BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029D11

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFH57997.1|  chloroplast PsbO1 precursor                             338   2e-112   Nicotiana benthamiana
ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    338   3e-112   Nicotiana tomentosiformis
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    337   6e-112   Nicotiana sylvestris
gb|AFH57998.1|  chloroplast PsbO2 precursor                             337   6e-112   Nicotiana benthamiana
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    337   7e-112   Nicotiana benthamiana
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 336   2e-111   Morus notabilis
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      335   4e-111   Litchi chinensis [litchi]
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    335   4e-111   Ricinus communis
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    335   4e-111   Solanum tuberosum [potatoes]
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    335   5e-111   Populus euphratica
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         335   6e-111   Jatropha curcas
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            335   6e-111   Populus trichocarpa [western balsam poplar]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    335   6e-111   
emb|CAA29062.1|  unnamed protein product                                334   7e-111   Spinacia oleracea
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    335   7e-111   Cucumis sativus [cucumbers]
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    334   8e-111   Spinacia oleracea
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    334   1e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    334   1e-110   Eucalyptus grandis [rose gum]
gb|ABK96748.1|  unknown                                                 334   1e-110   Populus trichocarpa x Populus deltoides
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    334   1e-110   Nicotiana tomentosiformis
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    333   2e-110   Nicotiana sylvestris
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    333   2e-110   Nicotiana sylvestris
gb|AFH58000.1|  chloroplast PsbO4 precursor                             333   2e-110   Nicotiana benthamiana
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       333   2e-110   Genlisea aurea
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            333   4e-110   Populus trichocarpa [western balsam poplar]
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    332   6e-110   Populus euphratica
prf||1204192A  photosystem II protein 33kD                              329   6e-110
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    332   8e-110   Solanum tuberosum [potatoes]
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    332   9e-110   Cucumis melo [Oriental melon]
ref|NP_001240871.1|  uncharacterized protein LOC100811386               331   1e-109   Glycine max [soybeans]
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    331   2e-109   
gb|ADR71223.1|  chloroplast manganese stabilizing protein               330   2e-109   Solanum tuberosum [potatoes]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   330   3e-109   
gb|AEN02470.1|  oxygen-evolving enhancer protein                        330   4e-109   Camellia sinensis [black tea]
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    330   4e-109   Pisum sativum [garden pea]
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    330   5e-109   Glycine max [soybeans]
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           330   6e-109   Bruguiera gymnorhiza [Burma mangrove]
ref|NP_001241522.1|  uncharacterized protein LOC100820458               329   6e-109   Glycine max [soybeans]
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    329   7e-109   
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    329   7e-109   Vitis vinifera
gb|AFH57999.1|  chloroplast PsbO3 precursor                             329   8e-109   Nicotiana benthamiana
emb|CDP02430.1|  unnamed protein product                                329   8e-109   Coffea canephora [robusta coffee]
emb|CAN61828.1|  hypothetical protein VITISV_027630                     328   1e-108   Vitis vinifera
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    325   2e-108   
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    328   2e-108   Fritillaria agrestis
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    328   2e-108   
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    328   2e-108   Oryza brachyantha
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    328   2e-108   Solanum tuberosum [potatoes]
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   328   2e-108   Citrus sinensis [apfelsine]
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   328   2e-108   Medicago truncatula
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          328   3e-108   Saccharum hybrid cultivar [sugarcane]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          328   3e-108   Dimocarpus longan [longan]
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     328   3e-108   Solanum tuberosum [potatoes]
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             328   3e-108   Citrus clementina [clementine]
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         328   3e-108   
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    328   4e-108   Pyrus x bretschneideri [bai li]
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          327   5e-108   Amborella trichopoda
ref|NP_001140815.1|  hypothetical protein                               323   5e-108   
gb|AFK43771.1|  unknown                                                 327   6e-108   Lotus japonicus
ref|NP_001239736.1|  uncharacterized protein LOC100798485               327   8e-108   Glycine max [soybeans]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             327   8e-108   Phaseolus vulgaris [French bean]
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   325   8e-108   Citrus sinensis [apfelsine]
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    327   8e-108   Pyrus x bretschneideri [bai li]
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      328   9e-108   
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    327   1e-107   Pyrus x bretschneideri [bai li]
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             326   1e-107   Phaseolus vulgaris [French bean]
ref|NP_001130585.1|  uncharacterized protein LOC100191684               327   1e-107   Zea mays [maize]
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    326   1e-107   Brachypodium distachyon [annual false brome]
dbj|BAJ89638.1|  predicted protein                                      326   1e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       326   2e-107   Triticum urartu
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    326   2e-107   Prunus mume [ume]
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    326   2e-107   Elaeis guineensis
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             326   2e-107   Prunus persica
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             323   2e-107   Phaseolus vulgaris [French bean]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    326   2e-107   Setaria italica
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    326   2e-107   Fragaria vesca subsp. vesca
ref|NP_001043134.1|  Os01g0501800                                       326   2e-107   
gb|EEC70714.1|  hypothetical protein OsI_02088                          326   2e-107   Oryza sativa Indica Group [Indian rice]
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    326   2e-107   Phoenix dactylifera
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    326   2e-107   Malus domestica [apple tree]
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                      320   3e-107   Oryza sativa Indica Group [Indian rice]
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                      320   3e-107   Oryza sativa Indica Group [Indian rice]
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    325   4e-107   Helianthus annuus
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    325   4e-107   Salicornia europaea [chicken-claws]
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    325   4e-107   Vitis vinifera
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          324   6e-107   Leymus chinensis
gb|KJB43586.1|  hypothetical protein B456_007G208000                    324   1e-106   Gossypium raimondii
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               324   1e-106   Gossypium arboreum [tree cotton]
prf||2002393A  oxygen-evolving complex protein 1                        320   1e-106
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    323   1e-106   Tarenaya hassleriana [spider flower]
gb|ABK95838.1|  unknown                                                 317   1e-106   Populus trichocarpa [western balsam poplar]
