BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029G03

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769968.1|  PREDICTED: uncharacterized protein LOC104220...    114   7e-43   Nicotiana sylvestris
ref|XP_009769969.1|  PREDICTED: uncharacterized protein LOC104220...    114   1e-42   Nicotiana sylvestris
ref|XP_009615933.1|  PREDICTED: uncharacterized protein LOC104108...    109   1e-40   Nicotiana tomentosiformis
ref|XP_009615934.1|  PREDICTED: uncharacterized protein LOC104108...    109   2e-40   Nicotiana tomentosiformis
ref|XP_006360111.1|  PREDICTED: uncharacterized protein LOC102579806  93.2    1e-32   
ref|XP_010324338.1|  PREDICTED: uncharacterized protein LOC101263...  90.9    2e-31   Solanum lycopersicum
ref|XP_004244170.1|  PREDICTED: uncharacterized protein LOC101263...  87.0    6e-31   Solanum lycopersicum
ref|XP_011097947.1|  PREDICTED: uncharacterized protein LOC105176...  82.0    5e-29   Sesamum indicum [beniseed]
gb|EYU33580.1|  hypothetical protein MIMGU_mgv1a010110mg              81.3    7e-26   Erythranthe guttata [common monkey flower]
gb|AFX67022.1|  hypothetical protein                                  73.6    6e-24   Solanum tuberosum [potatoes]
ref|XP_010267849.1|  PREDICTED: uncharacterized protein LOC104604963  71.2    1e-23   Nelumbo nucifera [Indian lotus]
gb|ABK93511.1|  unknown                                               62.8    5e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002316956.1|  hypothetical protein POPTR_0011s13360g           62.8    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006370583.1|  hypothetical protein POPTR_0001s44020g           62.8    3e-18   
ref|XP_010092273.1|  hypothetical protein L484_021134                 66.2    6e-18   
ref|XP_010062936.1|  PREDICTED: uncharacterized protein LOC104450...  65.9    1e-17   Eucalyptus grandis [rose gum]
gb|KCW70086.1|  hypothetical protein EUGRSUZ_F03390                   65.5    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010062934.1|  PREDICTED: uncharacterized protein LOC104450...  65.1    2e-17   Eucalyptus grandis [rose gum]
ref|XP_008789186.1|  PREDICTED: uncharacterized protein LOC103706755  60.1    5e-17   Phoenix dactylifera
ref|XP_010694294.1|  PREDICTED: uncharacterized protein LOC104907109  75.1    3e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385062.1|  PREDICTED: uncharacterized protein LOC103972444  55.8    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011030911.1|  PREDICTED: uncharacterized protein LOC105130...  61.6    3e-14   Populus euphratica
ref|XP_011030912.1|  PREDICTED: uncharacterized protein LOC105130...  61.6    3e-14   Populus euphratica
ref|XP_011097948.1|  PREDICTED: uncharacterized protein LOC105176...  79.7    3e-14   Sesamum indicum [beniseed]
ref|XP_010910123.1|  PREDICTED: uncharacterized protein LOC105036081  55.8    5e-14   Elaeis guineensis
emb|CDP05826.1|  unnamed protein product                              77.0    5e-13   Coffea canephora [robusta coffee]
ref|XP_007021147.1|  Uncharacterized protein TCM_031178               59.3    1e-12   
ref|XP_002530912.1|  conserved hypothetical protein                   70.5    2e-11   
ref|XP_002283181.1|  PREDICTED: uncharacterized protein LOC100265933  68.9    3e-11   Vitis vinifera
gb|KDP39009.1|  hypothetical protein JCGZ_00766                       71.6    3e-11   Jatropha curcas
ref|XP_004151973.1|  PREDICTED: uncharacterized protein LOC101218...  70.9    5e-11   
emb|CBI20469.3|  unnamed protein product                              70.5    6e-11   Vitis vinifera
ref|XP_004151972.1|  PREDICTED: uncharacterized protein LOC101218...  70.9    7e-11   Cucumis sativus [cucumbers]
ref|XP_008454598.1|  PREDICTED: uncharacterized protein LOC103494...  69.3    2e-10   Cucumis melo [Oriental melon]
ref|XP_008454597.1|  PREDICTED: uncharacterized protein LOC103494...  68.9    3e-10   Cucumis melo [Oriental melon]
ref|NP_200265.1|  uncharacterized protein                             68.2    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006452122.1|  hypothetical protein CICLE_v10008955mg           66.2    9e-10   
gb|KHG12371.1|  HEAT repeat-containing 8                              67.4    9e-10   Gossypium arboreum [tree cotton]
gb|KFK27065.1|  hypothetical protein AALP_AA8G329900                  66.6    2e-09   Arabis alpina [alpine rockcress]
ref|XP_010448280.1|  PREDICTED: uncharacterized protein LOC104730767  66.6    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006452123.1|  hypothetical protein CICLE_v10008955mg           65.5    5e-09   Citrus clementina [clementine]
ref|XP_006401561.1|  hypothetical protein EUTSA_v10014255mg           65.1    6e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010520882.1|  PREDICTED: uncharacterized protein LOC104799894  65.5    6e-09   Tarenaya hassleriana [spider flower]
ref|XP_008359297.1|  PREDICTED: uncharacterized protein LOC103423006  65.1    7e-09   
gb|KJB81865.1|  hypothetical protein B456_013G165300                  64.7    1e-08   Gossypium raimondii
gb|KHG00183.1|  hypothetical protein F383_20411                       64.7    1e-08   Gossypium arboreum [tree cotton]
ref|XP_010443028.1|  PREDICTED: uncharacterized protein LOC104725975  63.9    1e-08   Camelina sativa [gold-of-pleasure]
gb|KHN38595.1|  hypothetical protein glysoja_040149                   63.2    2e-08   Glycine soja [wild soybean]
ref|XP_003539571.1|  PREDICTED: uncharacterized protein LOC100795...  63.5    2e-08   Glycine max [soybeans]
ref|XP_009119980.1|  PREDICTED: uncharacterized protein LOC103844909  63.5    2e-08   Brassica rapa
ref|XP_006592890.1|  PREDICTED: uncharacterized protein LOC100795...  63.2    2e-08   
gb|KHN27993.1|  hypothetical protein glysoja_007725                   63.5    2e-08   Glycine soja [wild soybean]
emb|CDY42460.1|  BnaA10g08360D                                        63.9    2e-08   Brassica napus [oilseed rape]
ref|XP_011048249.1|  PREDICTED: uncharacterized protein LOC105142...  63.5    2e-08   Populus euphratica
ref|XP_011048250.1|  PREDICTED: uncharacterized protein LOC105142...  63.2    3e-08   Populus euphratica
ref|XP_002864339.1|  hypothetical protein ARALYDRAFT_495534           62.8    3e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_010482859.1|  PREDICTED: uncharacterized protein LOC104761470  62.8    4e-08   Camelina sativa [gold-of-pleasure]
gb|AFK40032.1|  unknown                                               62.8    4e-08   Lotus japonicus
emb|CDY64929.1|  BnaCnng45510D                                        62.4    4e-08   Brassica napus [oilseed rape]
gb|AFK40544.1|  unknown                                               62.8    5e-08   Lotus japonicus
ref|XP_003527303.2|  PREDICTED: uncharacterized protein LOC100782462  62.4    6e-08   Glycine max [soybeans]
gb|KJB45630.1|  hypothetical protein B456_007G317200                  62.4    7e-08   Gossypium raimondii
ref|XP_006280901.1|  hypothetical protein CARUB_v10026894mg           62.0    7e-08   Capsella rubella
gb|AGV54826.1|  hypothetical protein                                  62.0    8e-08   Phaseolus vulgaris [French bean]
gb|KHN36752.1|  hypothetical protein glysoja_001483                   61.2    9e-08   Glycine soja [wild soybean]
ref|XP_006594801.1|  PREDICTED: uncharacterized protein LOC100779229  61.2    1e-07   Glycine max [soybeans]
ref|XP_009127082.1|  PREDICTED: uncharacterized protein LOC103851954  61.6    1e-07   Brassica rapa
ref|XP_004294319.1|  PREDICTED: uncharacterized protein LOC101314638  61.6    1e-07   Fragaria vesca subsp. vesca
ref|XP_007133044.1|  hypothetical protein PHAVU_011G146700g           61.2    1e-07   Phaseolus vulgaris [French bean]
ref|XP_007211764.1|  hypothetical protein PRUPE_ppa009590mg           61.2    1e-07   
ref|XP_008226793.1|  PREDICTED: uncharacterized protein LOC103326356  60.8    2e-07   Prunus mume [ume]
emb|CDY68666.1|  BnaAnng27970D                                        59.7    3e-07   Brassica napus [oilseed rape]
ref|XP_008813171.1|  PREDICTED: uncharacterized protein LOC103723874  60.1    4e-07   
emb|CDY63696.1|  BnaCnng42470D                                        59.7    5e-07   Brassica napus [oilseed rape]
gb|AFK42977.1|  unknown                                               58.9    6e-07   Medicago truncatula
gb|KEH30768.1|  transmembrane protein, putative                       59.3    7e-07   Medicago truncatula
ref|XP_011095782.1|  PREDICTED: uncharacterized protein LOC105175132  57.8    7e-07   Sesamum indicum [beniseed]
ref|XP_010928579.1|  PREDICTED: uncharacterized protein LOC105050...  58.5    1e-06   Elaeis guineensis
ref|XP_009355556.1|  PREDICTED: uncharacterized protein LOC103946557  58.5    1e-06   Pyrus x bretschneideri [bai li]
gb|KJB45631.1|  hypothetical protein B456_007G317200                  57.8    2e-06   Gossypium raimondii
ref|XP_010928571.1|  PREDICTED: uncharacterized protein LOC105050...  57.4    3e-06   
ref|XP_002443952.1|  hypothetical protein SORBIDRAFT_07g004990        57.0    4e-06   Sorghum bicolor [broomcorn]
gb|ACJ85791.1|  unknown                                               53.5    5e-06   Medicago truncatula
ref|XP_002530913.1|  conserved hypothetical protein                   52.4    9e-06   
gb|ACF82614.1|  unknown                                               53.5    1e-05   Zea mays [maize]
ref|XP_004987122.1|  PREDICTED: uncharacterized protein LOC101758268  54.3    2e-05   
gb|EMT06766.1|  hypothetical protein F775_27558                       54.3    2e-05   
ref|XP_004972711.1|  PREDICTED: uncharacterized protein LOC101763830  54.3    3e-05   Setaria italica
gb|ABR26041.1|  unknown                                               52.8    3e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_008678238.1|  PREDICTED: uncharacterized protein LOC103653035  54.3    4e-05   
ref|XP_004985312.1|  PREDICTED: uncharacterized protein LOC101783230  53.9    4e-05   Setaria italica
ref|NP_001144178.1|  uncharacterized protein LOC100277035             53.9    5e-05   Zea mays [maize]
gb|AFW56882.1|  hypothetical protein ZEAMMB73_730622                  53.5    6e-05   
gb|EAY88928.1|  hypothetical protein OsI_10413                        53.5    7e-05   Oryza sativa Indica Group [Indian rice]
gb|AFW56883.1|  hypothetical protein ZEAMMB73_730622                  53.1    7e-05   
ref|NP_001049294.1|  Os03g0201000                                     53.1    8e-05   
gb|EEE58521.1|  hypothetical protein OsJ_09808                        53.1    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEE68150.1|  hypothetical protein OsJ_26259                        51.2    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94497.1|  expressed protein                                     53.1    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659890.1|  PREDICTED: uncharacterized protein LOC102713016  52.4    1e-04   
ref|XP_008365896.1|  PREDICTED: uncharacterized protein LOC103429531  52.8    1e-04   
gb|EAZ05807.1|  hypothetical protein OsI_28043                        52.4    1e-04   Oryza sativa Indica Group [Indian rice]
dbj|BAJ88294.1|  predicted protein                                    52.8    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573409.1|  PREDICTED: uncharacterized protein LOC100845511  52.8    1e-04   Brachypodium distachyon [annual false brome]
gb|KJB45632.1|  hypothetical protein B456_007G317300                  52.8    1e-04   Gossypium raimondii
ref|NP_001061135.1|  Os08g0179900                                     52.0    2e-04   
ref|XP_009393345.1|  PREDICTED: uncharacterized protein LOC103979052  51.6    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF80671.1|  unknown                                               48.9    4e-04   Zea mays [maize]
dbj|BAK00216.1|  predicted protein                                    50.4    5e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT30710.1|  hypothetical protein F775_11491                       50.1    6e-04   
ref|XP_007149673.1|  hypothetical protein PHAVU_005G0894000g          47.4    7e-04   Phaseolus vulgaris [French bean]



