  V+S+Y F+
Sbjct  369  ELLSLTFSGMTMLILEAVAFGSFLWDKEKYVESKYPFL  406



>ref|XP_002448446.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
 gb|EES12774.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
Length=402

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 144/214 (67%), Gaps = 14/214 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A+EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  197  IHSADAFEMIQNHLNLIMGEKIAAPPDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  256

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHP--EVVSWPDGGMGSRGFGTEMKP  393
            EK MK LP    K+    + +  +            P  E +S  D G           P
Sbjct  257  EKTMKTLPPN-PKQQIVFENLQPNPFWDMESLVQITPDGEEISLDDEGSN---------P  306

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
            ++L++YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G++++    ++ 
Sbjct  307  NKLKSYVSKLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGRMVT  366

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            I+F+ L  LVLEAVTFGSFLW+ ES V+S+YHFV
Sbjct  367  ITFTELNHLVLEAVTFGSFLWEAESYVESKYHFV  400



>ref|XP_006653725.1| PREDICTED: uncharacterized protein LOC102702753 [Oryza brachyantha]
Length=399

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 142/212 (67%), Gaps = 10/212 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSP+A EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  194  IHSPDALEMIQNHLNLIMGEKVAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  253

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EKNMK LP    K+    + +  +              V   PDG         E  P++
Sbjct  254  EKNMKTLPPN-PKQQIVFENLKPNPFWDMESL------VQITPDGEEIDLD-DEESNPNK  305

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G++++   ++I I+
Sbjct  306  LRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGSVNAKDGQMITIT  365

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  L  LVLEA  FGSFLW+ ES ++S+YHFV
Sbjct  366  FIELTHLVLEAAAFGSFLWEAESHIESKYHFV  397



>gb|EMT04061.1| hypothetical protein F775_32804 [Aegilops tauschii]
Length=392

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 143/212 (67%), Gaps = 8/212 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  185  IHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  244

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK LP  L+      +++  +              V   PDG M       E  P++
Sbjct  245  EKTMKTLPPSLN------EKLFTERDIKPNPFMDMESLVRMTPDGEMVDVEEDEETNPNK  298

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G++++   + + ++
Sbjct  299  LRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGSVNAKDGKTVTLT  358

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  359  FTELTHLVLEAAGFGAFLWEAESHVESKYHFV  390



>gb|EPS63452.1| hypothetical protein M569_11331, partial [Genlisea aurea]
Length=342

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 145/218 (67%), Gaps = 29/218 (13%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--------SNANSSVQINKLRVGQVYAASVMYGYFLKRV  585
            +HSPEA+EM+ +HLSL+LG R        S   S VQI+K+++G++YA+S+MYGYFL+RV
Sbjct  144  VHSPEAFEMVLSHLSLVLGERMTTTTGGPSEDPSVVQISKIKLGKLYASSIMYGYFLRRV  203

Query  584  DQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
            D+R+QLE+++  LP  + ++      +                 +  +PDG       G+
Sbjct  204  DERYQLERSVNTLPPPVGRQLWDPASL-----------------IRIYPDGAAYPEDDGS  246

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
                 +LR+YVM  D ETLQ+YAT+RSKEA+++IEK T+A+FG+PEIS+T +G++D++ D
Sbjct  247  H----KLRSYVMYLDAETLQKYATMRSKEALSLIEKQTQAVFGKPEISVTEEGSLDAADD  302

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            E   +SF  L  LVLEAV FGSFLWD E+ V+S+Y FV
Sbjct  303  ETFSVSFPDLTVLVLEAVAFGSFLWDAETFVESKYSFV  340



>ref|XP_004512464.1| PREDICTED: uncharacterized protein LOC101507671 [Cicer arietinum]
Length=410

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 146/216 (68%), Gaps = 12/216 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS EA+EMIQ+HLSL+LG R      + VQI+K+++G++YAAS+MYGYFLKRVD RFQL
Sbjct  199  VHSSEAFEMIQSHLSLVLGERVVGPLQTIVQISKIKLGKLYAASIMYGYFLKRVDDRFQL  258

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG----MGSRGFGTEM  399
            E+   +LPQ   KE+     +  D      +   S   +  +PD      M +   G E 
Sbjct  259  ERRTGILPQDFGKEN-----ISFDEPSPPNKLWDSDSLIRIYPDEEGYYEMDNMATG-EG  312

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            +  RLRTYVM  D ETLQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I++S DE+
Sbjct  313  RSFRLRTYVMQLDAETLQRLATVRSKEAISLIEKQTQALFGRPDIRVSKDGSIETSNDEV  372

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            + ++FS L  LVLEAV FGSFLW  E+ VD +Y F+
Sbjct  373  LSLTFSGLTMLVLEAVAFGSFLWVQENYVDIKYPFL  408



>gb|EMS68345.1| hypothetical protein TRIUR3_07699 [Triticum urartu]
Length=391

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 143/212 (67%), Gaps = 8/212 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  184  IHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  243

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK LP  L+      +++  +              V   PDG M       E  P++
Sbjct  244  EKTMKTLPPSLN------EKLFTERDIKPNPFMDMESLVRMTPDGEMVDVEEDEETNPNK  297

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G++++   + + ++
Sbjct  298  LRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGSVNAKDGKTVTLT  357

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  358  FTELTHLVLEAAGFGAFLWEAESHVESKYHFV  389



>dbj|BAJ87444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 144/212 (68%), Gaps = 8/212 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  185  IHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  244

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK LP  L+++    + +  +              V   PDG M       E  P++
Sbjct  245  EKTMKTLPPSLNEKLFTERDIKPNPFMDMESL------VRMTPDGEMVDVEEDEETNPNK  298

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKE++++IEK T+ALFGRP+I +   G++++   + + ++
Sbjct  299  LRSYVSRLDADTLQRYATIRSKESVSLIEKQTQALFGRPDIKVLDDGSVNAKDGKTVTLT  358

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  359  FTELTHLVLEAAGFGAFLWEAESHVESKYHFV  390



>ref|XP_009607216.1| PREDICTED: uncharacterized protein LOC104101473 [Nicotiana tomentosiformis]
Length=405

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 148/216 (69%), Gaps = 14/216 (6%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRS--NANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A+EMI +H+S++LG R     +S VQI+K+++G++YAAS+MYGYFLKRVD+R+QL
Sbjct  196  IHSADAFEMILSHISIVLGEREVGPLDSIVQISKVKLGKLYAASIMYGYFLKRVDERYQL  255

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPE--VVSWPDGG--MGSRGFGTEM  399
            E++M   P+          Q+  +  + +       PE  +  +P+ G   G      E 
Sbjct  256  ERSMSKPPESF--------QISTNPDEPAAPRQLWDPESLIEIYPEDGDREGLADSDIEG  307

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK T+ALFG+P+I ++  GT+D S DE+
Sbjct  308  KSQRLRSYVMYLDAETLQRYATLRSKEAISVIEKQTQALFGQPDIKVSDDGTLDVSNDEV  367

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            + +++S L  LVLEAV FGSFLW+ ES V+S+YH +
Sbjct  368  LSVTYSGLTMLVLEAVAFGSFLWEAESYVESKYHII  403



>gb|AFW59314.1| hypothetical protein ZEAMMB73_007794 [Zea mays]
Length=400

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 146/212 (69%), Gaps = 10/212 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A+EMIQNHL+LI+G +  S  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  195  IHSADAFEMIQNHLNLIMGEKIASPPDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  254

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK LP   +      QQ+  ++   +          ++ PDG   S     +  P++
Sbjct  255  EKTMKTLPPKPN------QQIVFENLQPNPFWDMESLVQIT-PDGEEISLD-DEKSNPNK  306

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G++++    +I I+
Sbjct  307  LRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGRMITIT  366

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F+ L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  367  FTELNHLVLEAVAFGSFLWEAESYVESKYHFV  398



>ref|NP_001145533.1| uncharacterized protein LOC100278968 [Zea mays]
 gb|ACG48280.1| hypothetical protein [Zea mays]
Length=400

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 146/212 (69%), Gaps = 10/212 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A+EMIQNHL+LI+G +  S  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  195  IHSADAFEMIQNHLNLIMGEKIASPPDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  254

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK LP   +      QQ+  ++   +          ++ PDG   S     +  P++
Sbjct  255  EKTMKTLPPKPN------QQIVFENLQPNPFWDMESLVQIT-PDGEEISLD-DEKSNPNK  306

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G++++    +I I+
Sbjct  307  LRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGRMITIT  366

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F+ L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  367  FTELNHLVLEAVAFGSFLWEAESYVESKYHFV  398



>ref|XP_003612708.1| hypothetical protein MTR_5g028020 [Medicago truncatula]
 gb|AES95666.1| plant/F3C3-6 protein [Medicago truncatula]
Length=410

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRS--NANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS EA+EMIQ+HLSL+LG R+     + +QI+K+++G++YAAS+MYGYFLKRVD+RFQL
Sbjct  197  VHSSEAFEMIQSHLSLVLGERAVGPLQTIIQISKIKLGKLYAASIMYGYFLKRVDERFQL  256

Query  566  EKNMKVLPQGLDKEDSGIQQVGG-DssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            E+++  LPQ L KE+    +    +    S      +P+   + +    + G G E K S
Sbjct  257  ERSVGTLPQDLGKENISFDEPSPPNKLWDSDSLIRIYPDDEGYYEMDDMNTGDG-EGKSS  315