emb|CAN79166.1|  hypothetical protein VITISV_019248                     323   2e-106   Vitis vinifera
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    320   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    322   3e-106   Tarenaya hassleriana [spider flower]
ref|XP_007047093.1|  Photosystem II subunit O-2                         323   4e-106   
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    321   1e-105   Arabis alpina [alpine rockcress]
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    321   2e-105   Phoenix dactylifera
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  320   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    320   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    320   2e-105   Brassica rapa
emb|CDX81388.1|  BnaC09g07990D                                          320   3e-105   
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             322   3e-105   
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             320   3e-105   Eutrema salsugineum [saltwater cress]
ref|XP_002877774.1|  photosystem II subunit O-2                         320   3e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    320   4e-105   Brassica rapa
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    320   4e-105   Brassica rapa
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    320   4e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    320   4e-105   Nelumbo nucifera [Indian lotus]
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      319   8e-105   Pinus sylvestris [Scotch pine]
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    319   9e-105   Brassica rapa
emb|CDY30764.1|  BnaC07g16640D                                          319   1e-104   Brassica napus [oilseed rape]
emb|CDY50981.1|  BnaC02g48890D                                          319   1e-104   Brassica napus [oilseed rape]
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    319   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             318   2e-104   Capsella rubella
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      318   2e-104   Phaseolus vulgaris [French bean]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        318   2e-104   Arabidopsis lyrata subsp. lyrata
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    318   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08257.1|  AT5g66570/K1F13_25                                      318   2e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         318   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|ACU19823.1|  unknown                                                 312   2e-104   Glycine max [soybeans]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       318   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    318   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    318   3e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             318   3e-104   Eutrema salsugineum [saltwater cress]
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    317   4e-104   Arabis alpina [alpine rockcress]
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            317   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    317   5e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    317   5e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    317   6e-104   Camelina sativa [gold-of-pleasure]
gb|ACN40581.1|  unknown                                                 317   1e-103   Picea sitchensis
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    316   1e-103   Camelina sativa [gold-of-pleasure]
gb|ACJ84218.1|  unknown                                                 310   1e-103   Medicago truncatula
gb|ABK24541.1|  unknown                                                 316   2e-103   Picea sitchensis
gb|KJB43585.1|  hypothetical protein B456_007G208000                    315   2e-103   Gossypium raimondii
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           316   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|ABK23365.1|  unknown                                                 316   2e-103   Picea sitchensis
gb|ABQ85434.1|  33 kDa OEC protein                                      306   3e-102   Salicornia veneta
gb|AAT65501.1|  photosystem II protein                                  313   4e-102   Brassica oleracea
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             311   5e-102   Eutrema salsugineum [saltwater cress]
emb|CDX72613.1|  BnaC07g46350D                                          311   8e-102   
gb|AFK46831.1|  unknown                                                 305   9e-102   Lotus japonicus
emb|CDY26519.1|  BnaC01g23800D                                          312   2e-101   Brassica napus [oilseed rape]
emb|CDY33308.1|  BnaA01g19750D                                          311   7e-101   Brassica napus [oilseed rape]
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             309   8e-101   Arabidopsis lyrata subsp. lyrata
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                309   9e-101   Erythranthe guttata [common monkey flower]
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   2e-100   Sesamum indicum [beniseed]
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    308   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    307   4e-100   Sesamum indicum [beniseed]
emb|CDY42709.1|  BnaA03g53620D                                          304   6e-99    Brassica napus [oilseed rape]
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    302   1e-98    
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    298   1e-96    Elaeis guineensis
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    294   5e-95    
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    293   1e-94    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    292   3e-94    
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        291   9e-94    Chara braunii
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     287   2e-93    Eucalyptus grandis [rose gum]
ref|XP_001763258.1|  predicted protein                                  288   1e-92    
ref|XP_001784751.1|  predicted protein                                  285   4e-92    
ref|XP_001781590.1|  predicted protein                                  284   4e-91    
ref|XP_001756893.1|  predicted protein                                  281   5e-90    
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            278   4e-89    Solanum tuberosum [potatoes]
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             278   6e-89    
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             278   6e-89    Selaginella moellendorffii
gb|AGI15761.1|  collinsiaXIII-like protein                              271   2e-88    Collinsia linearis
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    274   5e-88    Morus nigra
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             273   6e-88    
gb|AGI15739.1|  collinsiaXIII-like protein                              270   8e-88    Collinsia rattanii
gb|AGI15756.1|  collinsiaXIII-like protein                              270   1e-87    Collinsia linearis
gb|AGI15762.1|  collinsiaXIII-like protein                              266   2e-86    Collinsia linearis
gb|AGI15742.1|  collinsiaXIII-like protein                              266   2e-86    Collinsia rattanii
gb|AGI15740.1|  collinsiaXIII-like protein                              259   9e-84    Collinsia rattanii
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        261   1e-82    Oedogonium obesum
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        261   3e-82    Closterium peracerosum-strigosum-littorale complex
gb|ABR17376.1|  unknown                                                 256   3e-80    Picea sitchensis
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        252   6e-80    Allium cepa
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II        251   4e-79    Nephroselmis olivacea
gb|AAR85969.1|  ERT12                                                   246   5e-79    Nicotiana tabacum [American tobacco]
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1       249   2e-77    Gymnochlora stellata
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    248   2e-77    Micromonas pusilla CCMP1545
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          247   3e-77    Chlamydomonas incerta
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    248   3e-77    Ostreococcus lucimarinus CCE9901
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        246   1e-76    Hafniomonas montana
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    246   1e-76    Coccomyxa subellipsoidea C-169
gb|AAR20846.1|  oxygen-evolving enhancer protein 1                      241   2e-76    Pseudochlorella pringsheimii
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              244   4e-76    Chlorella variabilis
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             244   6e-76    Ostreococcus tauri
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...    243   1e-75    Micromonas commoda