>ref|XP_009769968.1| PREDICTED: uncharacterized protein LOC104220737 isoform X1 [Nicotiana 
sylvestris]
Length=328

 Score =   114 bits (285),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIK----VAVLDMMNC  283
            D +  ++ES+A+TD    SSPR+    SE    K  N FT FLQN+K      V+DMM+ 
Sbjct  218  DSDQKMDESVADTDSFSQSSPRSAFSKSEAEESKSKNSFTGFLQNVKRTVTQTVIDMMSS  277

Query  282  LSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            LSD+F NLFGG+KVF +ADGSAK    ++ LGASF+GLAIMAIMVVVLK
Sbjct  278  LSDYFNNLFGGNKVFIEADGSAKLGAAEKTLGASFIGLAIMAIMVVVLK  326


 Score = 87.8 bits (216),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 48/68 (71%), Gaps = 6/68 (9%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGII  518
            +   APKHAI+AF+FL E  AAQ+VVASIA DPNVW AVL NP LQEFLVSQKTS     
Sbjct  156  VTPSAPKHAIQAFRFLSETPAAQSVVASIACDPNVWTAVLQNPALQEFLVSQKTSE----  211

Query  517  VLNCLQFP  494
               C  FP
Sbjct  212  --KCASFP  217



>ref|XP_009769969.1| PREDICTED: uncharacterized protein LOC104220737 isoform X2 [Nicotiana 
sylvestris]
Length=325

 Score =   114 bits (285),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIK----VAVLDMMNC  283
            D +  ++ES+A+TD    SSPR+    SE    K  N FT FLQN+K      V+DMM+ 
Sbjct  215  DSDQKMDESVADTDSFSQSSPRSAFSKSEAEESKSKNSFTGFLQNVKRTVTQTVIDMMSS  274

Query  282  LSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            LSD+F NLFGG+KVF +ADGSAK    ++ LGASF+GLAIMAIMVVVLK
Sbjct  275  LSDYFNNLFGGNKVFIEADGSAKLGAAEKTLGASFIGLAIMAIMVVVLK  323


 Score = 87.0 bits (214),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            +   APKHAI+AF+FL E  AAQ+VVASIA DPNVW AVL NP LQEFLVSQKTS
Sbjct  156  VTPSAPKHAIQAFRFLSETPAAQSVVASIACDPNVWTAVLQNPALQEFLVSQKTS  210



>ref|XP_009615933.1| PREDICTED: uncharacterized protein LOC104108568 isoform X1 [Nicotiana 
tomentosiformis]
Length=330

 Score =   109 bits (273),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 4/109 (4%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIK----VAVLDMMNC  283
            D +  ++ES+A+TD    SSPRN     E    K  N FT FLQN+       V++MM+ 
Sbjct  220  DLDQKMDESVADTDSFSQSSPRNAFSKYEAEESKSKNSFTGFLQNVTHTVTQTVINMMSS  279

Query  282  LSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            LSD+F NLFGG KVF +ADGSAK   V++ LGASF+GLAIMAIMVVVLK
Sbjct  280  LSDYFNNLFGGTKVFIEADGSAKLGAVEKTLGASFIGLAIMAIMVVVLK  328


 Score = 85.1 bits (209),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 47/68 (69%), Gaps = 6/68 (9%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGII  518
            +   APKHAI+AF+FL E  AAQ+VVASIA DPNVW AVL NP LQEFL SQKTS     
Sbjct  158  VTPSAPKHAIQAFRFLSETPAAQSVVASIACDPNVWTAVLQNPALQEFLESQKTSE----  213

Query  517  VLNCLQFP  494
               C  FP
Sbjct  214  --KCASFP  219



>ref|XP_009615934.1| PREDICTED: uncharacterized protein LOC104108568 isoform X2 [Nicotiana 
tomentosiformis]
Length=327

 Score =   109 bits (273),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 4/109 (4%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIK----VAVLDMMNC  283
            D +  ++ES+A+TD    SSPRN     E    K  N FT FLQN+       V++MM+ 
Sbjct  217  DLDQKMDESVADTDSFSQSSPRNAFSKYEAEESKSKNSFTGFLQNVTHTVTQTVINMMSS  276

Query  282  LSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            LSD+F NLFGG KVF +ADGSAK   V++ LGASF+GLAIMAIMVVVLK
Sbjct  277  LSDYFNNLFGGTKVFIEADGSAKLGAVEKTLGASFIGLAIMAIMVVVLK  325


 Score = 84.3 bits (207),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            +   APKHAI+AF+FL E  AAQ+VVASIA DPNVW AVL NP LQEFL SQKTS
Sbjct  158  VTPSAPKHAIQAFRFLSETPAAQSVVASIACDPNVWTAVLQNPALQEFLESQKTS  212



>ref|XP_006360111.1| PREDICTED: uncharacterized protein LOC102579806 [Solanum tuberosum]
Length=328

 Score = 93.2 bits (230),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDF  271
            D +   +ES+A+T     SSP      S+    K GN FT FLQN+   V+DMM+ LSDF
Sbjct  221  DSDQEKDESVADTASFSESSPWKPFSESKAEESKSGNFFTSFLQNVTQTVVDMMDSLSDF  280

Query  270  FQNLFGGHKVFADADGSAKTSVVDRALGASFMGLA  166
            F NLFGG+K F DADGSAK   V++ LGASFM LA
Sbjct  281  FNNLFGGNKFFVDADGSAKFGAVEKTLGASFMALA  315


 Score = 74.7 bits (182),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (9%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGII  518
            +    PKHA++A++ L E  AAQ VVASIA DPNVWNAVL NP LQ+FL SQ++S     
Sbjct  159  VTKSVPKHAVQAYRVLSEIPAAQNVVASIACDPNVWNAVLQNPALQDFLESQRSSE----  214

Query  517  VLNCLQFP  494
               C  FP
Sbjct  215  --KCASFP  220



>ref|XP_010324338.1| PREDICTED: uncharacterized protein LOC101263228 isoform X1 [Solanum 
lycopersicum]
Length=334

 Score = 90.9 bits (224),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 4/105 (4%)
 Frame = -2

Query  468  AGAYVLDGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVL---  298
            AGA   D +   +ES+A TD+   SSP      S+    K GN FT FLQN+   V    
Sbjct  217  AGASFPDSDQERDESVANTDYFSESSPLKAVPESKAEESKSGNTFTSFLQNVTQTVTQTV  276

Query  297  -DMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLA  166
             DMM+ LSDFF NLFGG+K F DADG+AK   V++ LGASFM LA
Sbjct  277  VDMMDSLSDFFNNLFGGNKFFVDADGTAKFGAVEKTLGASFMALA  321


 Score = 73.6 bits (179),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            +    PKHA++A++ L E  AAQ VVASIA DPNVWNAVL NP LQ+FL SQ++S
Sbjct  159  VTKSVPKHAVQAYRVLSEIPAAQNVVASIACDPNVWNAVLQNPALQDFLESQRSS  213



>ref|XP_004244170.1| PREDICTED: uncharacterized protein LOC101263228 isoform X2 [Solanum 
lycopersicum]
Length=332

 Score = 87.0 bits (214),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVL----DMMNC  283
            D +   +ES+A TD+   SSP      S+    K GN FT FLQN+   V     DMM+ 
Sbjct  221  DSDQERDESVANTDYFSESSPLKAVPESKAEESKSGNTFTSFLQNVTQTVTQTVVDMMDS  280

Query  282  LSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLA  166
            LSDFF NLFGG+K F DADG+AK   V++ LGASFM LA
Sbjct  281  LSDFFNNLFGGNKFFVDADGTAKFGAVEKTLGASFMALA  319


 Score = 75.1 bits (183),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 7/76 (9%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGII  518
            +    PKHA++A++ L E  AAQ VVASIA DPNVWNAVL NP LQ+FL SQ++S     
Sbjct  159  VTKSVPKHAVQAYRVLSEIPAAQNVVASIACDPNVWNAVLQNPALQDFLESQRSSE----  214

Query  517  VLNCLQFPTFSFHSRD  470
               C  FP  S   RD
Sbjct  215  --KCASFPD-SDQERD  227



>ref|XP_011097947.1| PREDICTED: uncharacterized protein LOC105176746 isoform X1 [Sesamum 
indicum]
Length=317

 Score = 82.0 bits (201),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 11/101 (11%)
 Frame = -2

Query  429  ESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG  250
            E +A+TD L  +   ND       S K  +G+ DFLQ I+  ++ MM+ LSDFFQN FGG
Sbjct  223  ELVADTDNLDQAKTFND-------SSKHASGYKDFLQKIRCTIVGMMSGLSDFFQNFFGG  275

Query  249  ---HKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
               ++V  D+DG+A+ +  D  + ASFMGLA+MAI+V+VLK
Sbjct  276  KGTNRVVVDSDGTARVT-GDTWMEASFMGLAVMAILVIVLK  315


 Score = 73.6 bits (179),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -1

Query  670  IRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            I AF+FL E++AAQ VVASIA DPNVWNAVL N ELQEFL SQKTS
Sbjct  169  IMAFRFLSESSAAQNVVASIACDPNVWNAVLQNQELQEFLQSQKTS  214



>gb|EYU33580.1| hypothetical protein MIMGU_mgv1a010110mg [Erythranthe guttata]
Length=322

 Score = 81.3 bits (199),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = -2