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
             LR YV   D E LQR AT+RSKEAI++IEK T+ALFGRP+I ++  G+I+++ DE++ +
Sbjct  316  GLRAYVTQLDTEALQRLATVRSKEAISLIEKQTQALFGRPDIRLSGDGSIETTNDEVLSL  375

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
            +FS L  LVLE+V FGSFLWD E+ V+S+Y F+A
Sbjct  376  TFSGLTMLVLESVAFGSFLWDEENYVESKYPFLA  409



>ref|XP_010677383.1| PREDICTED: uncharacterized protein LOC104893042 [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 146/226 (65%), Gaps = 29/226 (13%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS EA EMIQ+HLSL+LG R      S V+I+K+++G++YAAS+MYGYFL+RVDQR+QL
Sbjct  203  VHSTEAIEMIQSHLSLVLGERLVGPLQSLVEISKIKLGKLYAASIMYGYFLRRVDQRYQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSW-PDG---------GMGSR  417
            E+ MK LP+   K  +  Q               S P+   W PD           M S 
Sbjct  263  ERAMKTLPEDFGKSTTRFQD--------------SVPQSPFWDPDSLIQIPADEEDMVSY  308

Query  416  GFGTEM---KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  246
            G   ++   K  +LR+YVM  D +TLQRYAT+RSKEA+++IE+ T++LFGRP+I I   G
Sbjct  309  GEPLDIGDGKSYKLRSYVMYLDTDTLQRYATLRSKEAMSLIERQTQSLFGRPDIKIAESG  368

Query  245  TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  108
             +++  DE+I ISFS L  LVLEAV FGSFLWD E  V+S+Y FV+
Sbjct  369  VLETQNDEIISISFSGLTMLVLEAVAFGSFLWDSEDYVESKYSFVS  414



>ref|XP_010240349.1| PREDICTED: uncharacterized protein LOC104585415 [Brachypodium 
distachyon]
Length=391

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 142/212 (67%), Gaps = 9/212 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQL
Sbjct  185  IHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQL  244

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            EK MK LP       S  +Q+  +              V   PDG         E  P++
Sbjct  245  EKTMKTLPP------SPKEQIVMERDLKPNPFWDMESLVQISPDGEEVDLD-DEESNPNK  297

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YV   D +TLQ+YATIRSKE++++IEK T+ALFGRP+I +   G++++   +++ I+
Sbjct  298  LRSYVSRLDADTLQKYATIRSKESVSLIEKQTQALFGRPDIKVLDDGSVNAKDGKIVTIT  357

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F+ L  LVLEA  FG+FLW+ ES ++S+YHFV
Sbjct  358  FTELTNLVLEAAGFGAFLWEAESHIESKYHFV  389



>ref|XP_010499760.1| PREDICTED: uncharacterized protein LOC104777247 [Camelina sativa]
Length=410

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 140/214 (65%), Gaps = 6/214 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR---SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS +A+EMIQ+HLS +LG+R   S  +S VQI+K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  197  IHSADAFEMIQSHLSSVLGDRTAVSPLSSIVQISKIKLGKLYAASAMYGYFLRRVDQRYQ  256

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            LE+ M  LP+  +K     ++                 PE    PD     R    E   
Sbjct  257  LERTMNTLPKRPEKTRERFEEPSPPYPLWDPNSLIRIQPEEYD-PDEYAIQRN-EDESSS  314

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
              LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  315  YGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSNDEVMS  374

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  375  LSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  408



>ref|XP_010461033.1| PREDICTED: uncharacterized protein LOC104741810 [Camelina sativa]
Length=406

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 145/219 (66%), Gaps = 16/219 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS +A+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  193  IHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASAMYGYFLRRVDQRYQ  252

Query  569  LEKNMKVLPQGLDK------EDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            LE+ M  LP+  +K      E S    +   +S   ++     P+  +       S  +G
Sbjct  253  LERTMNTLPKRPEKTRERFEEPSPPYPLWDPNSLIRIQPEEYDPDEYAIQRNEDESSSYG  312

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
                   LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S 
Sbjct  313  -------LRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSN  365

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  366  DEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  404



>ref|XP_004253444.1| PREDICTED: uncharacterized protein LOC101265814, partial [Solanum 
lycopersicum]
Length=273

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 137/214 (64%), Gaps = 6/214 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS +A+EMIQ+HLS +LG+       +S VQI K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  60   IHSADAFEMIQSHLSSVLGDGPAVGPLSSIVQIGKIKLGKLYAASAMYGYFLRRVDQRYQ  119

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            LE+ M  LP+  +K     ++                 PE    PD     R    E   
Sbjct  120  LERTMNTLPKRPEKTRERFEEPSPPYPLWDPDSLIRIQPEEYD-PDEYAIQRN-EDESSS  177

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
              LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  178  YGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSNDEVLS  237

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  238  LSLSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  271



>ref|XP_002890970.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67229.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 143/219 (65%), Gaps = 16/219 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS +A+EMIQ+HLS +LG+R+     +S VQI K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  193  IHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQIGKIKLGKLYAASAMYGYFLRRVDQRYQ  252

Query  569  LEKNMKVLPQGLDK------EDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            LE+ M  LP+  +K      E S    +    S   ++     P+  +       S  +G
Sbjct  253  LERTMNTLPKRPEKTRERFEEPSPPYPLWDPDSLIRIQPEEYDPDEYAIQRNEDESSSYG  312

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
                   LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S 
Sbjct  313  -------LRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSN  365

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  366  DEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  404



>ref|XP_010478637.1| PREDICTED: uncharacterized protein LOC104757587 [Camelina sativa]
Length=407

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 139/214 (65%), Gaps = 6/214 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS +A+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  194  IHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASAMYGYFLRRVDQRYQ  253

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssd-tslrsspSHPEVVSWPDGGMGSRGFGTEMKP  393
            LE+ M  LP+  +K     ++                 PE   +       +    E   
Sbjct  254  LERTMNTLPKRPEKTRERFEEPSPPYPLWDPNSLIRIQPE--EYDSDEYAIQRNEDESSS  311

Query  392  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  213
              LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S DE++ 
Sbjct  312  YGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSNDEVLS  371

Query  212  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  372  LSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  405



>ref|XP_002981973.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
 gb|EFJ17066.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
Length=324

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 143/230 (62%), Gaps = 34/230 (15%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILG-----NRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HSPEA+EMI+ H+ ++LG     +R   ++  QI+KLRVGQ+YA SVMYGYFLKRVD+R
Sbjct  105  VHSPEAFEMIKEHMEMVLGGHATLSRVEPHTVAQISKLRVGQIYATSVMYGYFLKRVDER  164

Query  575  FQLEKNMKVLPQ-------------GLDKEDSG--IQQVGGDssdtslrsspSHPEVVSW  441
            +QLEK MK+L +              ++K +S   IQ  G  S    + SS   P  V+ 
Sbjct  165  YQLEKKMKILTRVAESGRGFTTQFLSIEKRESSEMIQAAGAASELDLVSSSSRSPSQVA-  223

Query  440  PDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEIS  261
                         +K + LR YV  FD ETL RYAT+R+ E +++IE+H EALFGRP++ 
Sbjct  224  -------------LKNNDLRAYVAKFDHETLSRYATMRTHETVDLIERHAEALFGRPDLR  270

Query  260  ITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +   G++  ++D+ I+I F+SLR LV+EA  FGS+LWDVES VD  Y  V
Sbjct  271  VAADGSVGLARDDAIQIKFASLRALVMEAAAFGSYLWDVESYVDIHYRVV  320



>ref|XP_006307539.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
 gb|EOA40437.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
Length=440

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 142/225 (63%), Gaps = 29/225 (13%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS +A+EMIQ+HLS +LG+R+     +S VQI+K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  228  IHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQISKIKLGKLYAASAMYGYFLRRVDQRYQ  287

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSW-PDGGM-------GSRG  414
            LE+ M  LP+  +K     ++                P    W PD  +        S  
Sbjct  288  LERTMNTLPKRPEKTRERYEEPS--------------PPYPLWDPDSLIRIQPEEYDSDE  333

Query  413  FGTEMKPSR----LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  246
            +  +         LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G
Sbjct  334  YAIQRNEDESSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDG  393

Query  245  TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
             +D+S DE++ +S S L  LVLEAV FGSFLWD E+ V+S+YHF+
Sbjct  394  KLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSETYVESKYHFL  438



>ref|XP_002982952.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
 gb|EFJ16197.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
Length=324

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 142/230 (62%), Gaps = 34/230 (15%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILG-----NRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HSPEA+EMI+ H+ ++LG     +R   ++  QI+KLRVGQ+YA SVMYGYFLKRVD+R
Sbjct  105  VHSPEAFEMIKEHMEMVLGGHATLSRVEPHTVAQISKLRVGQIYATSVMYGYFLKRVDER  164

Query  575  FQLEKNMKVLPQ-------------GLDKEDSG--IQQVGGDssdtslrsspSHPEVVSW  441
            +QLEK MK+L +              ++K +S   IQ     S    + SS   P  V+ 
Sbjct  165  YQLEKKMKILTRVAESGRGFTTQFLSIEKRESSEMIQAAAAASELDLVSSSSRSPSQVA-  223