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II        243   3e-75    Tetraselmis cordiformis
ref|XP_007513615.1|  predicted protein                                  243   5e-75    Bathycoccus prasinos
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    241   8e-75    Chlamydomonas reinhardtii
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    240   2e-74    Chlamydomonas reinhardtii
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    239   6e-74    Auxenochlorella protothecoides
gb|AAP79149.1|  photosystem II protein PsbO                             238   3e-73    Bigelowiella natans
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    235   1e-72    Volvox carteri f. nagariensis
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    235   1e-72    Volvox carteri
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II        235   4e-72    Chlorarachnion reptans
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      232   2e-71    Monoraphidium neglectum
gb|ADB07372.1|  chloroplast managanese stabilizing protein              231   5e-71    Capsicum annuum
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor           233   2e-70    Euglena gracilis
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...    231   2e-70    Euglena gracilis
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II        228   1e-69    Bryopsis plumosa
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II        229   1e-69    Eutreptiella gymnastica
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        223   1e-67    Pyramimonas parkeae
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II        222   8e-67    Lepidodinium chlorophorum
gb|KJB43587.1|  hypothetical protein B456_007G208000                    216   2e-65    Gossypium raimondii
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...    210   6e-63    Hapalosiphonaceae
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...    207   5e-62    Fischerella sp. PCC 9605
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   207   5e-62    
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...    207   8e-62    Fischerella muscicola
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...    206   1e-61    Fischerella muscicola
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...    206   2e-61    Oscillatoria sp. PCC 10802
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...    205   4e-61    Fischerella
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...    205   4e-61    Fischerella sp. PCC 9339
gb|AIR09396.1|  psbO                                                    201   6e-61    Trachelomonas abrupta
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...    203   2e-60    Oscillatoriales cyanobacterium JSC-12
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...    202   4e-60    Nostoc
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...    201   1e-59    Nostoc sp. PCC 7107
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    199   3e-59    Euglena stellata
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            201   3e-59    Solanum tuberosum [potatoes]
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    199   3e-59    Monomorphina pyrum
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    199   4e-59    Euglena pseudostellata
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor           199   1e-58    Nostoc sp. PCC 7120
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...    199   1e-58    Chlorogloeopsis fritschii
gb|ADC54897.1|  oxygen-evolving enhancer protein                        197   1e-58    Cladophora coelothrix
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...    198   2e-58    Tolypothrix campylonemoides
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    197   2e-58    Euglena granulata
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...    198   2e-58    Cylindrospermum stagnale
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                       198   3e-58    Porphyridium purpureum
ref|WP_010997995.1|  manganese-stabilzing protein                       197   3e-58    Nostocaceae
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...    197   3e-58    Trichormus variabilis
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...    198   3e-58    
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...    197   4e-58    Rivularia sp. PCC 7116
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...    197   5e-58    cyanobacterium PCC 7702
ref|WP_036480960.1|  Photosystem II manganese-stabilizing polypep...    197   5e-58    Myxosarcina sp. GI1
ref|WP_017286598.1|  hypothetical protein                               197   7e-58    Leptolyngbya boryana
gb|ACE98011.1|  putative protein                                        193   8e-58    Populus tremula [European aspen]
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    196   8e-58    Discoplastis spathirhyncha
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...    197   8e-58    Nostoc sp. PCC 7524
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...    196   1e-57    Calothrix sp. PCC 7507
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide        196   1e-57    Tolypothrix bouteillei VB521301
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...    196   1e-57    
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...    196   2e-57    Scytonema hofmannii
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...    196   2e-57    Crinalium epipsammum
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...    196   2e-57    Calothrix sp. PCC 7103
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...    195   2e-57    Dolichospermum circinale
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...    195   2e-57    Anabaena sp. PCC 7108
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...    195   3e-57    Calothrix sp. 336/3
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II    195   4e-57    Coccomyxa subellipsoidea C-169
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...    195   4e-57    Fortiea contorta
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...    195   5e-57    Gloeocapsa sp. PCC 7428
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...    194   5e-57    
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...    194   6e-57    Calothrix parietina
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...    194   7e-57    Cyanothece sp. PCC 7425
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...    194   7e-57    Mastigocladopsis repens
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)     193   7e-57    Nodularia spumigena CCY9414
gb|ABV57472.1|  chloroplast PsbO                                        190   9e-57    Phyllostachys edulis [kikko-chiku]
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...    194   1e-56    Nodularia spumigena
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...    193   2e-56    Synechococcus sp. PCC 6312
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...    193   2e-56    [Scytonema hofmanni] UTEX B 1581
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...    193   2e-56    Neosynechococcus sphagnicola
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    192   2e-56    Cryptoglena skujai
emb|CBI19622.3|  unnamed protein product                                192   2e-56    Vitis vinifera
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...    192   3e-56    Nostocales
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...    192   3e-56    Dolichospermum circinale
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                       194   4e-56    Dixoniella grisea
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...    192   6e-56    Aphanizomenon flos-aquae
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...    191   9e-56    Aphanizomenonaceae
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...    191   1e-55    Synechocystis sp. PCC 7509
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...    191   1e-55    Thermosynechococcus sp. NK55a
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...    191   2e-55    [Leptolyngbya] sp. JSC-1
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...    190   3e-55    Cyanobacterium aponinum
emb|CCH65457.1|  Photosystem II manganese-stabilizing protein (PsbO)    187   3e-55    Richelia intracellularis HM01
ref|WP_044259457.1|  Photosystem II manganese-stabilizing protein...    188   3e-55    
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...    190   3e-55    Trichormus azollae
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...    190   4e-55    Kamptonema
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...    190   4e-55    Microcoleus sp. PCC 7113
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...    190   4e-55    Arthrospira
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO       190   4e-55    Arthrospira platensis C1
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...    189   6e-55    
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...    189   7e-55    