Query  456  VLDGEYSVEESIAETDFLRYSSPRN-DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCL  280
            V   E S  E   +++ + +S+P++ D  +SE+G   P N FT+  Q IK +V+DMM+ L
Sbjct  211  VFSDENSYTELAEDSEPIDHSTPKSVDSSSSENGEAGPANVFTNVFQKIKNSVVDMMSSL  270

Query  279  SDFFQNLF---GGHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            SD+FQ+ F   GG+ V  ++DG+A  S  +  +  SFMGLAIMAI+V++LK
Sbjct  271  SDYFQSFFGGKGGNGVTLNSDGTANLS-AETVMQGSFMGLAIMAILVILLK  320


 Score = 63.9 bits (154),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            ++++  P  AI AF+ L+E+  A+ VVASIA DPNVWNAV  N ELQ FL SQ  S++
Sbjct  154  SVSNAVPATAIMAFRLLHESPMAKNVVASIACDPNVWNAVRQNQELQGFLQSQGASLV  211



>gb|AFX67022.1| hypothetical protein [Solanum tuberosum]
Length=324

 Score = 73.6 bits (179),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (65%), Gaps = 6/68 (9%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGII  518
            +    PKHA++A++ L E  AAQ VVASIA DPNVWNAVL NP LQ+FL SQ+ S     
Sbjct  159  VTKSVPKHAVQAYRILSEIPAAQNVVASIACDPNVWNAVLQNPALQDFLESQRYSE----  214

Query  517  VLNCLQFP  494
               C  FP
Sbjct  215  --KCASFP  220


 Score = 65.1 bits (157),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVL----DMMNC  283
            D +   +ES+A+T     SSP      S+    K GN FT FLQN+   V      MM+ 
Sbjct  221  DSDQEKDESVADTASFSESSPWKPFSESKAEESKSGNSFTSFLQNVTQTVTQTVVSMMDS  280

Query  282  LSDFFQNLFGGHKVFADADGSAK  214
            LSDFF NLFGG+K F DADGSAK
Sbjct  281  LSDFFNNLFGGNKFFVDADGSAK  303



>ref|XP_010267849.1| PREDICTED: uncharacterized protein LOC104604963 [Nelumbo nucifera]
Length=339

 Score = 71.2 bits (173),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 66/105 (63%), Gaps = 11/105 (10%)
 Frame = -2

Query  450  DGEYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDF  271
            DG+++ EES +E+ +         D   ED     G+GF  ++ N+K+ V+ M++ +S+F
Sbjct  244  DGKFNGEES-SESIY---------DEVDEDHRENRGDGFMGWINNVKLTVMKMVSSVSEF  293

Query  270  FQNLFGGHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            F ++ GG  +  D +G+  T+ V+R + +SFM LA++AIMVVVLK
Sbjct  294  FHHILGGD-ISVDGNGNGTTATVERTITSSFMALAVLAIMVVVLK  337


 Score = 66.2 bits (160),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            AP HA++AFK L E+A AQ+VVAS+ SD NVW+AV+ N E+ EFL SQ TS
Sbjct  178  APIHALQAFKLLKESAEAQSVVASLVSDKNVWDAVMKNEEVVEFLQSQHTS  228



>gb|ABK93511.1| unknown [Populus trichocarpa]
Length=325

 Score = 62.8 bits (151),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            PK+A++AF  L E+   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T
Sbjct  165  PKYAMQAFSLLNESPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT  213


 Score = 59.3 bits (142),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 8/105 (8%)
 Frame = -2

Query  432  EESIAETDFLRYSSPRN----DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  265
            +E + +TDF    S +N     D  SE GS +      D + N+K+ V+D++  LS +FQ
Sbjct  221  KEFVRDTDFQDAVSSKNLAELSDDESEAGSSQ--TELVDIINNVKLTVVDLVTNLSAYFQ  278

Query  264  NLFG--GHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
             +F     +    A+ SA  + +++ +GAS MGLA++ IMVVVL+
Sbjct  279  KIFSFSSAEHTPAANESAGAATIEKTIGASLMGLAVIVIMVVVLR  323



>ref|XP_002316956.1| hypothetical protein POPTR_0011s13360g [Populus trichocarpa]
 gb|EEE97568.1| hypothetical protein POPTR_0011s13360g [Populus trichocarpa]
Length=326

 Score = 62.8 bits (151),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            PK+A++AF  L E+   QTVVA++ASDPNVWNAV  N  LQE L SQ T
Sbjct  164  PKYAMQAFSLLNESPKIQTVVAALASDPNVWNAVWENEALQELLQSQNT  212


 Score = 56.6 bits (135),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 58/106 (55%), Gaps = 10/106 (9%)
 Frame = -2

Query  429  ESIAETDF--LRYSSPRNDDLTSEDGSPKPGNGFT---DFLQNIKVAVLDMMNCLSDFFQ  265
            ES+ +TD      SS +  +L+  D   + GN  T   D + NIK+ V+DM+  +S +FQ
Sbjct  221  ESVGDTDSQDAAVSSKKLTELS--DDESETGNSQTRLMDVINNIKLTVVDMVTNVSAYFQ  278

Query  264  NLFG---GHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
             +F           AD +A  S  ++ LGAS M LA+M IMVVVL+
Sbjct  279  KIFSFSSAEHTPDAADENAGLSTTEKTLGASLMALAVMVIMVVVLR  324



>ref|XP_006370583.1| hypothetical protein POPTR_0001s44020g [Populus trichocarpa]
 gb|ERP67152.1| hypothetical protein POPTR_0001s44020g [Populus trichocarpa]
Length=325

 Score = 62.8 bits (151),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            PK+A++AF  L E+   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T
Sbjct  165  PKYAMQAFSLLNESPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT  213


 Score = 56.2 bits (134),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 59/107 (55%), Gaps = 12/107 (11%)
 Frame = -2

Query  432  EESIAETDFLRYSSPRN----DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  265
            +E + +TDF    S +N     D  SE GS +      D + N+K+ V+D++  +S +FQ
Sbjct  221  KEFVRDTDFQDAVSSKNLAELSDDESEAGSSQ--TELVDIINNVKLTVVDLVTNVSAYFQ  278

Query  264  NLF----GGHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
             +F      H   A+    A T  +++ +GAS MGLA++ IMVVVL+
Sbjct  279  KIFSFSSAEHTPAANEIAGAAT--IEKTIGASLMGLAVIVIMVVVLR  323



>ref|XP_010092273.1| hypothetical protein L484_021134 [Morus notabilis]
 gb|EXB50907.1| hypothetical protein L484_021134 [Morus notabilis]
Length=325

 Score = 66.2 bits (160),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            P HA++AFKFL  ++ AQTVVAS+A+D NVWNAV+ NP LQ+F+ + K S
Sbjct  166  PNHALKAFKFLSRSSEAQTVVASLATDLNVWNAVMQNPVLQDFMQANKNS  215


 Score = 52.0 bits (123),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -2

Query  441  YSVEESIAETDFLRYSSPRNDDLTSED-GSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  265
            YS + S+A+ +F     P N + +SE   +    N F   L+N KV V+++++ LS  FQ
Sbjct  224  YSPKNSVADPEFQEQVFPENVEKSSEGMETGDSENWFMSMLENFKVTVVELVSNLSSSFQ  283

Query  264  NLFGGHKVFADADGSAKTSVVDRALGASFMG  172
            N+FG     +D + + K++  D  LGASFMG
Sbjct  284  NIFG---FSSDVNENIKSTATDITLGASFMG  311



>ref|XP_010062936.1| PREDICTED: uncharacterized protein LOC104450186 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70085.1| hypothetical protein EUGRSUZ_F03390 [Eucalyptus grandis]
Length=322

 Score = 65.9 bits (159),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 9/63 (14%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGIIVLNCL  503
            PKHA+ AFK L ++  AQTVVASIASD +VW+A L N  LQ+FL SQ +S         +
Sbjct  167  PKHAVEAFKLLTQSPEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNSS---------I  217

Query  502  QFP  494
            QFP
Sbjct  218  QFP  220


 Score = 51.6 bits (122),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 11/94 (12%)
 Frame = -2

Query  444  EYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  265
            E  VE+S  +     + SPR D+ TSE G     NGF  FLQNIK+ V  M++ +S F  
Sbjct  223  EPKVEKSADDAFSDDWKSPRVDEETSEGGH---KNGFMSFLQNIKLRVEQMVSNISSFLA  279

Query  264  NLFGG---HKVFADADGSAKTSVVDRALGASFMG  172
            ++F      K+ +++DG+A       A+GASFMG
Sbjct  280  DIFTPPSVEKMSSNSDGNAGL-----AVGASFMG  308



>gb|KCW70086.1| hypothetical protein EUGRSUZ_F03390 [Eucalyptus grandis]
Length=194

 Score = 65.5 bits (158),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 9/63 (14%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGIIVLNCL  503
            PKHA+ AFK L ++  AQTVVASIASD +VW+A L N  LQ+FL SQ +S         +
Sbjct  39   PKHAVEAFKLLTQSPEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNSS---------I  89

Query  502  QFP  494
            QFP
Sbjct  90   QFP  92


 Score = 51.6 bits (122),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 11/79 (14%)
 Frame = -2

Query  399  YSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADA  229
            + SPR D+ TSE G     NGF  FLQNIK+ V  M++ +S F  ++F      K+ +++
Sbjct  110  WKSPRVDEETSEGGH---KNGFMSFLQNIKLRVEQMVSNISSFLADIFTPPSVEKMSSNS  166

Query  228  DGSAKTSVVDRALGASFMG  172
            DG+A       A+GASFMG
Sbjct  167  DGNAGL-----AVGASFMG  180



>ref|XP_010062934.1| PREDICTED: uncharacterized protein LOC104450186 isoform X1 [Eucalyptus 
grandis]
Length=323

 Score = 65.1 bits (157),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 8/63 (13%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGIIVLNCL  503
            PKHA+ AFK L ++  AQTVVASIASD +VW+A L N  LQ+FL SQ ++         +
Sbjct  167  PKHAVEAFKLLTQSPEAQTVVASIASDQDVWDAFLKNKALQDFLQSQNST--------GI  218

Query  502  QFP  494
            QFP
Sbjct  219  QFP  221


 Score = 51.2 bits (121),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 11/94 (12%)
 Frame = -2

Query  444  EYSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  265
            E  VE+S  +     + SPR D+ TSE G     NGF  FLQNIK+ V  M++ +S F  
Sbjct  224  EPKVEKSADDAFSDDWKSPRVDEETSEGGHK---NGFMSFLQNIKLRVEQMVSNISSFLA  280

Query  264  NLFGG---HKVFADADGSAKTSVVDRALGASFMG  172
            ++F      K+ +++DG+A       A+GASFMG
Sbjct  281  DIFTPPSVEKMSSNSDGNAGL-----AVGASFMG  309



>ref|XP_008789186.1| PREDICTED: uncharacterized protein LOC103706755 [Phoenix dactylifera]
Length=316

 Score = 60.1 bits (144),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 14/108 (13%)
 Frame = -2