Query  440  PDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEIS  261
                         +K + LR YV  FD ETL RYAT+R+ E +++IE+H EALFGRP++ 
Sbjct  224  -------------LKNNDLRAYVAKFDHETLSRYATMRTHETVDLIERHAEALFGRPDLR  270

Query  260  ITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +   G++  ++D+ I+I F+SLR LV+EA  FGS+LWDVES VD  Y  V
Sbjct  271  VAADGSVGLARDDAIQIKFASLRALVMEAAAFGSYLWDVESYVDIHYRVV  320



>ref|NP_564389.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG23441.1|AC084165_7 unknown protein [Arabidopsis thaliana]
 gb|AAK59781.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AAM65447.1| unknown [Arabidopsis thaliana]
 gb|AAO11596.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AEE31442.1| uncharacterized protein AT1G32160 [Arabidopsis thaliana]
Length=406

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 141/219 (64%), Gaps = 16/219 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA---NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            +HS +A+EMIQ+HLS +LG+       +S VQI K+++G++YAAS MYGYFL+RVDQR+Q
Sbjct  193  IHSADAFEMIQSHLSSVLGDGPAVGPLSSIVQIGKIKLGKLYAASAMYGYFLRRVDQRYQ  252

Query  569  LEKNMKVLPQGLDK------EDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            LE+ M  LP+  +K      E S    +    S   ++     P+  +       S  +G
Sbjct  253  LERTMNTLPKRPEKTRERFEEPSPPYPLWDPDSLIRIQPEEYDPDEYAIQRNEDESSSYG  312

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
                   LR+YV   D +TLQRYATIRSKEA+ +IEK T+ALFGRP+I I   G +D+S 
Sbjct  313  -------LRSYVTYLDSDTLQRYATIRSKEAMTLIEKQTQALFGRPDIRILEDGKLDTSN  365

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  366  DEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHFL  404



>ref|XP_011018702.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105121674 
[Populus euphratica]
Length=255

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 136/208 (65%), Gaps = 8/208 (4%)
 Frame = -2

Query  719  EMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVL  546
            EMIQ+HLS++LG R      + V+I+K+++ +++AAS++YGYFL+RVDQR+QLE+ M  L
Sbjct  49   EMIQSHLSIVLGVRLVCPLETIVEISKVKLXKLFAASILYGYFLRRVDQRYQLERTMNTL  108

Query  545  PQGLDKEDSGIQQVG-GDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVM  369
            P+G DK+ +  + +                P     PDGG    G   E K  RLR+YVM
Sbjct  109  PKGFDKDRAWFEDLSPAKPLWGPESLIRIVPGDSGCPDGGSXDTG---EEKSYRLRSYVM  165

Query  368  SFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRR  189
            +   ETL+RYAT+RSKEAI++ EK  +AL GRP+I I   G+I+++ DE++ I+FS L  
Sbjct  166  NLYVETLERYATLRSKEAISLNEKQAKALSGRPDIRIAENGSIETANDEVVSITFSGLAM  225

Query  188  LVLEAV--TFGSFLWDVESSVDSRYHFV  111
             VLEAV   FGSF WD ES V+S+YH +
Sbjct  226  PVLEAVAFAFGSFPWDAESDVESKYHVL  253



>emb|CBI33818.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG R     ++ VQI+K+++G++YAAS+MYGYFLKRVD+R+QL
Sbjct  194  IHSPEAFEMIQSHLSLVLGERLVGPLDTIVQISKIKLGKLYAASIMYGYFLKRVDERYQL  253

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
            E+ MK LP+G ++     +  G  +      S    P       G + S   G+     R
Sbjct  254  ERTMKTLPEGFNENRLSFEDPGPANRLWDPDSLIRIPADDDDDGGMLDSVEGGS----YR  309

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFG+P++ ++  G++D+S DE++ I+
Sbjct  310  LRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGKPDVRVSEDGSLDTSNDEVVSIT  369

Query  206  FSSLRRLVLEA  174
            FS L  LVLEA
Sbjct  370  FSGLTMLVLEA  380



>gb|ABR16101.1| unknown [Picea sitchensis]
Length=420

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 137/215 (64%), Gaps = 8/215 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HSPE  EMI+ H+S ILG R   N     +  +I++L +G+VYAA++MYGYFL+R +QR
Sbjct  201  IHSPEMLEMIREHISRILGRRGKLNIVDNRTITEIDRLTLGRVYAATIMYGYFLRRAEQR  260

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVG--GDssdtslrsspSHPEVVSWPDGGMGSRGF-GT  405
            +QLE N++ +   L   D   + +   G+S   +     S  ++ + P     +     T
Sbjct  261  YQLEMNLETIYSYLSDADDVKKYLLHLGESKFFTRTKCLSGKDLDAIPVADPSTSSLVET  320

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
              +P +LR Y+MSFD E+LQR A +R+KE++N++EKH EALFGRP I I   GT   + D
Sbjct  321  RTRPRQLRDYIMSFDAESLQRCAMMRTKESVNMVEKHAEALFGRPVIHIAADGTTTFAHD  380

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            + +++++SSL+RL+LEAV FGS LWDVE  V S Y
Sbjct  381  DALRLTYSSLKRLLLEAVAFGSLLWDVEGYVGSIY  415



>ref|XP_002965311.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
 gb|EFJ34149.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
Length=333

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 140/216 (65%), Gaps = 9/216 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRS----NANSSVQINKLRVGQVYAASVMYGYFLKRVDQRF  573
            +HS E  E++++HL +ILG  S       + VQ +K+++G +YAA+V++GYFL+R+DQR+
Sbjct  120  IHSAEVLEVVRDHLGMILGRPSPHYQEPYTLVQASKMKIGHLYAATVVFGYFLRRLDQRY  179

Query  572  QLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM--  399
            QL+ +MK   + L  +    ++ G  +++ +           S   GG+G  G   ++  
Sbjct  180  QLDLSMK---KALSSDKHEDEEQGKLAAEANAAVQAMQAAKSSTTRGGLGGSGVFPQLGW  236

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KPS+L++YVMS D E+LQR+AT+R KE+++++E+ T+ALFG+PE  I P G++     + 
Sbjct  237  KPSKLKSYVMSLDPESLQRFATLRCKESLDVVERQTQALFGKPEAEIAPDGSVVLLAGDS  296

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
              IS S LRRLV EAV FGSFLWD E+ VDS Y+ V
Sbjct  297  FTISLSGLRRLVTEAVVFGSFLWDAEAHVDSHYNLV  332



>ref|XP_002977160.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
 gb|EFJ21769.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
Length=333

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 140/216 (65%), Gaps = 9/216 (4%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRS----NANSSVQINKLRVGQVYAASVMYGYFLKRVDQRF  573
            +HS E  E++++HL +ILG  S       + VQ +K+++G +YAA+V++GYFL+R+DQR+
Sbjct  120  IHSAEVLEVVRDHLGMILGRPSPHYQEPYTLVQASKMKIGHLYAATVVFGYFLRRLDQRY  179

Query  572  QLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM--  399
            QL+ +MK   + L  +    ++ G  +++ +           S   GG+G  G   ++  
Sbjct  180  QLDLSMK---KALSSDKHEDEEQGKLAAEANAAVQAMQAAKSSTTRGGLGGSGVFPQLGW  236

Query  398  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
            KPS+L++YVMS D E+LQR+AT+R KE+++++E+ T+ALFG+PE  I P G++     + 
Sbjct  237  KPSKLKSYVMSLDPESLQRFATLRCKESLDVVERQTQALFGKPEAEIAPDGSVVLLAGDS  296

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
              IS S LRRLV EAV FGSFLWD E+ VDS Y+ V
Sbjct  297  FTISLSGLRRLVTEAVVFGSFLWDAEAHVDSHYNLV  332



>gb|KDO57188.1| hypothetical protein CISIN_1g036217mg [Citrus sinensis]
Length=196

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 131/212 (62%), Gaps = 47/212 (22%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA+EMIQ+HLSL+LG R     ++ +QI+K+++G++YAAS+MY       D   ++
Sbjct  28   VHSPEAFEMIQSHLSLVLGERLVGPLDTIIQISKIKLGKLYAASIMY-------DSLIRI  80

Query  566  EKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSR  387
              N           D G   VG                  S+ DGG G        K  R
Sbjct  81   PPN-----------DDG--TVGE-----------------SFMDGGEG--------KSYR  102

Query  386  LRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKIS  207
            LR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP+I +   G+ID+SKDE+I ++
Sbjct  103  LRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDIRVLEDGSIDTSKDEVISVT  162

Query  206  FSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            F  L  LVLEAV FGSF+WD ES V+S+Y F+
Sbjct  163  FLGLTMLVLEAVAFGSFMWDSESYVESKYPFI  194



>ref|XP_007036963.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY21464.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=360

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 106/137 (77%), Gaps = 7/137 (5%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  564
            LHSPEAYEMIQNHL+LILGNR   ++SV QI+KLRVGQVYAASVMYGYFLKRVDQRFQLE
Sbjct  225  LHSPEAYEMIQNHLALILGNRLGDSTSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLE  284