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...    189   8e-55    
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...    189   1e-54    
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    187   2e-54    
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...    187   2e-54    
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...    187   2e-54    
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...    187   3e-54    
ref|WP_015151496.1|  Manganese-stabilising protein / photosystem ...    187   3e-54    
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...    186   3e-54    
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...    186   3e-54    
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...    187   4e-54    
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...    187   4e-54    
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...    187   4e-54    
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...    187   5e-54    
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...    187   5e-54    
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...    187   5e-54    
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...    186   7e-54    
ref|WP_018399127.1|  hypothetical protein                               186   9e-54    
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...    186   1e-53    
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...    186   2e-53    
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...    185   2e-53    
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...    185   2e-53    
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide        185   2e-53    
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...    185   3e-53    
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...    185   3e-53    
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...    184   3e-53    
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein            184   4e-53    
ref|WP_019506429.1|  hypothetical protein                               184   4e-53    
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...    185   5e-53    
gb|EWM24379.1|  oxygen-evolving enhancer protein                        186   7e-53    
ref|WP_006529097.1|  Manganese-stabilising protein / photosystem ...    184   7e-53    
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                     186   8e-53    
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide        183   1e-52    
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...    183   1e-52    
ref|WP_017662186.1|  hypothetical protein                               183   2e-52    
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...    182   5e-52    
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor            182   6e-52    
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)    181   8e-52    
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...    181   9e-52    
ref|WP_017293645.1|  hypothetical protein                               181   1e-51    
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1                 180   1e-51    
dbj|BAG85210.1|  extrinsic protein in photosystem II                    182   1e-51    
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...    181   1e-51    
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor       182   1e-51    
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...    179   4e-51    
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...    179   4e-51    
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                       181   4e-51    
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II        180   4e-51    
ref|WP_015223075.1|  photosystem II manganese-stabilizing protein...    179   4e-51    
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...    179   6e-51    
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...    179   7e-51    
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...    179   7e-51    
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...    178   9e-51    
gb|KEI69285.1|  PsbO                                                    179   9e-51    
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...    178   1e-50    
gb|AAF13997.1|  photosystem II manganese stabilizing protein            178   1e-50    
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...    178   2e-50    
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...    178   2e-50    
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...    177   2e-50    
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                       179   2e-50    
ref|WP_030006064.1|  Photosystem II manganese-stabilizing polypep...    177   2e-50    
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...    177   3e-50    
ref|WP_008186133.1|  manganese-stabilising protein/ photosystem I...    177   4e-50    
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                    178   4e-50    
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                     178   4e-50    
ref|WP_035985606.1|  hypothetical protein                               177   4e-50    
emb|CAH25340.1|  oxygen-evolving enhancer                               176   4e-50    
ref|WP_033373963.1|  Photosystem II manganese-stabilizing polypep...    177   5e-50    
gb|ABF59672.1|  photosystem II extrinsic protein O                      178   5e-50    
ref|WP_002791059.1|  Photosystem II manganese-stabilizing polypep...    176   7e-50    
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...    177   1e-49    
ref|WP_012305903.1|  photosystem II manganese stabilizing protein...    176   1e-49    
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111              177   1e-49    
ref|XP_005536430.1|  manganese-stabilzing protein precursor             177   1e-49    
ref|WP_016922728.1|  hypothetical protein                               176   1e-49    
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                       176   1e-49    
ref|WP_002761031.1|  Photosystem II manganese-stabilizing polypep...    176   1e-49    
gb|AAN11311.1|  oxygen-evolving enhancer 1                              176   1e-49    
ref|WP_004160298.1|  Photosystem II manganese-stabilizing polypep...    175   1e-49    
ref|WP_002800587.1|  Photosystem II manganese-stabilizing polypep...    175   2e-49    
ref|WP_002773425.1|  Photosystem II manganese-stabilizing polypep...    175   2e-49    
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...    175   2e-49    
ref|WP_004162736.1|  Photosystem II manganese-stabilizing polypep...    175   3e-49    
ref|WP_008199011.1|  Photosystem II manganese-stabilizing polypep...    174   3e-49    
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    171   3e-49    
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...    174   3e-49    
ref|WP_002741980.1|  photosystem II manganese-stabilizing polypep...    174   3e-49    
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                       176   4e-49    
ref|WP_002738218.1|  photosystem II manganese-stabilizing polypep...    174   4e-49    
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                       176   5e-49    
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...    174   7e-49    
gb|EJK75097.1|  hypothetical protein THAOC_03193                        173   1e-48    
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...    173   1e-48    
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor       173   3e-48    
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                       173   3e-48    
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                    172   7e-48    
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...    170   1e-47    
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...    170   1e-47    
gb|ACF28703.1|  oxygen evolving complex protein variant                 167   2e-47    
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO       171   2e-47    
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...    169   2e-47    
gb|ADC54902.1|  oxygen-evolving enhancer protein                        164   5e-47    
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein       168   6e-47    
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                       170   7e-47    
ref|WP_011243530.1|  MULTISPECIES: photosystem II PsbO protein          168   1e-46    
ref|XP_005706438.1|  photosystem II PsbO protein                        170   1e-46    
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor          167   1e-45    
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...    165   1e-45    
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)     165   1e-45    
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor            167   1e-45    
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...    165   2e-45    
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...    166   2e-45    
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                    166   2e-45    