Query  444  EYSVEESIAETDFLRY-SSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFF  268
            E SV E++   +FL    +P  D  TS          F + + NIK  V +M+N LS+F 
Sbjct  216  EESVAENVCTKEFLESPKTPAEDSQTSV---------FAEIVGNIKRKVTEMVNHLSNFL  266

Query  267  QNLFGGHKVFADADGSAKTSV----VDRALGASFMGLAIMAIMVVVLK  136
            Q+LFG       +  + +T      VD A+GASF+ LAI AI+VV++K
Sbjct  267  QDLFGTSTGAQSSTSTKRTGTTGPNVDGAIGASFIALAIAAILVVLVK  314


 Score = 55.1 bits (131),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            PKH ++AF  L+ +  AQ VVAS+A+D NVW+AV+ N ++ EF  +Q++ +L
Sbjct  156  PKHVVQAFSLLHGSPEAQNVVASLAADKNVWDAVMKNEKVMEFYRTQQSVVL  207



>ref|XP_010694294.1| PREDICTED: uncharacterized protein LOC104907109 [Beta vulgaris 
subsp. vulgaris]
Length=295

 Score = 75.1 bits (183),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            PK A++AFK L EN AAQTVVASIA DPNVWNAV+ NP L EFL S+K S
Sbjct  147  PKSAMQAFKLLKENPAAQTVVASIACDPNVWNAVMQNPTLMEFLDSEKKS  196


 Score = 37.7 bits (86),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (52%), Gaps = 7/85 (8%)
 Frame = -2

Query  411  DFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGH---KV  241
            +F    SP+++  +++   P+  +G    L+N+K+ V+DM+  L++  Q+ F      K 
Sbjct  203  EFESEESPKSEVDSTDSSDPEGLHGLMAMLENVKLTVVDMVQNLTNLVQSWFASPELDKR  262

Query  240  FADADGSAKTSVVDRALGASFMGLA  166
                DGS+++       G SFM LA
Sbjct  263  SEATDGSSRSIFA----GGSFMALA  283



>ref|XP_009385062.1| PREDICTED: uncharacterized protein LOC103972444 [Musa acuminata 
subsp. malaccensis]
Length=297

 Score = 55.8 bits (133),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            +I   AP+H ++AF  L  +   Q VVAS+ASD NVWNAV+ N ++ EF V+ ++
Sbjct  148  SIVPSAPRHVVQAFSLLRGSPEVQDVVASLASDENVWNAVMKNEKVMEFYVTHQS  202


 Score = 54.3 bits (129),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 55/104 (53%), Gaps = 7/104 (7%)
 Frame = -2

Query  441  YSVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQN  262
            Y   +SIA    L   S   DD  S      P + F+DF+ N+KV V+ M++ ++ FFQ 
Sbjct  197  YVTHQSIA----LNSESDVADDCESSTAETTPNSVFSDFVHNVKVKVVAMVSNITSFFQE  252

Query  261  LFG--GHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            +    G    + +  + K   VD  +G+SFM LAI  I+VV+L+
Sbjct  253  ILQTLGRSSSSTSTNTDK-PFVDFTIGSSFMALAIATILVVLLR  295



>ref|XP_011030911.1| PREDICTED: uncharacterized protein LOC105130206 isoform X1 [Populus 
euphratica]
Length=331

 Score = 61.6 bits (148),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            PK+A++AF  L E+   QTVVA++ASDPNVWNAV  N  LQE L SQ
Sbjct  161  PKYAMQAFSLLNESPKIQTVVAALASDPNVWNAVWENEALQELLQSQ  207


 Score = 44.7 bits (104),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 14/109 (13%)
 Frame = -2

Query  429  ESIAETDF--LRYSSPRNDDLT---SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  265
            ES+ +TD      SS +  +L+   SE G+ +   G  D + N+K+ V+DM+   S +F+
Sbjct  224  ESVGDTDSQDAAVSSKKLTELSDDESETGNSQ--TGLKDVINNVKLTVVDMVTNASAYFK  281

Query  264  NLFGGHKVFADADGS------AKTSVVDRALGASFMGLAIMAIMVVVLK  136
             +F         D +      A +S  +  LG S M LA+M IMVVVL+
Sbjct  282  KIFSFSSAEHTPDAADENAENAGSSTFEMTLG-SLMALAVMVIMVVVLR  329



>ref|XP_011030912.1| PREDICTED: uncharacterized protein LOC105130206 isoform X2 [Populus 
euphratica]
Length=325

 Score = 61.6 bits (148),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            PK+A++AF  L E+   QTVVA++ASDPNVWNAV  N  LQE L SQ
Sbjct  161  PKYAMQAFSLLNESPKIQTVVAALASDPNVWNAVWENEALQELLQSQ  207


 Score = 44.7 bits (104),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 14/109 (13%)
 Frame = -2

Query  429  ESIAETDF--LRYSSPRNDDLT---SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQ  265
            ES+ +TD      SS +  +L+   SE G+ +   G  D + N+K+ V+DM+   S +F+
Sbjct  218  ESVGDTDSQDAAVSSKKLTELSDDESETGNSQ--TGLKDVINNVKLTVVDMVTNASAYFK  275

Query  264  NLFGGHKVFADADGS------AKTSVVDRALGASFMGLAIMAIMVVVLK  136
             +F         D +      A +S  +  LG S M LA+M IMVVVL+
Sbjct  276  KIFSFSSAEHTPDAADENAENAGSSTFEMTLG-SLMALAVMVIMVVVLR  323



>ref|XP_011097948.1| PREDICTED: uncharacterized protein LOC105176746 isoform X2 [Sesamum 
indicum]
Length=304

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 64/98 (65%), Gaps = 7/98 (7%)
 Frame = -2

Query  411  DFLRYSSPRNDDLTSE---DGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGG---  250
            +FL+      D+L      + S K  +G+ DFLQ I+  ++ MM+ LSDFFQN FGG   
Sbjct  206  EFLQSQKTYTDNLDQAKTFNDSSKHASGYKDFLQKIRCTIVGMMSGLSDFFQNFFGGKGT  265

Query  249  HKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            ++V  D+DG+A+ +  D  + ASFMGLA+MAI+V+VLK
Sbjct  266  NRVVVDSDGTARVT-GDTWMEASFMGLAVMAILVIVLK  302


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  670  IRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            I AF+FL E++AAQ VVASIA DPNVWNAVL N ELQEFL SQKT
Sbjct  169  IMAFRFLSESSAAQNVVASIACDPNVWNAVLQNQELQEFLQSQKT  213



>ref|XP_010910123.1| PREDICTED: uncharacterized protein LOC105036081 [Elaeis guineensis]
Length=318

 Score = 55.8 bits (133),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            A+    PKH ++AF  L  +  AQ VVAS+A+D NVW+AV+ N ++ EF  +Q++ +L
Sbjct  152  ALVQSMPKHVVQAFSLLQGSPEAQDVVASLAADKNVWDAVMKNEKVMEFYRTQQSVVL  209


 Score = 49.3 bits (116),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (51%), Gaps = 20/118 (17%)
 Frame = -2

Query  456  VLDGEYSV--EESIAETDFLRY-----SSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVL  298
            VL  E +V  EES+ E +  +       SP  D  TS          FT+ + +IK+ V 
Sbjct  208  VLQAETNVDFEESVGENECTKEYPESPKSPAGDSQTSV---------FTEIMGHIKLKVT  258

Query  297  DMMNCLSDFFQNLFG----GHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            +M++ +S+F Q+L G         +     +  S VD A+GASF+ LAI  I+VV++K
Sbjct  259  EMVSHISNFLQDLLGTSTGAQSSSSTKSTGSIGSNVDVAVGASFIALAIATILVVLVK  316



>emb|CDP05826.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQK  539
            APKHAI+AF FL E+ A Q+VVASIASDPNVWNAVL NP LQ+++ SQK
Sbjct  158  APKHAIQAFTFLNESPAVQSVVASIASDPNVWNAVLLNPTLQDYIQSQK  206


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = -2

Query  381  DDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGH---KVFADADGSAKT  211
            D   SE G       F +  Q +K+ V+DMMN LSD+FQ LFGG+   K  AD +G+  +
Sbjct  239  DRAESEYGESNSTGRFMELWQELKLTVVDMMNSLSDYFQALFGGYSNNKGAADTNGNVFS  298

Query  210  SVVDRALGASFMGLAIMAIMVVVLK  136
              VD+ALG S MGLA+M I+VVVLK
Sbjct  299  GFVDKALGPSLMGLAVMVIVVVVLK  323



>ref|XP_007021147.1| Uncharacterized protein TCM_031178 [Theobroma cacao]
 gb|EOY12672.1| Uncharacterized protein TCM_031178 [Theobroma cacao]
Length=355

 Score = 59.3 bits (142),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 60/103 (58%), Gaps = 14/103 (14%)
 Frame = -2

Query  438  SVEESIAETDFLRYSSPRNDDLTSEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNL  259
            S E S+   +++  S P++            GN F++FL  +K  V++++N  +DF Q+L
Sbjct  263  SSESSVKLEEYVDASHPKDS-----------GNQFSNFLLKVKTTVIELVNKATDFLQSL  311

Query  258  FGGHKVFADADGSAKT--SVVDRALGASFMGLAIMAIMVVVLK  136
            F       +A+G+A +  S  D+ +GAS MGLA+M IMVV++K
Sbjct  312  FTLPSA-ENAEGNAGSTFSSFDKTIGASLMGLAVMVIMVVLVK  353


 Score = 41.2 bits (95),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 35/87 (40%), Gaps = 34/87 (39%)
 Frame = -1

Query  694  AHGAPKHAIRAFKFLYENAAAQT----------------------------------VVA  617
            A   PK AI+AFK   E+   QT                                  VV 
Sbjct  165  ATSVPKPAIQAFKLFNESPQVQTSRRVSFLDSCALGNVRCVFAIISCPPVGFLHIVSVVT  224

Query  616  SIASDPNVWNAVLANPELQEFLVSQKT  536
            S+A+D NVWNAVL N    EF+ SQKT
Sbjct  225  SLAADQNVWNAVLNNSAYMEFVQSQKT  251



>ref|XP_002530912.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31461.1| conserved hypothetical protein [Ricinus communis]
Length=198

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  530
            A A  AP HAI+AF  L  +  AQT+VASIA+DPNVW+AVL N  LQE+L+SQ T +
Sbjct  137  ARASSAPTHAIKAFTLLNRSPQAQTIVASIATDPNVWDAVLKNGALQEYLLSQNTKL  193



>ref|XP_002283181.1| PREDICTED: uncharacterized protein LOC100265933 [Vitis vinifera]
Length=339

 Score = 68.9 bits (167),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 9/72 (13%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGIIVLNCL  503
            P HAI+AF +L ++ AAQ VVASIASDPNVW+AV+ N  L EFL +QKT         C 
Sbjct  160  PAHAIQAFAYLKDSPAAQNVVASIASDPNVWSAVMQNEALVEFLQAQKT---------CA  210

Query  502  QFPTFSFHSRDC  467
             +P+   ++ + 
Sbjct  211  PYPSMGLNAEES  222