Query  563  KNMKVLPQGLDKEDSGIQQ-VGGDssdt----slrsspSHPEVVSWPDGGMGSRGFGTEM  399
            K MK+LP   + E+SG++Q VG D        S ++  SHPEV SW  GG+   GFG  +
Sbjct  285  KTMKILPNASNGEESGVEQSVGEDMGTAGLGDSYKAVSSHPEVSSW-SGGISPGGFGHGI  343

Query  398  KPSRLRTYVMSFDGETL  348
            KP RLRTYVMSFDGETL
Sbjct  344  KPCRLRTYVMSFDGETL  360



>emb|CAN66177.1| hypothetical protein VITISV_005141 [Vitis vinifera]
Length=89

 Score =   162 bits (411),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -2

Query  371  MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  192
            MSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTIDSSKDELIKISF  L+
Sbjct  1    MSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIIITPQGTIDSSKDELIKISFGGLK  60

Query  191  RLVLEAVTFGSFLWDVESSVDSRYHFV  111
            RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  61   RLVLEAVTFGSFLWDVESFVDSRYHFV  87



>dbj|BAD94862.1| hypothetical protein [Arabidopsis thaliana]
Length=89

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  371  MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  192
            MSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKISF  ++
Sbjct  1    MSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKISFGGMK  60

Query  191  RLVLEAVTFGSFLWDVESSVDSRYHFV  111
            RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  61   RLVLEAVTFGSFLWDVESHVDARYHFV  87



>gb|AFK47814.1| unknown [Lotus japonicus]
Length=90

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  374  VMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSL  195
            +MSFDGETLQRYATIRSKE+++IIEKHTEALFGRP+  ITP+G I+SSKDE+IKISF  L
Sbjct  1    MMSFDGETLQRYATIRSKESVSIIEKHTEALFGRPDAVITPEGKINSSKDEIIKISFGGL  60

Query  194  RRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  61   KRLVLEAVTFGSFLWDVESYVDSRYHFV  88



>ref|XP_006437251.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
 gb|ESR50491.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
Length=281

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 124/228 (54%), Gaps = 45/228 (20%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  73   IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  132

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG------------  432
            + LE+ +    Q L        Q                PE  +W  G            
Sbjct  133  YYLEECLASAHQDLHLTHRNSLQF---------------PE--AWSYGLKQNQVVGCVNN  175

Query  431  ----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEI  264
                 +G    G E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  + 
Sbjct  176  TQSISLGRGTNGHELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT  235

Query  263  SITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                 G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  236  -----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  276



>gb|KDO46606.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46607.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46608.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46609.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46610.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=250

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 123/216 (57%), Gaps = 21/216 (10%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  42   IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  101

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSRGFG  408
            + LE+ +    Q L        Q        +        +VV   +      +G    G
Sbjct  102  YYLEECLASAHQDLHLTHRNSLQFP-----EAWSYGLKQNQVVGCVNNTQSISLGRGTNG  156

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D+  
Sbjct  157  HELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQ-----TGLLDT--  209

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  210  DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  245



>gb|KDO46604.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46605.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=281

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 123/228 (54%), Gaps = 45/228 (20%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  73   IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  132

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG------------  432
            + LE+ +    Q L        Q                PE  +W  G            
Sbjct  133  YYLEECLASAHQDLHLTHRNSLQF---------------PE--AWSYGLKQNQVVGCVNN  175

Query  431  ----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEI  264
                 +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  + 
Sbjct  176  TQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT  235

Query  263  SITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                 G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  236  -----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  276



>gb|KDO46603.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=276

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 123/216 (57%), Gaps = 21/216 (10%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  68   IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  127

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSRGFG  408
            + LE+ +    Q L        Q        +        +VV   +      +G    G
Sbjct  128  YYLEECLASAHQDLHLTHRNSLQFP-----EAWSYGLKQNQVVGCVNNTQSISLGRGTNG  182

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D+  
Sbjct  183  HELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQ-----TGLLDT--  235

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  236  DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  271



>gb|KDO46602.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=281

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 123/216 (57%), Gaps = 21/216 (10%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  73   IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  132

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSRGFG  408
            + LE+ +    Q L        Q        +        +VV   +      +G    G
Sbjct  133  YYLEECLASAHQDLHLTHRNSLQFP-----EAWSYGLKQNQVVGCVNNTQSISLGRGTNG  187

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D+  
Sbjct  188  HELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLDT--  240

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  241  DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  276



>ref|XP_007049654.1| F21O3.2 protein [Theobroma cacao]
 gb|EOX93811.1| F21O3.2 protein [Theobroma cacao]
Length=403

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 125/231 (54%), Gaps = 53/231 (23%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ H+S ++G R+N++     ++ +I +L++G+VYAAS++YGYFLK    R
Sbjct  197  IHSIEVLEMVREHVSTVIGLRANSSVTDNWATTEIQRLQLGRVYAASILYGYFLKSASSR  256

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD---GGMGSRGFG-  408
            + LEK + +  Q    + + +Q                      +PD    G  S  FG 
Sbjct  257  YHLEKCLALAHQDRLSQRNSLQ----------------------FPDLLPCGFKSLVFGH  294

Query  407  ---------------TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  273
                            E     LR YVM FD ETLQR A ++SKEA+N+IEKH+ ALFG 
Sbjct  295  VRDMQSVSLGQGPGRQEKNLEELRCYVMGFDPETLQRCAKVKSKEAVNLIEKHSCALFGD  354

Query  272  PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
             +  +   G       E+I  SFSSL+RLVLEAV FGSFLWD+E  VD+ Y
Sbjct  355  EKTGVLETG-------EVILTSFSSLKRLVLEAVAFGSFLWDIEEYVDTVY  398



>ref|XP_006437252.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
 gb|ESR50492.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
Length=390

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 124/216 (57%), Gaps = 21/216 (10%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  182  IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  241

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSRGFG  408
            + LE+ +    Q L        Q        +        +VV   +      +G    G
Sbjct  242  YYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVNNTQSISLGRGTNG  296

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D+  
Sbjct  297  HELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLDT--  349

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  350  DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>gb|KJB42555.1| hypothetical protein B456_007G157400 [Gossypium raimondii]
Length=398

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 129/213 (61%), Gaps = 17/213 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  E++++H+S ++G R++++     ++ +I +L +G++YAAS++YGYFLK    R
Sbjct  192  IHSIEVLEVVRDHISAVIGLRADSSVTDNWATTEIQQLHLGRLYAASILYGYFLKSASSR  251

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
             QLE+ + ++ Q      + +Q +                +V S P G    +G G + K
Sbjct  252  HQLERCLTLVHQKRLNHRNSLQFLDLLPCGIKSLVLGRFSDVQSVPLG----QGPGRQEK  307

Query  395  P-SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
                LR YVM FD ETLQR A  RSKEA ++IE+H+ ALFG  +  I PQ       DE+
Sbjct  308  DLEELRCYVMGFDPETLQRCAKPRSKEAAHLIERHSCALFGDEQTGI-PQ------TDEV  360

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            I+ SFSSL+RLVLEAV FGSFLWD+E  VD+ Y
Sbjct  361  IRTSFSSLKRLVLEAVAFGSFLWDIEEYVDTVY  393



>ref|XP_002531072.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31286.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 123/210 (59%), Gaps = 14/210 (7%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EMI+ H+  ++G R+N++     ++ +I +L++G+VYAASV+YGYFLK    R
Sbjct  201  IHSFEVLEMIKEHVCTVIGLRANSSVTDSWATTEIQRLQLGRVYAASVLYGYFLKSASLR  260

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
              LE+ + V    +      ++Q     S            + +   G  G      + +
Sbjct  261  HYLEQCIAVSHHNVHLSCRTVRQYPESISHGLTNIVFR--RISNMQSGSAGQGSIKQDWQ  318

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              +LR YVM FD ETLQR A ++SKEA+N+IEKH+ ALFG         G++++  DE+I
Sbjct  319  RGKLRCYVMGFDAETLQRCAKLKSKEAMNLIEKHSSALFGNDNT-----GSLEN--DEVI  371

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDS  126
              SFSSL+RLVLEAV FGSFLWD E  V+S
Sbjct  372  LTSFSSLKRLVLEAVAFGSFLWDTEEYVNS  401



>ref|XP_006484801.1| PREDICTED: uncharacterized protein LOC102613099 [Citrus sinensis]
Length=390

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 124/216 (57%), Gaps = 21/216 (10%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  182  IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  241

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSRGFG  408
            + LE+ +    Q L        Q        +        +VV   +      +G    G
Sbjct  242  YYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVNNMQSISLGRGTNG  296

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D+  
Sbjct  297  HELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLDT--  349

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  350  DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>gb|KDO46601.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=390

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 123/216 (57%), Gaps = 21/216 (10%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  182  IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  241

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSRGFG  408
            + LE+ +    Q L        Q        +        +VV   +      +G    G
Sbjct  242  YYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVNNTQSISLGRGTNG  296

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D+  
Sbjct  297  HELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLDT--  349

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  350  DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>gb|KDO46600.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=404

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 123/216 (57%), Gaps = 21/216 (10%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY AS++YGYFLK    R
Sbjct  196  IHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVYVASILYGYFLKSASLR  255

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG----GMGSRGFG  408
            + LE+ +    Q L        Q        +        +VV   +      +G    G
Sbjct  256  YYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVGCVNNTQSISLGRGTNG  310