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...    164   3e-45    
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...    163   6e-45    
gb|ACF95815.1|  oxygen evolving enhancer protein 1                      160   7e-45    
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678              163   1e-44    
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                       163   3e-44    
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...    160   6e-44    
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                    159   6e-43    
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                    159   6e-43    
emb|CBN78902.1|  manganese stabilising protein                          159   1e-42    
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...    155   5e-42    
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...    154   1e-41    
gb|ADC54900.1|  oxygen-evolving enhancer protein                        150   2e-41    
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...    154   2e-41    
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                       150   4e-41    
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...    149   9e-40    
ref|WP_019500685.1|  hypothetical protein                               149   1e-39    
ref|YP_002049183.1|  Photosystem II manganese-stabilizing polypep...    148   2e-39    
gb|ABH09263.1|  photosystem II manganese-stabilizing protein            148   3e-39    
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...    148   3e-39    
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO      148   5e-39    
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...    147   5e-39    
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein       147   6e-39    
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...    147   9e-39    
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein       145   3e-38    
gb|ADC54890.1|  oxygen-evolving enhancer protein                        142   3e-38    
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...    145   3e-38    
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...    145   4e-38    
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...    145   5e-38    
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein       145   6e-38    
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...    144   1e-37    
ref|WP_028953543.1|  Photosystem II manganese-stabilizing polypep...    144   2e-37    
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...    143   2e-37    
ref|WP_011127177.1|  photosystem II manganese-stabilizing polypep...    143   2e-37    
gb|ADC54903.1|  oxygen-evolving enhancer protein                        139   3e-37    
gb|AIS72812.1|  oxygen evolving activity                                139   4e-37    
ref|WP_043694690.1|  Photosystem II manganese-stabilizing polypep...    141   2e-36    
gb|AHF62713.1|  photosystem II manganese-stabilizing polypeptide        141   2e-36    
ref|WP_011363327.1|  photosystem II manganese-stabilizing polypep...    141   2e-36    
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...    141   2e-36    
gb|ADC54907.1|  oxygen-evolving enhancer protein                        137   2e-36    
gb|ADC54904.1|  oxygen-evolving enhancer protein                        137   2e-36    
gb|ADD94884.1|  photosystem II manganese stabilizing polypeptide        140   3e-36    
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein       140   4e-36    
ref|WP_009788842.1|  photosystem II manganese-stabilizing polypep...    140   5e-36    
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...    139   7e-36    
gb|ADC54905.1|  oxygen-evolving enhancer protein                        135   9e-36    
ref|WP_038551339.1|  Photosystem II manganese-stabilizing polypep...    139   1e-35    
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...    139   1e-35    
ref|WP_011360791.1|  photosystem II manganese-stabilizing polypep...    137   4e-35    
gb|ADC54906.1|  oxygen-evolving enhancer protein                        132   1e-34    
gb|ADC54901.1|  oxygen-evolving enhancer protein                        132   2e-34    
gb|ADC54894.1|  oxygen-evolving enhancer protein                        131   4e-34    
gb|ADC54891.1|  oxygen-evolving enhancer protein                        130   6e-34    
gb|ADC54911.1|  oxygen-evolving enhancer protein                        130   8e-34    
gb|ADC54909.1|  oxygen-evolving enhancer protein                        129   1e-33    
gb|ADC54912.1|  oxygen-evolving enhancer protein                        129   2e-33    
gb|ADC54896.1|  oxygen-evolving enhancer protein                        128   6e-33    
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722              131   6e-33    
ref|NP_195440.1|  photosystem II manganese-stabilising protein (P...    127   1e-32    
gb|ADC54913.1|  oxygen-evolving enhancer protein                        127   1e-32    
gb|ADC54908.1|  oxygen-evolving enhancer protein                        126   4e-32    
ref|WP_011294230.1|  photosystem II manganese-stabilizing protein       129   7e-32    
ref|WP_036906171.1|  Photosystem II manganese-stabilizing polypep...    129   8e-32    
ref|WP_038651072.1|  Photosystem II manganese-stabilizing polypep...    128   1e-31    
gb|ADC54893.1|  oxygen-evolving enhancer protein                        125   1e-31    
gb|ADC54910.1|  oxygen-evolving enhancer protein                        124   2e-31    
gb|ADC54898.1|  oxygen-evolving enhancer protein                        122   1e-30    
ref|WP_019474069.1|  MULTISPECIES: Photosystem II manganese-stabi...    125   2e-30    
ref|WP_002806175.1|  photosystem II manganese-stabilizing protein       124   3e-30    
gb|ABV49867.1|  Photosystem II manganese-stabilizing protein            124   3e-30    
ref|WP_011375796.1|  photosystem II manganese-stabilizing protein       124   5e-30    
ref|WP_026032523.1|  Photosystem II manganese-stabilizing polypep...    124   5e-30    
ref|WP_036922154.1|  Photosystem II manganese-stabilizing polypep...    124   5e-30    
ref|WP_026032868.1|  Photosystem II manganese-stabilizing polypep...    123   9e-30    
gb|ADC54899.1|  oxygen-evolving enhancer protein                        119   1e-29    
ref|WP_011433163.1|  photosystem II manganese-stabilizing protein       122   1e-29    
gb|KGF94551.1|  Photosystem II manganese-stabilizing protein (PsbO)     120   1e-29    
ref|WP_029981289.1|  Photosystem II manganese-stabilizing polypep...    120   1e-29    
ref|WP_025946585.1|  Photosystem II manganese-stabilizing polypep...    120   1e-29    
ref|WP_025929711.1|  Photosystem II manganese-stabilizing polypep...    122   2e-29    
ref|WP_025921390.1|  Photosystem II manganese-stabilizing polypep...    122   2e-29    
ref|WP_025955147.1|  MULTISPECIES: Photosystem II manganese-stabi...    122   3e-29    
ref|WP_025945629.1|  MULTISPECIES: Photosystem II manganese-stabi...    122   3e-29    
ref|WP_025952314.1|  Photosystem II manganese-stabilizing polypep...    122   3e-29    
ref|WP_025942737.1|  MULTISPECIES: Photosystem II manganese-stabi...    121   3e-29    
ref|WP_025937984.1|  Photosystem II manganese-stabilizing polypep...    121   3e-29    
ref|WP_025956454.1|  Photosystem II manganese-stabilizing polypep...    121   3e-29    
gb|ADC54895.1|  oxygen-evolving enhancer protein                        118   3e-29    
ref|WP_025979193.1|  MULTISPECIES: Photosystem II manganese-stabi...    121   3e-29    
ref|WP_025892535.1|  MULTISPECIES: Photosystem II manganese-stabi...    121   3e-29    
ref|WP_041484654.1|  Photosystem II manganese-stabilizing polypep...    121   4e-29    
ref|WP_025890347.1|  MULTISPECIES: Photosystem II manganese-stabi...    121   4e-29    
gb|ABM69537.1|  Photosystem II manganese-stabilizing protein            121   4e-29    
ref|WP_025925905.1|  Photosystem II manganese-stabilizing polypep...    121   4e-29    
ref|WP_042849726.1|  Photosystem II manganese-stabilizing polypep...    121   4e-29    
gb|ABO16873.1|  Photosystem II manganese-stabilizing protein            121   5e-29    
ref|WP_032527523.1|  Photosystem II manganese-stabilizing polypep...    120   5e-29    
ref|WP_025914084.1|  Photosystem II manganese-stabilizing polypep...    120   7e-29    
ref|WP_019477231.1|  Photosystem II manganese-stabilizing polypep...    120   9e-29    
ref|WP_025941252.1|  Photosystem II manganese-stabilizing polypep...    120   9e-29    
ref|WP_025906083.1|  Photosystem II manganese-stabilizing polypep...    120   1e-28    
ref|WP_025965258.1|  Photosystem II manganese-stabilizing polypep...    119   2e-28    
emb|CDX73783.1|  BnaC08g22200D                                          115   2e-28    
sp|P84989.1|PSBO_POPEU  RecName: Full=Oxygen-evolving enhancer pr...    114   4e-28    
gb|KGF89180.1|  Photosystem II manganese-stabilizing protein (PsbO)     115   2e-27    
ref|WP_036913864.1|  MULTISPECIES: Photosystem II manganese-stabi...    117   2e-27    
gb|KGG33279.1|  Photosystem II manganese-stabilizing protein (PsbO)     117   2e-27    