 Score = 26.9 bits (58),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 54/112 (48%), Gaps = 20/112 (18%)
 Frame = -2

Query  432  EESIAETDFLRYSSPRNDDLTSEDG----------SPKPGNGFTDF-----LQNIKVAVL  298
            EES+A+T F    +P++ + +S++G          +PK     +D      L +   ++L
Sbjct  220  EESVADTGFQDQEAPKSFEDSSDEGDSGSRFQNKETPKSFEDSSDAGDSGSLSSWFASLL  279

Query  297  DMMN-CLSDFFQNLFGGH----KVFADADGSAKTSVVDRALGASFMGLAIMA  157
            + M   L++   N+FG      K   D++   +  V++  LGAS  GLA+M 
Sbjct  280  ETMKLSLAEIVGNIFGRPAADVKSSPDSNEKPEGQVMNMGLGASLTGLAVMV  331



>gb|KDP39009.1| hypothetical protein JCGZ_00766 [Jatropha curcas]
Length=316

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  694  AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            A+ APK A+ AFK L E+  AQTVVASIASDPNVW+AV  N  LQEFL SQKT
Sbjct  163  ANSAPKCAVTAFKLLNESPEAQTVVASIASDPNVWDAVWKNVALQEFLQSQKT  215


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 49/91 (54%), Gaps = 5/91 (5%)
 Frame = -2

Query  393  SPRNDDLTSEDGSP--KPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADA  229
            SPR     S+D S   K  N   D  +NIK  V +M+N +S   Q +FG        + A
Sbjct  224  SPRAFTELSDDSSETEKSENKPIDIFENIKQTVAEMVNSVSSMIQQIFGFATAENTSSAA  283

Query  228  DGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            D  ++ +  D+ LGASFM LA+M I VVVLK
Sbjct  284  DEDSQPTFFDKTLGASFMALAVMVIAVVVLK  314



>ref|XP_004151973.1| PREDICTED: uncharacterized protein LOC101218021 isoform 2 [Cucumis 
sativus]
Length=297

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            P+HAI+AFK L E+A AQTVVASIASDPNVWNA+L N  L+ FL S +T+ +
Sbjct  144  PQHAIQAFKLLKESAEAQTVVASIASDPNVWNAMLGNEALKSFLQSYQTNKI  195



>emb|CBI20469.3| unnamed protein product [Vitis vinifera]
Length=281

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSMLGIIVLNCL  503
            P HAI+AF +L ++ AAQ VVASIASDPNVW+AV+ N  L EFL +QKT         C 
Sbjct  206  PAHAIQAFAYLKDSPAAQNVVASIASDPNVWSAVMQNEALVEFLQAQKT---------CA  256

Query  502  QFPTFSFHSRDCRCLCPRW  446
             +P+   ++ +   L P +
Sbjct  257  PYPSMGLNAEESVILEPEF  275



>ref|XP_004151972.1| PREDICTED: uncharacterized protein LOC101218021 isoform 1 [Cucumis 
sativus]
 gb|KGN57942.1| hypothetical protein Csa_3G402460 [Cucumis sativus]
Length=317

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            P+HAI+AFK L E+A AQTVVASIASDPNVWNA+L N  L+ FL S +T+ +
Sbjct  164  PQHAIQAFKLLKESAEAQTVVASIASDPNVWNAMLGNEALKSFLQSYQTNKI  215



>ref|XP_008454598.1| PREDICTED: uncharacterized protein LOC103494971 isoform X2 [Cucumis 
melo]
Length=295

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVS  545
            P+HAI+AFK L E+A AQTVVASIASDPNVWNA+L N  L+ FL S
Sbjct  142  PQHAIQAFKLLKESAEAQTVVASIASDPNVWNAMLGNEALKSFLQS  187



>ref|XP_008454597.1| PREDICTED: uncharacterized protein LOC103494971 isoform X1 [Cucumis 
melo]
Length=315

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVS  545
            P+HAI+AFK L E+A AQTVVASIASDPNVWNA+L N  L+ FL S
Sbjct  162  PQHAIQAFKLLKESAEAQTVVASIASDPNVWNAMLGNEALKSFLQS  207



>ref|NP_200265.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09333.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL25598.1| AT5g54540/MRB17_4 [Arabidopsis thaliana]
 gb|AAM19986.1| AT5g54540/MRB17_4 [Arabidopsis thaliana]
 gb|AED96508.1| uncharacterized protein AT5G54540 [Arabidopsis thaliana]
Length=297

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  530
            A+    P+ A++AF FL EN AAQTVVASIASDP VW+AV+ N +L +FL + KT++
Sbjct  146  AVESAVPQVALQAFAFLSENTAAQTVVASIASDPKVWDAVMENKDLMKFLQTNKTAV  202



>ref|XP_006452122.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|ESR65362.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74401.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=224

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -1

Query  742  NNDHsppsnssseNAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPEL  563
            N++H+   +  + +  +   PK AI+AFK L E+ AAQ+VVASIA DP VWNAV+ N  L
Sbjct  143  NSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQSVVASIACDPAVWNAVVKNDAL  202

Query  562  QEFLVSQKTS  533
             EF+ SQKTS
Sbjct  203  VEFVQSQKTS  212



>gb|KHG12371.1| HEAT repeat-containing 8 [Gossypium arboreum]
Length=317

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  694  AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            A   PK AI+AFK L E+ A Q+VVASIASDPNVWNAVL N    +F+ SQ+TS
Sbjct  169  ATSVPKPAIQAFKLLNESPAVQSVVASIASDPNVWNAVLNNSAYMDFIKSQQTS  222


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (68%), Gaps = 3/71 (4%)
 Frame = -2

Query  345  GNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFAD-ADGSAKTSVVDRALGASFMGL  169
            G+ F+ F+Q IK +V++M++  +DF  +LF      AD A  +A ++ +D+ +GAS MGL
Sbjct  247  GDSFSAFIQKIKTSVVEMVSKTTDFLHSLFSLPS--ADKAKENAGSNNMDKTIGASLMGL  304

Query  168  AIMAIMVVVLK  136
            A+M  MVV+LK
Sbjct  305  AVMVTMVVLLK  315



>gb|KFK27065.1| hypothetical protein AALP_AA8G329900 [Arabis alpina]
Length=296

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            AI    P+ A++AF FL EN AAQTVVASIASDP VW+AV+ N +L +FL S  T
Sbjct  147  AIESAVPQVALQAFAFLSENTAAQTVVASIASDPKVWDAVMENKDLMKFLESNNT  201



>ref|XP_010448280.1| PREDICTED: uncharacterized protein LOC104730767 [Camelina sativa]
Length=305

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            A+    P+ A++AF FL EN AAQTVVASIASDP VW+AV+ N +L +FL +  T
Sbjct  154  AVESAVPQVALKAFAFLSENTAAQTVVASIASDPKVWDAVMENKDLMKFLQTNST  208



>ref|XP_006452123.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 ref|XP_006475259.1| PREDICTED: uncharacterized protein LOC102621279 isoform X1 [Citrus 
sinensis]
 gb|ESR65363.1| hypothetical protein CICLE_v10008955mg [Citrus clementina]
 gb|KDO74399.1| hypothetical protein CISIN_1g021190mg [Citrus sinensis]
Length=316

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  742  NNDHsppsnssseNAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPEL  563
            N++H+   +  + +  +   PK AI+AFK L E+ AAQ+VVASIA DP VWNAV+ N  L
Sbjct  143  NSEHTETKSCITYDLKSASVPKPAIQAFKLLSESPAAQSVVASIACDPAVWNAVVKNDAL  202

Query  562  QEFLVSQKT  536
             EF+ SQKT
Sbjct  203  VEFVQSQKT  211


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 9/83 (11%)
 Frame = -2

Query  369  SEDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTS-----V  205
            +E+ S   G+   D L+ IK  V+DM+N ++ F QN+FG    FA AD ++  +      
Sbjct  236  TENQSADSGSFPMDVLETIKNKVVDMVNNVTGFLQNIFG----FAAADKTSSEADAGGFT  291

Query  204  VDRALGASFMGLAIMAIMVVVLK  136
            +D+ LG +F GLA+M I+VV+LK
Sbjct  292  IDKTLGTAFTGLAMMVIVVVLLK  314



>ref|XP_006401561.1| hypothetical protein EUTSA_v10014255mg [Eutrema salsugineum]
 gb|ESQ43014.1| hypothetical protein EUTSA_v10014255mg [Eutrema salsugineum]
Length=292

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            A+    P+ A++AF FL ENAAAQ+VVASIASDP VW+AV+ N +L +FL +  T
Sbjct  141  AVESAVPQVALQAFAFLSENAAAQSVVASIASDPKVWDAVMENKDLMKFLETNNT  195



>ref|XP_010520882.1| PREDICTED: uncharacterized protein LOC104799894 [Tarenaya hassleriana]
Length=320

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            PK A++AF FL E+ AAQ+VVASIASDP VW+AV+ N +L EFL S KT
Sbjct  166  PKVALQAFAFLSESPAAQSVVASIASDPKVWDAVMENKDLVEFLESNKT  214



>ref|XP_008359297.1| PREDICTED: uncharacterized protein LOC103423006 [Malus domestica]
Length=312

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            PKHA+RAF+ L +++ AQ VVASIASDPN+WNA++ N E+++F+ ++
Sbjct  167  PKHALRAFEMLSQSSEAQNVVASIASDPNIWNAMMENSEVKQFMANK  213



>gb|KJB81865.1| hypothetical protein B456_013G165300 [Gossypium raimondii]
Length=316

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            PK A++AFK L E+ A Q++VASIA+DPNVWNAVL NP   +F+ S KT+ +
Sbjct  165  PKPAVQAFKLLNESPAVQSMVASIAADPNVWNAVLHNPAYMDFIGSHKTNYI  216


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = -2

Query  345  GNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLA  166
            GN F++FL+N+K +V+++ N  +DF Q+LF       + +     + +++ +GAS MGLA
Sbjct  246  GNPFSEFLENLKSSVVEVANKATDFLQSLFTIPTAGMEKENGG-LNYLEKTIGASLMGLA  304

Query  165  IMAIMVVVLK  136
            +M IMVV+LK
Sbjct  305  VMVIMVVLLK  314



>gb|KHG00183.1| hypothetical protein F383_20411 [Gossypium arboreum]
Length=316

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            PK A++AFK L E+ A Q++VASIA+DPNVWNAVL NP   +F+ S KT+ +
Sbjct  165  PKPAVQAFKLLNESPAVQSMVASIAADPNVWNAVLHNPAYMDFIGSHKTNYI  216


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -2

Query  345  GNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRALGASFMGLA  166
            GN F++FL+N+K +V+++ N  +DF Q LF       + +     + +++ +GAS MGLA
Sbjct  246  GNPFSEFLENLKSSVVEVANKATDFLQCLFTIPTAGMEKENGG-LNYLEKTIGASLMGLA  304

Query  165  IMAIMVVVLK  136
            +M IMVV+LK
Sbjct  305  VMVIMVVLLK  314



>ref|XP_010443028.1| PREDICTED: uncharacterized protein LOC104725975 [Camelina sativa]
Length=305