Query  407  TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG  +      G +D+  
Sbjct  311  HELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFGDGQT-----GLLDT--  363

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  364  DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  399



>gb|KHG02769.1| Phosphoserine aminotransferase [Gossypium arboreum]
Length=403

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 127/213 (60%), Gaps = 17/213 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  E++++H+S ++G R++++     ++ +I +L +G++YAAS++YGYFLK    R
Sbjct  197  IHSIEVLEVVRDHISAVIGLRADSSVTDNWATTEIQQLHLGRLYAASILYGYFLKSASSR  256

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
             QLE+ + ++ Q      + +Q +                +V S P G    +G G + K
Sbjct  257  HQLERCLTLVHQKRLNHRNSLQFLDLLPCGIKSLVLGRFSDVQSVPLG----QGPGRQEK  312

Query  395  P-SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  219
                LR YVM FD ETLQR A  RSKEA ++IE+H+ ALFG  +  I          DE+
Sbjct  313  DLEELRCYVMGFDPETLQRCAKPRSKEAAHLIERHSCALFGDEQTGIP-------ETDEV  365

Query  218  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            I+ SFSSL+RLVLEAV FGSFLWD+E  VD+ Y
Sbjct  366  IRTSFSSLKRLVLEAVAFGSFLWDIEEYVDTVY  398



>ref|XP_010069618.1| PREDICTED: uncharacterized protein LOC104456510 [Eucalyptus grandis]
 gb|KCW58026.1| hypothetical protein EUGRSUZ_H00754 [Eucalyptus grandis]
Length=389

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 125/228 (55%), Gaps = 48/228 (21%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  +  EMI+ H++ ++G R +++     ++  I +L++GQ+YAASV+YGYFLK    R
Sbjct  184  IHGIDVLEMIKEHVAAVIGLRVDSSVTDNWATTHIQRLQLGQLYAASVLYGYFLKSASLR  243

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDG------------  432
              LE ++ + PQG                      +  HP  + WP G            
Sbjct  244  HHLECSLALSPQG----------------HRVFHRNSLHPPKI-WPHGWNNLVCGRVSND  286

Query  431  ----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEI  264
                G  S   G   K   LR YVM FD ETLQR A +RS+EA+++IEKH+ ALFG  ++
Sbjct  287  KLSLGQASIQDGNHGK---LRCYVMGFDPETLQRCAKVRSREAMDLIEKHSCALFGDGKM  343

Query  263  SITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                 G I S  D++I  SFSSL+RLVLEA+ FGSFLWDVE  VD+ Y
Sbjct  344  -----GLITS--DDVILTSFSSLKRLVLEAIAFGSFLWDVEEHVDTVY  384



>ref|XP_006368347.1| hypothetical protein POPTR_0001s01860g [Populus trichocarpa]
 gb|ERP64916.1| hypothetical protein POPTR_0001s01860g [Populus trichocarpa]
Length=219

 Score =   139 bits (349),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 117/213 (55%), Gaps = 53/213 (25%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQ  570
            R +  +  EMIQ+HLS++LG R      + V+I+K                         
Sbjct  56   RPNQEQKLEMIQSHLSIVLGERLVCPLETIVEISK-------------------------  90

Query  569  LEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
              +N    P+ L      I+ V GDS                +PDGG    G   E K  
Sbjct  91   --RNRLWRPESL------IRIVPGDS---------------GYPDGGFTDTG---EEKSY  124

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR+YVM  D ETLQRYATIRSKEAI++ EK T+ALFGRP+ISI   G+I+++ DE++ I
Sbjct  125  RLRSYVMYLDVETLQRYATIRSKEAISLNEKQTQALFGRPDISIAKNGSIETANDEVVSI  184

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +FS L   VLEAV FGSFLWD ES V+S+YHF+
Sbjct  185  TFSGLTMPVLEAVAFGSFLWDAESYVESKYHFL  217



>ref|XP_007209264.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
 gb|EMJ10463.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
Length=369

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 118/213 (55%), Gaps = 47/213 (22%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            +HSPEA EMIQ+HLSL+LG R     ++ V+I+K+++G++YAAS+MYGYFLKRVDQRFQL
Sbjct  199  VHSPEALEMIQSHLSLVLGERLVGPLSAIVEISKIKLGKLYAASIMYGYFLKRVDQRFQL  258

Query  566  EKNMKVLPQGLDKEDSGIQQVGG-DssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS  390
            E+ M  LP G   + +   Q+   DS         S  +  S+ + G        + K  
Sbjct  259  ERTMNTLPDGFTPDAAPANQLWDPDSLIRIPPDGGSDSDGGSYMNNG--------DDKSY  310

Query  389  RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKI  210
            RLR+YVM                                    IT  G+ID+S DE+I +
Sbjct  311  RLRSYVM------------------------------------ITEDGSIDASNDEVIAL  334

Query  209  SFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +FS L  LVLEAV FGSFLWD E+ ++S YHF+
Sbjct  335  TFSGLTMLVLEAVAFGSFLWDAETYIESNYHFL  367



>gb|KDP45280.1| hypothetical protein JCGZ_15145 [Jatropha curcas]
Length=400

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (58%), Gaps = 18/212 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EMI+ H+S ++G R+N++     ++ +I +L++G++Y AS++YGYFLK    R
Sbjct  197  IHSFEVLEMIREHVSTVIGLRANSSVTDTWATTEIQRLQLGRLYVASILYGYFLKSASLR  256

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
              LE  + V    +        Q+   S          H  V S      G +    + K
Sbjct  257  HYLELCLAVPHHDVHLSRRTSLQLPESSPYRISNLVFGHQSVSS------GQKSRKQDQK  310

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
               LR YVM FD ETLQR A ++SKEA+N+IEKH+ ALFG  +      G +++  DE+I
Sbjct  311  RGNLRCYVMGFDAETLQRCAKLKSKEAVNLIEKHSCALFGDDK-----AGLLEN--DEVI  363

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
              SFSSL+RL+LEAV FGSFLWD E  V+S +
Sbjct  364  LTSFSSLKRLILEAVAFGSFLWDTEEYVNSVF  395



>ref|XP_002272171.1| PREDICTED: uncharacterized protein LOC100251038 [Vitis vinifera]
Length=380

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 124/219 (57%), Gaps = 20/219 (9%)
 Frame = -2

Query  752  AAARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKR  588
            A   +H+ E  EMI+ HL+ +LG +  +N     ++ QI + ++GQ+YAAS++YGYFLK 
Sbjct  173  ALECIHNFEVLEMIKEHLTTVLGWKPKSNVTENWATTQIRRFQLGQIYAASILYGYFLKS  232

Query  587  VDQRFQLEKNMKVLPQGLDKED-SGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGF  411
               R  LE ++      L   + SG    G       L+     P   S P     +   
Sbjct  233  ASLRHHLEMSLVHSHHDLPSSNVSGFWSYG-------LKDLFLGPNCSSQPTSLGEASSR  285

Query  410  GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSS  231
              E +  +LR YVM FD +TLQR A ++SKEA+N++EKH+ ALFG  +      G +++ 
Sbjct  286  QEEKEEKKLRCYVMGFDPDTLQRCAKLKSKEAVNLVEKHSCALFGDEKT-----GLLET-  339

Query  230  KDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
             D++I  SFSS++RLVLEAV FGSFLWD E  V S Y+ 
Sbjct  340  -DDVISTSFSSMKRLVLEAVAFGSFLWDTEEYVGSVYNL  377



>ref|XP_006432689.1| hypothetical protein CICLE_v10003247mg [Citrus clementina]
 gb|ESR45929.1| hypothetical protein CICLE_v10003247mg [Citrus clementina]
Length=129

 Score =   132 bits (333),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = -2

Query  437  DGGMGSRGF-GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEIS  261
            DG +G     G E K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP++ 
Sbjct  18   DGTVGESFMDGGEGKSYRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDVR  77

Query  260  ITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  111
            +   G+ID+SKDE+I ++F  L  LVLEAV FGSF+WD ES V+S+Y F+
Sbjct  78   VLEDGSIDTSKDEVISVTFLGLTMLVLEAVAFGSFMWDSESYVESKYPFI  127



>ref|XP_010274079.1| PREDICTED: uncharacterized protein LOC104609452 [Nelumbo nucifera]
Length=414

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 129/218 (59%), Gaps = 25/218 (11%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ H+  I+G R  +      S+ QI+KL++G+VYAASVMYGYFLK    +
Sbjct  206  IHSLEVVEMVKEHVGTIIGWRGKSRLTDNWSTTQIHKLQLGRVYAASVMYGYFLKSASLK  265

Query  575  FQLEKNMKV------LPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRG  414
             +LE ++ +      L  G+    + +Q  G ++     RS+ +    +     G G R 
Sbjct  266  HRLELSLALTHQDLPLGHGIRIPVTELQLHGLENLVVLGRSTETRSTSLC---QGTGRRV  322

Query  413  FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  234
             G +    +LR+YVM FD ETLQR A ++S+EA N+IEKH+ ALFG          T   
Sbjct  323  DGHK----KLRSYVMGFDSETLQRCAKLKSQEAANLIEKHSWALFG-------DGNTSSL  371

Query  233  SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
              D+++ ++FSSL+RLVLEA+ FGSFLWDVE+ VD  Y
Sbjct  372  ENDKVLVVTFSSLKRLVLEAIAFGSFLWDVETYVDRVY  409