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   338 bits (868),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  218  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TASSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   338 bits (867),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  218  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TSSSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   337 bits (865),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  218  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT  KPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TASSTGKITLSVTQCKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   337 bits (865),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  218  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKP+TGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TASSTGKITLSVTQSKPQTGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   337 bits (864),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  218  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKP+TGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TASSTGKITLSVTQSKPQTGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV++DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVANDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  218  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  278  TASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  332



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRG+SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  218  LVASGKPESFGGQFLVPSYRGTSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT +KPETGEVIGVFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  ASSSTGKITLSVTKTKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGIWYAQLE  332



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV  DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVGPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  219  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS GKIT SVTGSKPETGE+IGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  279  AASSVGKITLSVTGSKPETGEIIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLE  333



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  155  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  215  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  275  TASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  329



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   335 bits (859),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LTASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  277  TASSTGKITLSVTKSKPETGEIIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   335 bits (858),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  217  LVASGKPESFSGQFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            V SSTGKIT SVTGSKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  277  VGSSTGKITLSVTGSKPETGEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   335 bits (858),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LAASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  277  TASSTGKITLSVTKSKPETGEIIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   335 bits (858),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  155  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  215  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  275  TASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE  329



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   334 bits (857),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  156  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  215

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  216  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  275

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  276  VASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  330



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   335 bits (858),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV +DGS+KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVGADGSIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQL+
Sbjct  277  ASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLD  331



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   334 bits (857),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  156  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  215

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  216  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  275

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  276  VASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  330



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDE+EGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  155  FQNTKLMTRLTYTLDEMEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  215  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  275  TASSKGTITLSVTQSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGIWYAQLE  329



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  156  FQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  215

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE+L KENIKN
Sbjct  216  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEDLTKENIKN  275

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  276  ASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  330



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPE+FSGEFLVPSYRG+SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LAASGKPENFSGEFLVPSYRGTSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  277  TASSTGKITLSVTKSKPETGEIIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  218  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  278  TSSSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  153  FQKTKLMTRLTYTLDEIEGPFEVSSDGNVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  212

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  213  LAANGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  272

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  273  TSSSTGKITLSVTNSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  327



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  218  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  278  TASSTGKITLSVTRSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  218  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  278  TASSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDGSVKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  155  FQKTKLMTRLTYTLDEIEGPFEVSSDGSVKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+G P+SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN
Sbjct  215  LAASGTPDSFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT S+T +KPETGEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQLE
Sbjct  275  TASSTGKITLSITKTKPETGEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQLE  329



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   333 bits (853),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSSDGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  277  TASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   332 bits (852),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SF GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LVASGKPDSFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  277  TASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  331



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   329 bits (844),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  72   FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  131

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  132  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  191

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+G+WYAQLE
Sbjct  192  VASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLE  246



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   332 bits (851),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  218  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   332 bits (850),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV +DGS+KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVGADGSIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  217  LVASGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  277  ASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  331



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  151  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  210

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  211  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  270

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS GKITFSVT +KPETGEVIGVF+SLQPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  271  ASSSKGKITFSVTKTKPETGEVIGVFQSLQPSDTDLGAKAPKDVKIQGIWYAQLE  325



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  218  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  149  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  208

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  209  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  268

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQ  242
             AS TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQ
Sbjct  269  TASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQ  321



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGE+LVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVASGKPESFSGEYLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  274  AASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQRTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKN
Sbjct  219  LVASGKPESFGGQFLVPSYRGSSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT  VT SKPETGEVIGVFES+QPSDTDLGAK PKEVKIQG+WYAQLE
Sbjct  279  TASSTGKITLGVTNSKPETGEVIGVFESIQPSDTDLGAKVPKEVKIQGVWYAQLE  333



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS+DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  274  AASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   330 bits (845),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  156  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  215

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  216  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  275

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  276  ASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  330



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   330 bits (845),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG+VKF EKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSGE+LVPSYRGSSFLDPKGRGGSTGY+NAVALPAGGRGDEEEL KENIKN
Sbjct  217  LVATGKPESFSGEYLVPSYRGSSFLDPKGRGGSTGYBNAVALPAGGRGDEEELTKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  277  TSSSTGKITLGVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGIWYAQLD  331



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   329 bits (844),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS GKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQL+
Sbjct  274  ASSSKGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLD  328



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   329 bits (844),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS GKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  274  ASSSKGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   329 bits (844),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+ F GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KENIK+
Sbjct  217  LVASGKPDKFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKKENIKD  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PKEVKIQG WY QLE
Sbjct  277  ASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKTPKEVKIQGFWYGQLE  331



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   329 bits (844),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRGGST YDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  218  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGGSTVYDNAVALPAGGRGDEEELEKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS+TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  278  TASATGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  332



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   329 bits (844),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEV++DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVNTDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKN
Sbjct  217  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            V+SS+GKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPKEVKIQGIWYAQLE
Sbjct  277  VSSSSGKITLSVTKSKPETGEVIGVFESVQPSDTDLGSKAPKEVKIQGIWYAQLE  331



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  137  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  196

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+ F GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KENIK+
Sbjct  197  LVASGKPDKFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKKENIKD  256