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            A+    P+ A++AF FL EN AAQTVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  154  AVESAVPQAALQAFAFLSENTAAQTVVASIACDPKVWDAVMENKDLMKFLKTNNTA  209



>gb|KHN38595.1| hypothetical protein glysoja_040149 [Glycine soja]
Length=246

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            APKHAI+AF  L  +  AQ VVAS+A DPNVWNAV+ NP +  F  SQ++
Sbjct  77   APKHAIQAFHLLSTSREAQAVVASLACDPNVWNAVMENPAVSSFFQSQQS  126


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 13/96 (14%)
 Frame = -2

Query  393  SPRNDDLTSEDGSPKPGNG---FTDFLQNIKVAVLDMMNCLSDFFQNLFG-----GHKVF  238
            SP    +++E     PGNG   F D LQN+K+ V+++++ +S F QN+F        K+ 
Sbjct  152  SPEKLGVSAES---HPGNGIFDFMDLLQNVKLTVIELVSRVSGFLQNIFPPPDAMKEKMS  208

Query  237  ADADGSAKTSVVDR--ALGASFMGLAIMAIMVVVLK  136
             D DG+ K S +D   ++G +F GLAI+ IMV+V K
Sbjct  209  GDVDGNTKASFMDSKISMGGTFTGLAIIVIMVIVTK  244



>ref|XP_003539571.1| PREDICTED: uncharacterized protein LOC100795500 isoform X1 [Glycine 
max]
Length=274

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            AP  A++AF+ L E+  AQ+VVASIA DPN+WNA+  NP LQ+F  S +T+
Sbjct  123  APNRALQAFQLLSESPEAQSVVASIACDPNIWNAIAQNPTLQDFFQSHQTA  173



>ref|XP_009119980.1| PREDICTED: uncharacterized protein LOC103844909 [Brassica rapa]
Length=289

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFL  551
            A+    P+ A++AF FL EN AAQ+VVASIASDP VW+AV+ N +L +FL
Sbjct  139  AVESAVPQVALKAFAFLSENTAAQSVVASIASDPKVWDAVMENKDLMKFL  188



>ref|XP_006592890.1| PREDICTED: uncharacterized protein LOC100795500 isoform X2 [Glycine 
max]
Length=258

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            AP  A++AF+ L E+  AQ+VVASIA DPN+WNA+  NP LQ+F  S +T+
Sbjct  107  APNRALQAFQLLSESPEAQSVVASIACDPNIWNAIAQNPTLQDFFQSHQTA  157



>gb|KHN27993.1| hypothetical protein glysoja_007725 [Glycine soja]
Length=275

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            AP  A++AF+ L E+  AQ+VVASIA DPN+WNA+  NP LQ+F  S +T+
Sbjct  124  APNRALQAFQLLSESPEAQSVVASIACDPNIWNAIAQNPTLQDFFQSHQTA  174



>emb|CDY42460.1| BnaA10g08360D [Brassica napus]
Length=293

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFL  551
            A+    P+ A++AF FL EN AAQ+VVASIASDP VW+AV+ N +L +FL
Sbjct  139  AVESAVPQVALKAFAFLSENTAAQSVVASIASDPKVWDAVMENKDLMKFL  188



>ref|XP_011048249.1| PREDICTED: uncharacterized protein LOC105142358 isoform X1 [Populus 
euphratica]
Length=326

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            PK+A++AF  L E+   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T+
Sbjct  165  PKYAMQAFSLLNESPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNTT  214


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = -2

Query  336  FTDFLQNIKVAVLDMMNCLSDFFQNLF----GGHKVFADADGSAKTSVVDRALGASFMGL  169
              D + N+K+ V+DM+  +S +FQ +F      H   A+    A T  +++ +GAS MGL
Sbjct  256  LVDIINNVKLTVVDMVTNVSAYFQKIFSFSSAEHTPAANERAGAAT--IEKTIGASLMGL  313

Query  168  AIMAIMVVVLK  136
            A++ IMVVVL+
Sbjct  314  AVIVIMVVVLR  324



>ref|XP_011048250.1| PREDICTED: uncharacterized protein LOC105142358 isoform X2 [Populus 
euphratica]
Length=325

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            PK+A++AF  L E+   QTVVA++ASDPNVWNAV  N  LQ+FL SQ T
Sbjct  165  PKYAMQAFSLLNESPKIQTVVAAVASDPNVWNAVWENEALQDFLQSQNT  213


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = -2

Query  336  FTDFLQNIKVAVLDMMNCLSDFFQNLF----GGHKVFADADGSAKTSVVDRALGASFMGL  169
              D + N+K+ V+DM+  +S +FQ +F      H   A+    A T  +++ +GAS MGL
Sbjct  255  LVDIINNVKLTVVDMVTNVSAYFQKIFSFSSAEHTPAANERAGAAT--IEKTIGASLMGL  312

Query  168  AIMAIMVVVLK  136
            A++ IMVVVL+
Sbjct  313  AVIVIMVVVLR  323



>ref|XP_002864339.1| hypothetical protein ARALYDRAFT_495534 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40598.1| hypothetical protein ARALYDRAFT_495534 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            A+    P+ A++AF FL EN AAQTVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  146  AVESAVPQVALQAFAFLSENTAAQTVVASIACDPKVWDAVMENKDLMKFLQTNNTA  201



>ref|XP_010482859.1| PREDICTED: uncharacterized protein LOC104761470 [Camelina sativa]
Length=306

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            A+    P+ A++AF FL EN AAQTVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  155  AVESPVPQVALQAFAFLSENTAAQTVVASIACDPKVWDAVMENKDLMKFLKTNNTA  210



>gb|AFK40032.1| unknown [Lotus japonicus]
Length=324

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            PKHAI+AF+ L  ++  QTVVASIASD NVW AV+ NP +  F  SQ+T
Sbjct  165  PKHAIQAFELLSASSEVQTVVASIASDSNVWKAVMQNPAVSSFFQSQQT  213


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 9/92 (10%)
 Frame = -2

Query  384  NDDLTSEDGSPKPGNG----FTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADAD  226
            +DD  +    P+  +G    F   LQN+K+ V +M++ +S++ QN+F      K   DAD
Sbjct  231  DDDTVTGSEEPEIHSGIAFDFIGLLQNLKLTVAEMVSRVSNYLQNIFPTGEKEKSSGDAD  290

Query  225  GSAKTSVVDR--ALGASFMGLAIMAIMVVVLK  136
            G+ K +V+D    +G SFMGLA++ IMVV++K
Sbjct  291  GNTKANVMDNMNVMGGSFMGLAMLVIMVVLVK  322



>emb|CDY64929.1| BnaCnng45510D [Brassica napus]
Length=289

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFL  551
            A+    P+ A++AF FL EN AAQ+VV SIASDP VW+AV+ N +L +FL
Sbjct  139  AVESAVPQVALKAFAFLSENTAAQSVVTSIASDPKVWDAVMENKDLMKFL  188



>gb|AFK40544.1| unknown [Lotus japonicus]
Length=324

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            PKHAI+AF+ L  ++  QTVVASIASD NVW AV+ NP +  F  SQ+T
Sbjct  165  PKHAIQAFELLSASSEVQTVVASIASDSNVWKAVMQNPAVNSFFQSQQT  213


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 55/92 (60%), Gaps = 9/92 (10%)
 Frame = -2

Query  384  NDDLTSEDGSPKPGNG----FTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADAD  226
            +DD  +    P+  +G    F   LQN+K+ V +M++ +S++ QN+F      K   D D
Sbjct  231  DDDTVTGSEEPEIHSGIAFDFIGLLQNLKLTVAEMVSRVSNYLQNIFPTGEKEKSSGDTD  290

Query  225  GSAKTSVVD--RALGASFMGLAIMAIMVVVLK  136
            G+ K +V+D    +G SFMGLA++ IMVV++K
Sbjct  291  GNTKANVMDSMNVMGGSFMGLAMLVIMVVLVK  322



>ref|XP_003527303.2| PREDICTED: uncharacterized protein LOC100782462 [Glycine max]
Length=316

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 10/81 (12%)
 Frame = -2

Query  348  PGNGFTDF---LQNIKVAVLDMMNCLSDFFQNLFGG-----HKVFADADGSAKTSVVDR-  196
            PGN F DF   LQN+K+ V+++++ LS F QN+F        K+  DADG+ K S +D  
Sbjct  234  PGNMFDDFMGLLQNVKLTVIELVSRLSGFLQNIFPTPDAMREKMSFDADGNTKASFMDSK  293

Query  195  -ALGASFMGLAIMAIMVVVLK  136
             ++G +F+GLA++ IMV+V K
Sbjct  294  ISMGGTFIGLAVLVIMVIVTK  314


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            APKHAI+AF  L  +  AQ VVAS+A DPNVWNAV+ N  +  F  SQ++
Sbjct  147  APKHAIQAFHLLSTSREAQAVVASLACDPNVWNAVMENSAVSSFFQSQQS  196



>gb|KJB45630.1| hypothetical protein B456_007G317200 [Gossypium raimondii]
Length=317

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  694  AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            A   PK AI+AFK L E+ A Q+VVASIASDP+VW+AVL N    +F+ SQ+T
Sbjct  169  ATSVPKPAIQAFKLLNESPAVQSVVASIASDPHVWDAVLNNSAYMDFIKSQQT  221


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = -2

Query  366  EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRALG  187
            EDG    G  F+ F+Q IK +V++M++  +DF  +LF    V   A  +A ++ +D+ +G
Sbjct  244  EDG----GESFSAFIQKIKTSVVEMVSKTTDFLHSLFSLPSV-DKAKENAGSNNMDKTIG  298

Query  186  ASFMGLAIMAIMVVVLK  136
            AS MGLA+M IMVV++K
Sbjct  299  ASLMGLAVMVIMVVLVK  315



>ref|XP_006280901.1| hypothetical protein CARUB_v10026894mg [Capsella rubella]
 gb|EOA13799.1| hypothetical protein CARUB_v10026894mg [Capsella rubella]
Length=291

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            P+ A++AF FL EN AAQTVVASIA DP VW+AV+ N +L +FL +  T+
Sbjct  149  PQVALQAFSFLSENTAAQTVVASIACDPKVWDAVMENKDLMKFLQTNNTA  198



>gb|AGV54826.1| hypothetical protein [Phaseolus vulgaris]
Length=309

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            P HAI+AF  L  +  AQ VVAS+ASDPNVWNAV+ NP +  F  SQ+T
Sbjct  149  PNHAIQAFNLLSTSHEAQAVVASLASDPNVWNAVMENPAVYRFFQSQQT  197


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 7/70 (10%)
 Frame = -2

Query  336  FTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADADGSAKTSVVDRALGASFMGLA  166
            F  FLQN+K+ V ++++ +SDF QN+F      K+  DA G+ K ++    +G +FMGLA
Sbjct  242  FIGFLQNLKLTVTELVSSVSDFLQNIFPSPDTQKMAGDAVGNNKANL----MGGTFMGLA  297