>ref|XP_002303068.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
 gb|EEE82341.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
Length=407

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 127/228 (56%), Gaps = 45/228 (20%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ H+S ++G ++N++     ++ ++ + R+G+VYAAS++YGYFLK    R
Sbjct  199  IHSFEVLEMVREHVSTVIGLKANSSVADSWATTEVQRCRLGRVYAASILYGYFLKSASLR  258

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG----  408
              LE  + VLP     +D  +            RS+   PE  S P  G+ +  FG    
Sbjct  259  HHLEWCL-VLPH----QDIHLGH----------RSTLQFPE--SLPSYGLTNLVFGHISN  301

Query  407  ------------TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEI  264
                         + +  +L+ Y+M FD ETLQR A ++SKEA+N+IEKH+ ALFG  + 
Sbjct  302  KQSTSQGTRLNRPKSEHEKLKCYMMGFDSETLQRCAKLKSKEAVNLIEKHSCALFGDEKT  361

Query  263  SITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
             +          DE+I  SFSSL+RLVLEAV FG FLWD E  V+S Y
Sbjct  362  GVL-------ENDEVILTSFSSLKRLVLEAVAFGCFLWDTEEDVNSVY  402



>ref|XP_010247844.1| PREDICTED: uncharacterized protein LOC104590798 [Nelumbo nucifera]
Length=415

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 128/218 (59%), Gaps = 25/218 (11%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ H+  I+G R   N     ++ QI+KL++G+VYAAS++YGYFLK    R
Sbjct  207  IHSDELLEMVREHVRTIIGWRGRFNMTDNWTTTQIHKLQLGRVYAASILYGYFLKSAYLR  266

Query  575  FQLEKNMKV----LP--QGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRG  414
             +LE ++ +    LP  +G+    + +Q  G +      RS     E +S     +  R 
Sbjct  267  HRLELSLSLTHLDLPIGRGIRIPVTELQLHGSEDHVLFGRS----AETIS---TSLYQRL  319

Query  413  FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  234
                 +   L++YVM FD ETLQR A ++S+EA+N+IEKH+ ALFG          T   
Sbjct  320  GRHVDRHENLKSYVMKFDPETLQRCARLKSREAVNLIEKHSWALFG-------DGNTSSL  372

Query  233  SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
             KDE+I ++FSSL+RLVLEAV FGSFLWD E  VDS Y
Sbjct  373  EKDEVIVVTFSSLKRLVLEAVAFGSFLWDAERFVDSVY  410



>ref|XP_006367000.1| PREDICTED: uncharacterized protein LOC102582294 [Solanum tuberosum]
Length=390

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 121/224 (54%), Gaps = 38/224 (17%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ HL+ +LG +  +N     +  ++ K ++ QVYAASV+YGYFLK    R
Sbjct  183  IHSCEVLEMVREHLTTVLGWKEKSNVADNWTPTEVQKFKLCQVYAASVLYGYFLKSASLR  242

Query  575  FQLEKNMKVLPQGLDKED------SGIQQVGGDssdtslrsspSHPEVVSW-PDGGMGSR  417
              LEK +  +   LD         S I+ +G               E+V +   GG  S 
Sbjct  243  HHLEKKLDHINPYLDIASYNQLLLSEIRSLGS--------------EIVPFGCIGGTRST  288

Query  416  GFGT-----EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITP  252
              G      E K  +L+ YVMSFD ETLQ +A  +SKEA+N+IEKH+ ALFG  +  +  
Sbjct  289  SVGQIPLLREKKQDKLKYYVMSFDPETLQMWAKPKSKEALNLIEKHSYALFGDKKTGLV-  347

Query  251  QGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                  + DE+I  S +SL+R+VLEA+ FGSFLWD E  V   Y
Sbjct  348  ------ASDEVILTSLASLKRIVLEAIAFGSFLWDAEEYVRIVY  385



>ref|XP_011024597.1| PREDICTED: uncharacterized protein LOC105125729 [Populus euphratica]
Length=404

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 86/228 (38%), Positives = 130/228 (57%), Gaps = 45/228 (20%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ H+S ++G ++N++     ++ ++ + R+G+VYAAS++YGYFLK    R
Sbjct  196  IHSFEVLEMVREHVSTVIGLKANSSVADSWATTEVQRCRLGRVYAASILYGYFLKSASLR  255

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFG----  408
              LE  + VLP     +D  +            R++   PE  S P  G+ +  FG    
Sbjct  256  HHLEWCL-VLPH----QDIHLGH----------RTTLQFPE--SLPSYGLTNLVFGHISN  298

Query  407  ------------TEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEI  264
                         + +  +L+ Y+M FD ETL+R A ++SKEA+N+IEKH+ ALFG  + 
Sbjct  299  KQSTSQETRLNRPKSEHEKLKCYLMGFDSETLKRCAKLKSKEAVNLIEKHSCALFGDEK-  357

Query  263  SITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                 G +++  DE+I  SFSSL+RLVLEAV FG FLWD E  V+S Y
Sbjct  358  ----TGVLEN--DEVILTSFSSLKRLVLEAVAFGCFLWDTEEYVNSVY  399



>ref|XP_010908555.1| PREDICTED: uncharacterized protein LOC105034920 isoform X2 [Elaeis 
guineensis]
Length=351

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 115/212 (54%), Gaps = 17/212 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H PE  EM++ HLS IL  R   N     S + I ++++G++YAAS+MYGYF+K V  R
Sbjct  147  IHDPEILEMVREHLSNILKWRGKVNLIENSSMIHIKRVQLGRIYAASIMYGYFIKSVSLR  206

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
             QLE     L      ED  + Q+         +         S+         +    +
Sbjct  207  HQLE-----LSLARTDEDLPLGQLMNSELFKKEQEENLVALGCSFDMASSLHPSYDRRRR  261

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              +LR+Y+M FD ETLQ  A +RS+EA+N+IEKH+ ALF   E S         + D  I
Sbjct  262  VEKLRSYMMGFDSETLQICAKLRSQEAVNLIEKHSYALFEDREKST-------QTNDGNI  314

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
             +++S+ +RLVLEAV FGSFLWDVE  VDS Y
Sbjct  315  IVTYSAFKRLVLEAVAFGSFLWDVERYVDSIY  346



>ref|XP_010908554.1| PREDICTED: uncharacterized protein LOC105034920 isoform X1 [Elaeis 
guineensis]
Length=408

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 115/212 (54%), Gaps = 17/212 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H PE  EM++ HLS IL  R   N     S + I ++++G++YAAS+MYGYF+K V  R
Sbjct  204  IHDPEILEMVREHLSNILKWRGKVNLIENSSMIHIKRVQLGRIYAASIMYGYFIKSVSLR  263

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
             QLE     L      ED  + Q+         +         S+         +    +
Sbjct  264  HQLE-----LSLARTDEDLPLGQLMNSELFKKEQEENLVALGCSFDMASSLHPSYDRRRR  318

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              +LR+Y+M FD ETLQ  A +RS+EA+N+IEKH+ ALF   E S         + D  I
Sbjct  319  VEKLRSYMMGFDSETLQICAKLRSQEAVNLIEKHSYALFEDREKST-------QTNDGNI  371

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
             +++S+ +RLVLEAV FGSFLWDVE  VDS Y
Sbjct  372  IVTYSAFKRLVLEAVAFGSFLWDVERYVDSIY  403



>ref|XP_004247039.1| PREDICTED: uncharacterized protein LOC101262953 [Solanum lycopersicum]
Length=390

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 121/226 (54%), Gaps = 42/226 (19%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ HL+ +LG +  +N     +  ++ K ++ QVY ASV+YGYFLK    R
Sbjct  183  IHSCEVLEMVREHLTSVLGWKEKSNVADNWTPTEVQKFKLCQVYVASVLYGYFLKSASLR  242

Query  575  FQLEKNMKVLPQGLDKED------SGIQQVGGDssdtslrsspSHPEVVSWPDGGMG-SR  417
              LEK +  +   LD         S IQ +G               E+V  P G +G +R
Sbjct  243  HHLEKKLDHINPYLDLASYKQLLLSTIQSLGS--------------EIV--PFGCIGGTR  286

Query  416  GFGT-------EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISI  258
                       E K  +L+ YVM+FD E LQ  A  +SKEA+N+IEKH+ ALFG      
Sbjct  287  STSVSQIPLLREKKQDKLKYYVMNFDPEMLQMCAKPKSKEALNLIEKHSYALFG------  340

Query  257  TPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
              + T+  + D++I  S +SL+R+VLEA+ FGSFLWD E  V + Y
Sbjct  341  -DKNTVLVASDDVILTSLASLKRIVLEAIAFGSFLWDAEEYVRTVY  385



>ref|XP_004290164.1| PREDICTED: uncharacterized protein LOC101305809 [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 125/222 (56%), Gaps = 37/222 (17%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            ++S E  EMI+ H++ ++G R+N++     +  +I +  +G+VY AS++YGYFLK V  R
Sbjct  175  IYSLEVLEMIREHVTTVIGLRANSSVTDNWAMTKITRQTLGRVYVASILYGYFLKSVSLR  234