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PKEVKIQG WY QLE
Sbjct  257  ASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKTPKEVKIQGFWYGQLE  311



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   325 bits (833),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  58   FQRTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  117

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYD+AVALPAGGRGDEEEL KENIKN
Sbjct  118  LVASGKPESFGGQFLVPSYRGSSFLDPKGRGGSTGYDSAVALPAGGRGDEEELVKENIKN  177

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTGKIT  VT SKPETGEVIGVFES+QPSDTDLGAK PKEVKIQG+WYAQLE
Sbjct  178  TASSTGKITLGVTNSKPETGEVIGVFESIQPSDTDLGAKVPKEVKIQGVWYAQLE  232



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  155  FQKTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG +LVPSYRGSSFLDPKGRGGS GYDNAVALPAGGRGDEEEL KENIK+
Sbjct  215  LVATGKPESFSGSYLVPSYRGSSFLDPKGRGGSAGYDNAVALPAGGRGDEEELVKENIKD  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            V+SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+VKIQGIWYAQLE
Sbjct  275  VSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGSKAPKDVKIQGIWYAQLE  329



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  151  FQKTKLMTRLTYTLDEIEGPLEVSSDGNVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  210

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  211  LAASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENVKN  270

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKP+TGE+IGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  271  TSSSTGKITLSVTNSKPDTGELIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLD  325



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVS+DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPLEVSADGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LVATGKPESFSGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  278  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  332



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFS +FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  218  LVASGKPESFSVDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  278  TASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  332



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN
Sbjct  219  LVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  279  TSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS GKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  274  AASSKGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQKTKLMTRLTYTLDEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN
Sbjct  218  LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  278  AASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  332



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRG+SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  218  LVASGKPESFGGQFLVPSYRGTSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFES QPSDTDLGAK  K+VKIQGIWYAQL+
Sbjct  278  ASSSTGKITLSVTKSKPETGEVIGVFESFQPSDTDLGAKVAKDVKIQGIWYAQLD  332



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFS +FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  217  LVASGKPESFSVDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  277  TASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   328 bits (841),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN
Sbjct  219  LVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  279  TSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  155  FQKTKLMTRLTYTLDEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN
Sbjct  215  LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  275  AASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  329



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   328 bits (840),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F+GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  218  LVASGKPENFTGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S+GKIT SVT SKPETGE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  278  TAASSGKITLSVTKSKPETGELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   327 bits (839),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGD+EELQKENIKN
Sbjct  217  LVASGKPERFGGQFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDDEELQKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG IT SVT SKPE+GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  277  TASSTGNITLSVTKSKPESGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   323 bits (829),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  56   FQKTKLMTRLTYTLDEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  115

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN
Sbjct  116  LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  175

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  176  AASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  230



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   327 bits (838),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  217  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGTSTGYDNAVALPAGGRGDEEELAKENNKS  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS GKIT SVT SKPETGE+IGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  277  ASSSKGKITLSVTQSKPETGEIIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  331



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVTSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQL+
Sbjct  274  ASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLD  328



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  155  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G FLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  215  LVASGKPESFGGPFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  275  ASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  329



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   325 bits (832),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  96   FQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQ  155

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KENIKN
Sbjct  156  LVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKN  215

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT SKPETGEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  216  TSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  270



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   327 bits (837),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+ DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVAPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F+GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  218  LVASGKPENFTGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S GKIT SVT +KPETGE+IGVFESLQPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  278  TAASKGKITLSVTKTKPETGELIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLD  332



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   328 bits (841),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  199  FQKTKLMTRLTYTLDEIEGPLEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  258

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKP+SF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN
Sbjct  259  LVATGKPDSFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  318

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG IT SVT S P+TGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  319  AASSTGNITLSVTKSNPDTGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  373



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLD+IEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDQIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F+GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  218  LVASGKPENFTGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S+GKIT SVT SKPETGE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  278  TAASSGKITLSVTKSKPETGELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVTPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG+FLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVATGKPESFSGDFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  274  ASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  161  FQKTKLMTRLTYTLDEIEGPLEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  220

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKP+SF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN
Sbjct  221  LVATGKPDSFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  280

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG IT SVT S P+TGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  281  AASSTGNITLSVTKSNPDTGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  335



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV++DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  154  FQKTKLMTRLTYTLDEIEGPLEVAADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  214  LVATGKPESFSGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SS G IT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  274  ASSSQGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  328



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   326 bits (836),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDE+EGP EV +DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  152  FQKTKLMTRLTYTLDEMEGPLEVGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  212  LVATGKPESFSGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  272  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDE+EGP EV +DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  152  FQKTKLMTRLTYTLDEMEGPLEVGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  212  LVATGKPESFSGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  272  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSPDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEEEL KENIKN
Sbjct  218  LVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEELAKENIKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS GKIT SVT SKPE+GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  278  TASSKGKITLSVTKSKPESGELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS +GSV FEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQKTKLMTRLTYTLDEIEGPFEVSPNGSVTFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  219  LVASGKPESFGGQFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPE+GEVIGVFES+QPSDTDLGAK PKEVKIQGIWYAQLE
Sbjct  279  TSSSTGSITLSVTKSKPESGEVIGVFESVQPSDTDLGAKTPKEVKIQGIWYAQLE  333



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSPDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEEEL KENIKN
Sbjct  218  LVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEELAKENIKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS GKIT SVT SKPE+GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  278  TASSKGKITLSVTKSKPESGELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  89   FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  148

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G FLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  149  LVASGKPESFGGPFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  208

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  209  ASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGVWYAQLE  263



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  277  AASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  331



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP++F+GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  217  LVASGKPDNFTGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS GKIT SVT +KPETGE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  277  TASSKGKITLSVTKTKPETGELIGVFESIQPSDTDLGAKVPKDVKIQGVWYAQLD  331



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK 
Sbjct  159  FQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKN  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  219  LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  279  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  333



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK 
Sbjct  159  FQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKN  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  219  LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  279  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  333