Query  165  IMAIMVVVLK  136
            ++ IMV+V K
Sbjct  298  VLVIMVIVTK  307



>gb|KHN36752.1| hypothetical protein glysoja_001483 [Glycine soja]
Length=259

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  676  HAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
             A++AF+ L E   AQ+VVASIA DPN+WNA++ NP LQ+F  SQ+T+
Sbjct  111  RALQAFQLLSECPEAQSVVASIACDPNIWNAIVQNPALQDFFQSQQTA  158


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (65%), Gaps = 6/71 (8%)
 Frame = -2

Query  330  DFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFA--DADGSAKTSVVDR-ALGASFMGL  169
            + LQN+K  V +M++ + ++ QN+FG   G    A  DA G+ K + +D   +G +FMGL
Sbjct  187  NVLQNVKFTVSEMLSRVPNYLQNMFGFLSGQTSSAVIDARGNTKANFMDPITMGGTFMGL  246

Query  168  AIMAIMVVVLK  136
            A++ +MV++LK
Sbjct  247  AVLVVMVIMLK  257



>ref|XP_006594801.1| PREDICTED: uncharacterized protein LOC100779229 [Glycine max]
Length=282

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  676  HAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
             A++AF+ L E   AQ+VVASIA DPN+WNA++ NP LQ+F  SQ+T+
Sbjct  134  RALQAFQLLSECPEAQSVVASIACDPNIWNAIVQNPALQDFFQSQQTA  181


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (65%), Gaps = 6/71 (8%)
 Frame = -2

Query  330  DFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFA--DADGSAKTSVVDR-ALGASFMGL  169
            + LQN+K  V +M++ + ++ QN+FG   G    A  DA G+ K + +D   +G +FMGL
Sbjct  210  NVLQNVKFTVSEMLSRVPNYLQNMFGFLSGQTSSAVIDARGNTKANFIDPITMGGTFMGL  269

Query  168  AIMAIMVVVLK  136
            A++ +MV++LK
Sbjct  270  AVLVVMVIMLK  280



>ref|XP_009127082.1| PREDICTED: uncharacterized protein LOC103851954 [Brassica rapa]
Length=296

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            A+    P+ A+ AF FL E++AAQ+VVASIASDP VW+AV+ N +L +FL +  T+
Sbjct  143  AVESAVPQVALNAFAFLSESSAAQSVVASIASDPKVWDAVMENSDLMKFLDTNTTA  198



>ref|XP_004294319.1| PREDICTED: uncharacterized protein LOC101314638 [Fragaria vesca 
subsp. vesca]
Length=313

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQK  539
            P+HA +AF+ L  +  AQ VVASIASDPNVWNA++ N  +++F+ SQK
Sbjct  163  PQHAYKAFELLSRSPEAQNVVASIASDPNVWNAMIENSAVKQFMESQK  210



>ref|XP_007133044.1| hypothetical protein PHAVU_011G146700g [Phaseolus vulgaris]
 gb|ESW05038.1| hypothetical protein PHAVU_011G146700g [Phaseolus vulgaris]
Length=309

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            P HAI+AF  L  +  AQ VVAS+ASDPNVWNAV+ NP +  F  SQ+T
Sbjct  149  PNHAIQAFNLLSTSHEAQAVVASLASDPNVWNAVMENPVVYRFFQSQQT  197


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 7/70 (10%)
 Frame = -2

Query  336  FTDFLQNIKVAVLDMMNCLSDFFQNLFGG---HKVFADADGSAKTSVVDRALGASFMGLA  166
            F  FLQN+K+ V ++++ +SDF QN+F      K+  DA G+ K ++    +G +FMGLA
Sbjct  242  FIGFLQNLKLTVTELVSSVSDFLQNIFPSPDTQKMAGDAVGNNKANL----MGGTFMGLA  297

Query  165  IMAIMVVVLK  136
            ++ IMV+V K
Sbjct  298  VLVIMVIVTK  307



>ref|XP_007211764.1| hypothetical protein PRUPE_ppa009590mg [Prunus persica]
 gb|EMJ12963.1| hypothetical protein PRUPE_ppa009590mg [Prunus persica]
Length=285

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQK  539
            PKHA +AF+ L  +  AQ VVASIASDPN+WNA++ N  +++FL S K
Sbjct  165  PKHAFQAFEMLSRSTEAQNVVASIASDPNIWNAMMENSAVKQFLKSNK  212



>ref|XP_008226793.1| PREDICTED: uncharacterized protein LOC103326356 [Prunus mume]
Length=313

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            PKHA +AF+ L  +  AQ VVASIASDPN+WNA++ N  +++FL S K   L
Sbjct  165  PKHAFQAFEMLSRSTEAQNVVASIASDPNIWNAMMENSAVKQFLESNKNYKL  216



>emb|CDY68666.1| BnaAnng27970D [Brassica napus]
Length=228

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            A+    P+ ++ AF FL E++AAQ+VVASIASDP VW+AV+ N +L +FL +  T+
Sbjct  75   AVESAVPQVSLNAFAFLSESSAAQSVVASIASDPKVWDAVMENNDLMKFLDTNTTA  130



>ref|XP_008813171.1| PREDICTED: uncharacterized protein LOC103723874 [Phoenix dactylifera]
Length=342

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
             P H I+ F  L  N  AQ VVASIASD NVWNAV+ NP+++EF  +Q++ +L
Sbjct  198  TPNHVIQMFSLLQGNPEAQNVVASIASDENVWNAVMNNPKVKEFYKTQQSVVL  250



>emb|CDY63696.1| BnaCnng42470D [Brassica napus]
Length=358

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            A+    P+ A+ AF FL E++AAQ+VVASIASDP VW+AV+ N +L +FL +  T+
Sbjct  205  AVESAVPQVALNAFAFLSESSAAQSVVASIASDPKVWDAVMENNDLMKFLDTNTTA  260



>gb|AFK42977.1| unknown [Medicago truncatula]
Length=241

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  679  KHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            KHAI AF+ L  +  AQTVV SIA DPN+WNAV+ NP +  F  SQ
Sbjct  155  KHAIHAFQLLSSSVEAQTVVQSIACDPNIWNAVMQNPAVTSFFESQ  200



>gb|KEH30768.1| transmembrane protein, putative [Medicago truncatula]
Length=305

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  679  KHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            KHAI AF+ L  +  AQTVV SIA DPN+WNAV+ NP +  F  SQ
Sbjct  155  KHAIHAFQLLSSSVEAQTVVQSIACDPNIWNAVMQNPAVTSFFESQ  200


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 8/72 (11%)
 Frame = -2

Query  336  FTDFLQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADADGSAKTSVVD--RALGASFMG  172
            F   LQN+K+ V +M++ +S+FFQN+F      K  ADADG    S +D    +G SFMG
Sbjct  235  FMGILQNLKLTVTEMVSRMSNFFQNIFPTVEKDKSSADADGG---SFMDYKNVMGTSFMG  291

Query  171  LAIMAIMVVVLK  136
            LA+M IMVV++K
Sbjct  292  LAVMVIMVVLMK  303



>ref|XP_011095782.1| PREDICTED: uncharacterized protein LOC105175132 [Sesamum indicum]
Length=198

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -1

Query  664  AFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  554
            AF+FLYE++AAQ VVASIA D NVWNAVL N ELQ F
Sbjct  155  AFQFLYESSAAQDVVASIACDQNVWNAVLHNQELQGF  191



>ref|XP_010928579.1| PREDICTED: uncharacterized protein LOC105050305 isoform X2 [Elaeis 
guineensis]
Length=308

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            P +AI+ F  L  N  AQ VVASIASD NVWNAV+ NP++++F  +Q++ +L
Sbjct  156  PNYAIQMFSLLQGNPKAQNVVASIASDENVWNAVMNNPKVKQFYETQQSMVL  207



>ref|XP_009355556.1| PREDICTED: uncharacterized protein LOC103946557 [Pyrus x bretschneideri]
Length=312

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            PKHA+ AF+ L  ++ AQ VVASIASDPN+WNA++ N  +++F+ ++
Sbjct  167  PKHALHAFEMLSRSSEAQNVVASIASDPNIWNAMMENSAVKQFMANK  213



>gb|KJB45631.1| hypothetical protein B456_007G317200 [Gossypium raimondii]
Length=315

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = -2

Query  366  EDGSPKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKTSVVDRALG  187
            EDG    G  F+ F+Q IK +V++M++  +DF  +LF    V   A  +A ++ +D+ +G
Sbjct  242  EDG----GESFSAFIQKIKTSVVEMVSKTTDFLHSLFSLPSV-DKAKENAGSNNMDKTIG  296

Query  186  ASFMGLAIMAIMVVVLK  136
            AS MGLA+M IMVV++K
Sbjct  297  ASLMGLAVMVIMVVLVK  313


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -1

Query  694  AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            A   PK AI+AFK L E+ A  +VVASIASDP+VW+AVL N    +F+ SQ+T
Sbjct  169  ATSVPKPAIQAFKLLNESPA--SVVASIASDPHVWDAVLNNSAYMDFIKSQQT  219



>ref|XP_010928571.1| PREDICTED: uncharacterized protein LOC105050305 isoform X1 [Elaeis 
guineensis]
Length=312

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            P +AI+ F  L  N  AQ VVASIASD NVWNAV+ NP++++F  +Q++
Sbjct  156  PNYAIQMFSLLQGNPKAQNVVASIASDENVWNAVMNNPKVKQFYETQQS  204



>ref|XP_002443952.1| hypothetical protein SORBIDRAFT_07g004990 [Sorghum bicolor]
 gb|EES13447.1| hypothetical protein SORBIDRAFT_07g004990 [Sorghum bicolor]
Length=313

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 8/93 (9%)
 Frame = -2

Query  393  SPRN-DDLTSEDGS----PKPGNGFTDFLQNIKVAVLDMMNCLSDFFQNLF--GGHKVFA  235
            SP N +D TSE+ S    P  G+ F+DF+ N K  V+D++  ++DFF++LF   G +  A
Sbjct  220  SPGNFEDATSENASNTELPT-GSPFSDFVDNAKKRVMDVIYNITDFFKDLFDSAGAQDGA  278

Query  234  DADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
                    S  + ALG SFM LAI  I+VV+LK
Sbjct  279  GPSAEKGPSAAEMALGGSFMALAIGVILVVLLK  311


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            AI    P H ++AF  L  +  AQ+VVAS+ASD NVW AVL N ++ EF  + +T+++
Sbjct  151  AIIPSMPGHVVQAFTLLKSSPEAQSVVASLASDRNVWEAVLKNEKVMEFYKNHQTTLV  208



>gb|ACJ85791.1| unknown [Medicago truncatula]
Length=70

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 8/68 (12%)
 Frame = -2

Query  324  LQNIKVAVLDMMNCLSDFFQNLFG---GHKVFADADGSAKTSVVD--RALGASFMGLAIM  160
            LQN+K+ V +M++ +S+FFQN+F      K  ADADG    S +D    +G SFMGLA+M
Sbjct  4    LQNLKLTVTEMVSRMSNFFQNIFPTVEKDKSSADADGG---SFMDYKNVMGTSFMGLAVM  60