Query  575  FQLEKNMKVLPQGLD-KEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT--  405
             +LE+++ +  Q L     + +Q++      +          ++    G + S   G+  
Sbjct  235  HRLERSLFLESQDLHLSCRTSLQEMSPHGIKS----------LIFGHVGKIQSECVGSNR  284

Query  404  -EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG------RPEISITPQG  246
             E    +L+ YVM FD ETLQR A +RS+E++++I+ H  ALFG       PEI      
Sbjct  285  LEKTHGKLKCYVMGFDPETLQRCAKLRSEESVDLIKNHCCALFGDDAEMGSPEI------  338

Query  245  TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                  DE+I  SFSSL+RLVLEAV FGSFLWD E  +DS Y
Sbjct  339  ------DEVISTSFSSLKRLVLEAVAFGSFLWDTEECIDSVY  374



>ref|XP_009763079.1| PREDICTED: uncharacterized protein LOC104215037 [Nicotiana sylvestris]
Length=392

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 116/220 (53%), Gaps = 26/220 (12%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ HL+ +LG +  +N     +  ++ KL++ +VYAASV++GYFLK    R
Sbjct  185  IHSCEVLEMVREHLTTVLGWKEKSNVTDNWAPTKVRKLQLCRVYAASVLFGYFLKSASLR  244

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD-GGMGSRGFGT--  405
              LE+ +  + + L         + G S            E V +    G  S   G   
Sbjct  245  HHLEQKVDHINRDLG--------IAGSSQLLLSELRSLGSETVPFSHISGTRSTSVGRIP  296

Query  404  ---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  234
               E K  +L+ YVMSFD ETLQ  A  +SKEA+N+IEKH  ALFG  +  +   G    
Sbjct  297  LVREKKQEKLKYYVMSFDAETLQMCAKPKSKEALNLIEKHIYALFGDEKTGLIASG----  352

Query  233  SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
               E+I  S +SL+R+VLEA+ FGSFLWD E  + + Y  
Sbjct  353  ---EVISTSLASLKRIVLEAIAFGSFLWDAEEYIRTVYQL  389



>ref|XP_010100787.1| hypothetical protein L484_015816 [Morus notabilis]
 gb|EXB84485.1| hypothetical protein L484_015816 [Morus notabilis]
Length=363

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 125/220 (57%), Gaps = 35/220 (16%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQR  576
            ++S E  E+++ H++ ++G R+N++ +       I K  + ++Y AS++YGYFLK    R
Sbjct  161  IYSFEVLEIVREHIAAVIGLRANSSITDHWAITTIAKSALSRIYIASILYGYFLKSALLR  220

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS--------  420
             QLE+ +      LD +D  ++Q          R++  H  + +   G +GS        
Sbjct  221  LQLEQCV-----ALDSQDLPLRQ----------RTTVQHHGIKNLLFGRIGSIQSESQSL  265

Query  419  RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  240
                 E KP  L+ YVM FD ETLQR A ++SKEA ++IE H+ ALFG  +      G++
Sbjct  266  DPSSQEKKPENLKCYVMGFDPETLQRCAKLKSKEATSLIENHSSALFGDEK-----TGSL  320

Query  239  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            D   DE+I  SFSSL+RLVLEAV FGSFLW+ E  V++ Y
Sbjct  321  DD--DEVILTSFSSLKRLVLEAVAFGSFLWETEECVNTVY  358



>gb|KFK38188.1| hypothetical protein AALP_AA3G080700 [Arabis alpina]
Length=374

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 110/220 (50%), Gaps = 59/220 (27%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS EA E+I+ H+S ++G R N+      ++ +I KL +G VYAAS++YGYFLK    R
Sbjct  185  IHSCEALELIKEHVSAVIGLRVNSCVTDNWATTEIQKLHLGNVYAASILYGYFLKSASLR  244

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
             QLE                +  + G                     G + S  FG    
Sbjct  245  HQLE--------------CSLSDIHGS--------------------GYLKSSVFGCSFT  270

Query  395  PS--------RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  240
             S        +LR Y+ +FD ETLQR A  R++EA+N+IEK + ALFG  +         
Sbjct  271  TSNAQISTKQQLRHYISAFDPETLQRCAKPRTEEAMNLIEKQSLALFGTED---------  321

Query  239  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                DE I  SFSSL+RLVLEAV FG+FLWD E  VD  Y
Sbjct  322  ---HDETIVTSFSSLKRLVLEAVAFGTFLWDTELYVDGAY  358



>ref|XP_009587865.1| PREDICTED: uncharacterized protein LOC104085515 [Nicotiana tomentosiformis]
Length=387

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 118/222 (53%), Gaps = 30/222 (14%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ HL+++LG +  +N     +  ++ KL++ +VYAASV++GYFLK    R
Sbjct  180  IHSCEVLEMVREHLTIVLGWKEKSNVTDNWAPTKVQKLQLCRVYAASVLFGYFLKSASLR  239

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGM-GSRGFGT--  405
              LE+ +  + + L         + G S            E V  P G + G+R      
Sbjct  240  HHLEQKVDHINRDLG--------IAGSSQLLLSELRSLGSETV--PFGRISGTRSTSVGR  289

Query  404  -----EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  240
                 E K  +L+ YVMSFD ETLQ  A  +SKEA+N+IEKH  ALFG  +  +   G +
Sbjct  290  IPLVREKKQEKLKYYVMSFDAETLQMCAKPKSKEALNLIEKHIYALFGDEKTGLIASGGV  349

Query  239  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
                   I  S +SL+R+VLEA+ FGSFLWD E  + + Y  
Sbjct  350  -------ISTSLASLKRIVLEAIAFGSFLWDAEEYIRTVYQL  384



>ref|XP_008776305.1| PREDICTED: uncharacterized protein LOC103696450 [Phoenix dactylifera]
Length=408

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 113/212 (53%), Gaps = 17/212 (8%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +H  E  EM++ HLS IL  +   N     S + I ++++G++YAAS+MYGYF+K V  R
Sbjct  204  IHDSEILEMVREHLSNILKWKGKINLMENSSMIHIKRVQLGRIYAASIMYGYFIKSVSLR  263

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
             QLE     L      ED  + Q+         +         S+         +    +
Sbjct  264  HQLE-----LSLARTDEDLPLGQLMNSELFKKEQEENLVALGCSFDMASSLHPSYDRRRR  318

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              +LR+Y+M FD ETLQ  A +RS+EAIN+IEKH+ ALF   + S           D  I
Sbjct  319  VEKLRSYMMGFDSETLQICAKLRSREAINLIEKHSYALFEDRQKST-------QKNDGNI  371

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
             +++S+ +RLVLEAV FGSFLWDVE  VDS Y
Sbjct  372  IVTYSAFKRLVLEAVAFGSFLWDVEKYVDSIY  403



>ref|XP_006848511.1| hypothetical protein AMTR_s00013p00260550 [Amborella trichopoda]
 gb|ERN10092.1| hypothetical protein AMTR_s00013p00260550 [Amborella trichopoda]
Length=424

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 128/220 (58%), Gaps = 24/220 (11%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNA----NSSVQ--INKLRVGQVYAASVMYGYFLKRVDQ  579
            +H  EA  M+++HL+ ILG RS++    NS V   I +L++G++YA+SVMYGYFL+   +
Sbjct  210  IHDWEARIMVKDHLNKILGRRSDSSYTLNSCVMTLIGRLQLGKLYASSVMYGYFLESACR  269

Query  578  RFQLEKNMKV-----LPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRG  414
            R+ LEK++ V     L QG+   DSG   +  ++           P  V+          
Sbjct  270  RYHLEKSLHVRSDHPLFQGITLPDSGCWHLTPETLI---------PLGVTEEQETCCGDT  320

Query  413  FGTEM--KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  240
            + ++   +   L+ Y+  F+ ET QR A +RSKEA+N++EKH+ ALFG        +  +
Sbjct  321  YSSKTIDELDSLKRYITGFNAETFQRCAALRSKEAVNLVEKHSWALFGE--CEEEGEEGM  378

Query  239  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
               +DE++ IS SSL+RLVLEAV FG FL++VE+ VD  Y
Sbjct  379  GEEQDEVLLISISSLKRLVLEAVAFGLFLYNVEAYVDPIY  418



>ref|XP_011089045.1| PREDICTED: uncharacterized protein LOC105170122 [Sesamum indicum]
Length=378

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 119/215 (55%), Gaps = 20/215 (9%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  +M++ HL  ++G RS +N     ++ +I +L++ ++YAAS++YGYFLK    R
Sbjct  171  IHSFEVLQMVREHLRAVVGWRSISNVTASWATTEIQRLKLCKLYAASILYGYFLKSASLR  230

Query  575  FQLEKNMKVLPQGLDKEDSGI---QQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
              LE+ +      L     GI    Q+      +      +   V S     +G   +  
Sbjct  231  HHLERVLD-----LSNSHFGIGARNQLSAPEMFSVGSDYITSGRVGSAKSSSVGRVSYSL  285

Query  404  EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKD  225
              K    R YVM FD ET+Q  A  +SKEA+N+IE+H+ ALFG  E      G +++  +
Sbjct  286  GSKQENFRFYVMGFDAETIQMCAKPKSKEAVNLIERHSSALFGDEE-----TGLVET--N  338

Query  224  ELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
            ++I  SF+SL+R +LEAV FGSFLW+ E+ V++ Y
Sbjct  339  DVITTSFASLKRFLLEAVAFGSFLWEAENCVNAVY  373



>ref|XP_010547130.1| PREDICTED: uncharacterized protein LOC104818981 [Tarenaya hassleriana]
Length=370

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 116/221 (52%), Gaps = 53/221 (24%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS +A E+I+ H+S ++G R N++     ++ QI KL +G+VY AS++YGYFLK    R
Sbjct  172  IHSIDALELIKEHVSAVIGLRVNSSVTDNWATTQIQKLHLGRVYTASILYGYFLKSATLR  231

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT---  405
             QLE ++          D  I Q                P  + +P G +    F T   
Sbjct  232  HQLECSLS---------DLQINQ--------------QRP--IQFPKGPVFGCSFPTSTP  266

Query  404  ------EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  243
                  E+K   LR Y+  F+ ETLQR A  RS+EA N+IEK + ALFG+          
Sbjct  267  QAFENRELK--HLRHYISGFNPETLQRCAKPRSEEARNLIEKQSIALFGQ----------  314

Query  242  IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
                 DE++  SFSSL+RLVLEAV FG+FLWD E  VD  Y
Sbjct  315  --EKGDEVVVTSFSSLKRLVLEAVAFGTFLWDTEEYVDGVY  353



>gb|ABR26180.1| unknown [Oryza sativa Indica Group]
Length=74

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = -2

Query  305  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  126
            +EKHTEALFG+PEI ITP+GT+DSSKDE ++ISF+ LRRL+LEAVTFGSFLWDVES VD+
Sbjct  8    LEKHTEALFGKPEIVITPEGTVDSSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDT  67

Query  125  RYHFVA  108
            RYHFVA
Sbjct  68   RYHFVA  73



>ref|NP_001031154.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32294.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=342

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 90/124 (73%), Gaps = 8/124 (6%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  203  RLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGD-------ssdtslrsspSHPEVVSWPDGGMGSRGFG  408
            EK M++LP G D+ ++ I+Q G D        ++ + ++  S+ +V S+  G   S GF 
Sbjct  263  EKTMRILPGGSDEGETSIEQAGRDVERNFYEEAEETYQAVSSNQDVGSFVGGINASGGFS  322

Query  407  TEMK  396
            ++MK
Sbjct  323  SDMK  326



>ref|XP_006407850.1| hypothetical protein EUTSA_v10020977mg [Eutrema salsugineum]
 gb|ESQ49303.1| hypothetical protein EUTSA_v10020977mg [Eutrema salsugineum]
Length=367

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 106/212 (50%), Gaps = 43/212 (20%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS +A E+I+ H+S ++G R N+      ++ QI KL +G+VY AS+MYGYFLK    R
Sbjct  178  IHSCDALELIKEHVSAVIGLRVNSCVTDNWATTQIQKLHLGKVYVASIMYGYFLKSASLR  237

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
             QLE +        D   SG                     + S   G   + G      
Sbjct  238  HQLECSFS------DLHGSGY--------------------LKSPVFGCSVTTGTAQIST  271

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
              +LR Y+  FD  TLQR A  R++EA N+IEK   ALFG  E             DE I
Sbjct  272  KQKLRHYISGFDPVTLQRCANPRTEEARNLIEKQCLALFGTEE------------SDETI  319

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
              SFSSL+RLVLEAV FG+FLWD E  VD  Y
Sbjct  320  VTSFSSLKRLVLEAVAFGTFLWDTELYVDGAY  351



>dbj|BAH56904.1| AT1G48450 [Arabidopsis thaliana]
Length=321

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  203  RLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGD  495
            EK M++LP G D+ ++ I+Q G D
Sbjct  263  EKTMRILPGGSDEGETSIEQAGRD  286



>ref|NP_001185170.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32295.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=333

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = -2

Query  743  RLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQL  567
            RLHSPE YEMIQNHLS+IL NR++  ++V QI+KL VGQVYAASVMYGYFLKR+DQRFQL
Sbjct  203  RLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVGQVYAASVMYGYFLKRIDQRFQL  262

Query  566  EKNMKVLPQGLDKEDSGIQQVGGD  495
            EK M++LP G D+ ++ I+Q G D
Sbjct  263  EKTMRILPGGSDEGETSIEQAGRD  286



>gb|EYU39191.1| hypothetical protein MIMGU_mgv1a013058mg [Erythranthe guttata]
Length=231

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/212 (35%), Positives = 111/212 (52%), Gaps = 32/212 (15%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  +M++ HLS ++G + NAN +      +I +LR+ ++YAAS++YGYFLK    R
Sbjct  42   IHSFEVLQMVREHLSAVIGCKGNANVTDTWVTTKIQRLRLCRLYAASILYGYFLKSASLR  101

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  396
              LE+ +            G  Q+                E+ S     +G  G   ++ 
Sbjct  102  HFLERILNTSTSNFSIGGQGQSQLPVS-------------EIFSVESNVIGCVG---QIS  145

Query  395  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  216
               L  YVM FD E +Q  A  +S EA+N+IE+H+ ALFG            + + D++I
Sbjct  146  QENLGFYVMGFDQEMIQMCAKPKSIEAMNLIERHSCALFGD-----------EVTTDDVI  194

Query  215  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
              SF+SL+R +LEAV FGSFLW+ E+SV   Y
Sbjct  195  TTSFASLKRFLLEAVDFGSFLWESENSVSDVY  226



>ref|XP_009793974.1| PREDICTED: uncharacterized protein LOC104240787 [Nicotiana sylvestris]
Length=384

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 115/229 (50%), Gaps = 50/229 (22%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQR  576
            +HS E  EM++ HL+ ++G +  +N +      Q+ K ++ +VYAAS++YGYFLK    R
Sbjct  183  IHSFEVLEMVREHLTTVIGWKEKSNVTENWIPTQVPKFQIHRVYAASILYGYFLKSASLR  242

Query  575  FQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWP-----------DGG  429
              +E++++ +   +    SG   V G                 SWP            G 
Sbjct  243  HHMEQSLEHINSDIGVTTSGNLLVSG-----------------SWPLKQNSVPFGRISGT  285

Query  428  MGSRGFGTEM----KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEIS  261
              +    T +    K  +LR+YVM+FD E +Q  A  + KEA+ +IEKH  ALFG     
Sbjct  286  RSTLAGPTSLIQGKKNEKLRSYVMNFDHEIMQMCAKPKCKEALYLIEKHCSALFG-----  340

Query  260  ITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
                   D S DE++  S +SL+R+VLEAV FGSFLWD E  V + Y  
Sbjct  341  -------DES-DEVVSTSLASLKRIVLEAVAFGSFLWDAEDYVRTFYQL  381



>ref|XP_008382586.1| PREDICTED: uncharacterized protein LOC103445364 [Malus domestica]
Length=378

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/219 (36%), Positives = 119/219 (54%), Gaps = 29/219 (13%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYGYFLKRVDQR  576
            L+S +  EMI+ H+S ++G ++N++ +       I +  +GQ Y AS++YGYFLK    R
Sbjct  172  LYSXDVLEMIREHVSTVIGLKANSSVTDNWAVTTITRQTLGQAYVASILYGYFLKSASLR  231

Query  575  FQLEKNMKVLPQGLD---KEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT  405
              L++ + +  Q L    +     Q++  + +   L              G + ++  G 
Sbjct  232  HSLDRILTLESQDLHMSHRTSLPFQEMCPNENKNLLFGRI----------GNIQTKFQGP  281

Query  404  ---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  234
               E    +LR YVM FD  TLQR A +RSK A+N+I+ H  ALFG         G++ S
Sbjct  282  SRQEKTHGKLRCYVMGFDPNTLQRCAKLRSKVAVNLIKNHCCALFGD-------DGSMGS  334

Query  233  SK-DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  120
             + DE+I  S+SSL+RLVLEAV FGSFLWD E  +++ Y
Sbjct  335  PETDEVISTSYSSLKRLVLEAVAFGSFLWDTEECIETIY  373



>ref|XP_009349111.1| PREDICTED: uncharacterized protein LOC103940675 [Pyrus x bretschneideri]
Length=379

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 119/218 (55%), Gaps = 23/218 (11%)
 Frame = -2

Query  740  LHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQR  576
            L+S +  EMI+ H+S ++G R+ ++     +  +I +  +GQ Y AS++YGYFLK    R
Sbjct  173  LYSMDVLEMIREHVSTVIGLRAKSSVTDNWAMTKITRQTLGQAYVASILYGYFLKSALLR  232

Query  575  FQLEKNMKVLPQGLD-KEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT--  405
              L++ + +  Q L     + +Q +              +  ++    G + ++  G+  
Sbjct  233  HSLDRILTLESQDLPLNHRTSLQSL--------EMCPNGNKNLLFGRIGNIQTKFQGSSR  284

Query  404  -EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSK  228
             E    +LR YVM FD +TLQR A +RSK A+N+I+ H  ALFG  E   +P+       
Sbjct  285  QEKTHGKLRCYVMGFDPDTLQRCAKLRSKVAVNLIKNHCCALFGDDESMGSPE------T  338

Query  227  DELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  114
            DE+I  S+SSL+RLVLEAV FGSFLWD E  + + Y  
Sbjct  339  DEVIITSYSSLKRLVLEAVAFGSFLWDTEECIGTVYEL  376



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360