Query  159  AIMVVVLK  136
             IMVV++K
Sbjct  61   VIMVVLMK  68



>ref|XP_002530913.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31462.1| conserved hypothetical protein [Ricinus communis]
Length=58

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -2

Query  294  MMNCLSDFFQNLFG---GHKVFADADGSAKTSVVDRALGASFMGLAIMAIMVVVLK  136
            M+N +S F Q +FG      + A AD +A+ S +D+ + ASFM LA+M IMVVVLK
Sbjct  1    MVNNVSTFVQQIFGYSPADNISAAADANARPSFIDKTMAASFMALAVMVIMVVVLK  56



>gb|ACF82614.1| unknown [Zea mays]
Length=161

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+
Sbjct  2    PGHVVQAFTLLKSSTEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTT  51


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = -2

Query  381  DDLTSEDGSPK-----PGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG-GHKVFADADGS  220
            +D TSE+ S        G  F DF+ N K  V+D+++ ++DFF++LF    +    A  S
Sbjct  70   EDATSENASNSELPTGSGASFADFVDNAKKKVMDVVHNITDFFRDLFNDSAEAQTGAGPS  129

Query  219  AKT--SVVDRALGASFMGLAIMAIMVVVLK  136
            A+   S  + A+G SFM L I  I+VV+ K
Sbjct  130  AEKGFSATEMAVGGSFMALTIAVILVVLFK  159



>ref|XP_004987122.1| PREDICTED: uncharacterized protein LOC101758268 [Setaria italica]
Length=224

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  694  AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  554
            A G P   ++AF  L+EN  AQ VVAS+ASD NVW+AV+ N ++ +F
Sbjct  70   ASGTPGRVVQAFTLLHENPEAQDVVASLASDKNVWDAVMKNEKVLKF  116



>gb|EMT06766.1| hypothetical protein F775_27558 [Aegilops tauschii]
Length=251

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -1

Query  748  QVNNDHsppsnssseNAIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANP  569
            +V  +H    +    +A+    P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N 
Sbjct  74   EVVKEHDQELSKLGADALIPAMPGHVVQAFTLLKSSPEAQSVVASLASDKNVWDAVLKNE  133

Query  568  ELQEFLVSQKTSML  527
             + EF  S + +++
Sbjct  134  RVMEFYKSHQQTLV  147



>ref|XP_004972711.1| PREDICTED: uncharacterized protein LOC101763830 [Setaria italica]
Length=310

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            AI    P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+++
Sbjct  152  AIIPSMPGHVVQAFTLLKSSPEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTLV  209



>gb|ABR26041.1| unknown [Oryza sativa Indica Group]
Length=168

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            AI    P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S++
Sbjct  21   AIIPAMPGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV  78



>ref|XP_008678238.1| PREDICTED: uncharacterized protein LOC103653035 [Zea mays]
 gb|AFW61103.1| hypothetical protein ZEAMMB73_425084 [Zea mays]
Length=314

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+++
Sbjct  154  PGHVVQAFTLLKSSTEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTTLV  205


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 22/83 (27%)
 Frame = -2

Query  345  GNGFTDFLQNIKVAVLDMMNCLSDFFQNLFGGHKVFADADGSAKT-------------SV  205
            G  F+DF+ N K  V+D+++ ++DFF++LF         D SAKT             S+
Sbjct  239  GLSFSDFVDNAKKTVMDVVHNITDFFKDLF---------DDSAKTQTGAGPSAAEKGPSM  289

Query  204  VDRALGASFMGLAIMAIMVVVLK  136
             D A+G SFM LAI  I+VV+ K
Sbjct  290  ADMAVGGSFMALAIAVILVVMFK  312



>ref|XP_004985312.1| PREDICTED: uncharacterized protein LOC101783230 [Setaria italica]
Length=310

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  694  AHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  530
            A G P   ++AF  L+EN  AQ VVAS+ASD NVW+AV+ N ++ +F  + ++ +
Sbjct  148  ASGTPGRVVQAFTLLHENPEAQDVVASLASDKNVWDAVMKNEKVLKFYKTYESKL  202



>ref|NP_001144178.1| uncharacterized protein LOC100277035 [Zea mays]
 gb|ACG38484.1| hypothetical protein [Zea mays]
Length=315

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            AI    P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+
Sbjct  150  AIIPSMPGHVVQAFTLLKSSTEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTT  205



>gb|AFW56882.1| hypothetical protein ZEAMMB73_730622 [Zea mays]
Length=315

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            AI    P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T+
Sbjct  150  AIIPSMPGHVVQAFTLLKSSTEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQTT  205



>gb|EAY88928.1| hypothetical protein OsI_10413 [Oryza sativa Indica Group]
Length=327

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  530
            ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F  +  T +
Sbjct  174  VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFYKTYATKL  229



>gb|AFW56883.1| hypothetical protein ZEAMMB73_730622 [Zea mays]
Length=313

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKT  536
            AI    P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N ++ EF  + +T
Sbjct  150  AIIPSMPGHVVQAFTLLKSSTEAQSVVASLASDRNVWDAVLKNEKVMEFYKTHQT  204



>ref|NP_001049294.1| Os03g0201000 [Oryza sativa Japonica Group]
 gb|ABF94496.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11208.1| Os03g0201000 [Oryza sativa Japonica Group]
 dbj|BAG91353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=327

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  530
            ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F  +  T +
Sbjct  174  VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFYKTYATKL  229



>gb|EEE58521.1| hypothetical protein OsJ_09808 [Oryza sativa Japonica Group]
Length=279

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  530
            ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F  +  T +
Sbjct  126  VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFYKTYATKL  181



>gb|EEE68150.1| hypothetical protein OsJ_26259 [Oryza sativa Japonica Group]
Length=143

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S++
Sbjct  2    PGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV  53



>gb|ABF94497.1| expressed protein [Oryza sativa Japonica Group]
Length=288

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -1

Query  697  IAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSM  530
            ++ GAP   ++AF  L ++  AQ VVAS+ASD NVWNAV+ N ++ +F  +  T +
Sbjct  135  VSSGAPGRVVQAFTMLQDSPEAQEVVASLASDQNVWNAVMRNEKVMKFYKTYATKL  190



>ref|XP_006659890.1| PREDICTED: uncharacterized protein LOC102713016 [Oryza brachyantha]
Length=236

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            AI    P H ++AF  L  +  AQ VVAS+ASD NVW AVL N ++ EF  + + S++
Sbjct  75   AIIPAMPGHVVQAFTLLKSSPEAQGVVASLASDKNVWEAVLKNEKVMEFYKTHQQSLV  132



>ref|XP_008365896.1| PREDICTED: uncharacterized protein LOC103429531 [Malus domestica]
Length=307

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  682  PKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            PKHA+ AF+ L   + AQ VVASI SDPN+W A++ N  +++F+ ++
Sbjct  162  PKHALHAFEMLSRCSEAQNVVASITSDPNIWXAMMENSAVKQFMANK  208



>gb|EAZ05807.1| hypothetical protein OsI_28043 [Oryza sativa Indica Group]
Length=240

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            AI    P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S++
Sbjct  93   AIIPAMPGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV  150



>dbj|BAJ88294.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00328.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK05236.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            A+    P H ++AF  L  +  AQ+VVAS+ASD NVW+AVL N  + EF  S + +++
Sbjct  143  ALIPAMPGHVVQAFTLLKSSPEAQSVVASLASDKNVWDAVLKNERVMEFYRSHQQTLI  200



>ref|XP_003573409.1| PREDICTED: uncharacterized protein LOC100845511 [Brachypodium 
distachyon]
Length=313

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            AI    P H ++AF  L  ++ AQ+VVAS+ASD NVW+AVL N  + EF  + + +++
Sbjct  148  AIIPAMPGHVVQAFTLLKSSSEAQSVVASLASDKNVWDAVLKNERVMEFYKNHQQTLV  205



>gb|KJB45632.1| hypothetical protein B456_007G317300 [Gossypium raimondii]
Length=368

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  685  APKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQ  542
            APK AI+AFK L E+A  Q+VV+SI +DPNV NAVL N    +F+  Q
Sbjct  159  APKPAIQAFKLLSESADVQSVVSSIVADPNVRNAVLNNSAYMDFIQYQ  206



>ref|NP_001061135.1| Os08g0179900 [Oryza sativa Japonica Group]
 dbj|BAD17035.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23049.1| Os08g0179900 [Oryza sativa Japonica Group]
Length=300

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEFLVSQKTSML  527
            AI    P H ++AF  L  +  AQ VVAS+ASD NVW+AVL N ++ EF  + + S++
Sbjct  153  AIIPAMPGHVMQAFTLLKSSPEAQGVVASLASDKNVWDAVLKNEKVMEFYKTHQQSLV  210



>ref|XP_009393345.1| PREDICTED: uncharacterized protein LOC103979052 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  554
            +I    P+H +  F  L  +   QTVVASIASD NVWNAV  N ++ EF
Sbjct  160  SIIPSMPRHVVETFSLLQRSPEVQTVVASIASDENVWNAVTKNEKVMEF  208



>gb|ACF80671.1| unknown [Zea mays]
Length=118

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = -2

Query  381  DDLTSEDGSPK-----PGNGFTDFLQNIKVAVLDMMNCLSDFFQNLFG-GHKVFADADGS  220
            +D TSE+ S        G  F DF+ N K  V+D+++ ++DFF++LF    +    A  S
Sbjct  27   EDATSENASNSELPTGSGASFADFVDNAKKKVMDVVHNITDFFRDLFNDSAEAQTGAGPS  86

Query  219  AKT--SVVDRALGASFMGLAIMAIMVVVLK  136
            A+   S  + A+G SFM L I  I+VV+ K
Sbjct  87   AEKGFSATEMAVGGSFMALTIAVILVVLFK  116



>dbj|BAK00216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -1

Query  700  AIAHGAPKHAIRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  554
            ++A G+    I AF  L ++  AQ VVAS+ASD NVW AV+ N +L EF
Sbjct  130  SVASGSSARVIEAFTMLQDSPEAQDVVASLASDKNVWEAVMKNKKLVEF  178



>gb|EMT30710.1| hypothetical protein F775_11491 [Aegilops tauschii]
Length=222

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -1

Query  670  IRAFKFLYENAAAQTVVASIASDPNVWNAVLANPELQEF  554
            I AF  L+E+  AQ VVAS+ASD NVW AV+ N +L EF
Sbjct  76   IEAFTMLHESPEAQDVVASLASDKNVWEAVMKNKKLVEF  114



>ref|XP_007149673.1| hypothetical protein PHAVU_005G0894000g, partial [Phaseolus vulgaris]
 gb|ESW21667.1| hypothetical protein PHAVU_005G0894000g, partial [Phaseolus vulgaris]
Length=87

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  628  TVVASIASDPNVWNAVLANPELQEFLVSQKTS  533
            +VVASIA DPN+WNA++ NP+LQ+F+ +Q+T+
Sbjct  1    SVVASIACDPNIWNAMVKNPKLQDFVDAQQTA  32



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730