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+V+F+EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQKTKLMTRLTYTLDEIEGPFEVSPDGAVRFQEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  219  LVASGKPESFGGQFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPE+GEVIGVFESLQPSDTD+GAK PK+VKIQGIWYAQLE
Sbjct  279  TSSSTGSITLSVTKSKPESGEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLE  333



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP++F+GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  218  LVASGKPDNFTGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENTKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+STGKIT SVT SKPE GE+IGVFES+QPSDTDLGAK PK+VKIQG+WYAQL+
Sbjct  278  TAASTGKITLSVTKSKPENGELIGVFESIQPSDTDLGAKTPKDVKIQGVWYAQLD  332



>gb|ABR26133.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=178

 Score =   320 bits (819),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK 
Sbjct  4    FQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKN  63

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  64   LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  123

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  124  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  178



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score =   320 bits (821),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK 
Sbjct  29   FQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKN  88

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  89   LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  148

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  149  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  203



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK+
Sbjct  150  FQKTKLMTRLTYTLDEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKE  209

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  210  LVATGKPESFGGNFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENIKN  269

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+  G+ITFSVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQL
Sbjct  270  TAAGKGEITFSVTSSKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQL  323



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ+TKLMTRLTYTLDE+EGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  155  FQDTKLMTRLTYTLDEMEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN
Sbjct  215  LVASGKPDSFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENNKN  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS G IT SV+ SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  275  TASSKGTITLSVSKSKPETGEVIGVFQSLQPSDTDLGAKTPKDVKIEGIWYAQLE  329



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSD +VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSSDRTVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL++ENIK+
Sbjct  217  LVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKRENIKD  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT S+T SKPE+GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  277  ASSSTGKITLSITKSKPESGEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYAQLE  331



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   324 bits (831),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDE+EGP EV +DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  152  FQKTKLMTRLTYTLDEMEGPLEVGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  212  LVATGKPESFSGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFE +QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  272  ASSSTGNITLSVTKSKPETGEVIGVFERVQPSDTDLGAKAPKDVKIQGVWYAQLE  326



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  217  LVASGKPDSFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKS  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  277  AASSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDVKITGVWYAQLD  331



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  217  LVASGKPDSFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKS  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  277  AASSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDVKITGVWYAQLD  331



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   320 bits (821),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIK 
Sbjct  73   FQKTKLMTRLTYTLDEIEGPLEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKN  132

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  133  LVATGKPESFGGPFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  192

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  193  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  247



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  217  LDASGKPNSFGGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG+IT  VT SKPETGE+IGVFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  277  AASSTGEITLKVTKSKPETGELIGVFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  331



>gb|ABK95838.1| unknown [Populus trichocarpa]
Length=170

 Score =   317 bits (813),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -3

Query  742  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  563
            MTRLTYTLDEIEGPFEVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1    MTRLTYTLDEIEGPFEVSSDGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  562  PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  383
            P+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN ASSTG
Sbjct  61   PDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKNTASSTG  120

Query  382  KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            KIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQL+
Sbjct  121  KITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDVKIQGIWYAQLD  169



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSD +VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVSSDRTVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+ ENIK+
Sbjct  217  LVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELKXENIKD  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT S+T SKPE+GEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  277  ASSSTGKITLSITKSKPESGEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYAQLE  331



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  56   FQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  115

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  116  LDASGKPNSFGGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  175

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG+IT  VT SKPETGE+IGVFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  176  AASSTGEITLKVTKSKPETGELIGVFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  230



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   322 bits (825),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPF+VSSDG+VKF EKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  143  FQNTKLMTRLTYTLDEIEGPFDVSSDGTVKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQ  202

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  203  LEASGKPDSFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  262

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASSTG+IT  VT SKPETGE+IGVFES+QPSDTDLGAK PK+VKIQGIWY QLE
Sbjct  263  AASSTGEITLKVTKSKPETGELIGVFESIQPSDTDLGAKVPKDVKIQGIWYGQLE  317



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQRTKLMTRLTYTLDEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE+L KEN K+
Sbjct  217  LVASGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEDLAKENNKS  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VASS+GKIT SVT ++PETGEVIGVFESLQPSDTDLG+KAPK+VKI GIWYAQL+
Sbjct  277  VASSSGKITLSVTKTRPETGEVIGVFESLQPSDTDLGSKAPKDVKITGIWYAQLD  331



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS+DGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSADGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS  G+V F EKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  159  FQKTKLMTRLTYTLDEIEGPFEVSPSGTVNFVEKDGIDYAAVTVQLPGGERVPFLFTVKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  219  LVASGKPESFGGQFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPE+GEVIGVFES+QPSDTDLGAK PKEVKIQGIWYAQLE
Sbjct  279  TSSSTGTITLSVTKSKPESGEVIGVFESIQPSDTDLGAKVPKEVKIQGIWYAQLE  333



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  217  LEASGKPESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  277  TAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  331



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+
Sbjct  217  LVASGKPENFGGQFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKD  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG I+ SVT SKPE+GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYA+LE
Sbjct  277  PSSSTGTISLSVTKSKPESGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAKLE  331



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  219  LEASGKPDNFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  279  TAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  333



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  202  FQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  261

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  262  LEASGKPESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  321

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  322  TAASVGDITLRITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  376



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  217  LEASGKPDSFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  277  TAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPE+FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  217  LEASGKPENFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  277  TAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   320 bits (819),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   320 bits (819),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   320 bits (820),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 167/181 (92%), Gaps = 6/181 (3%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQRTKLMTRLTYTLDEIEGPFEVSPDGAVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  219  LVASGKPESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENIKN  278

Query  400  ------VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
                   +SSTG IT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WYAQL
Sbjct  279  XXXXXXXSSSTGSITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDVKIQGVWYAQL  338

Query  238  E  236
            E
Sbjct  339  E  339



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   320 bits (819),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPE+F G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+
Sbjct  217  LVASGKPENFGGQFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKD  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SK E+GEVIGVFESLQPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  277  PSSSTGTITLSVTKSKTESGEVIGVFESLQPSDTDLGAKTPKDVKIQGIWYAQLE  331



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   319 bits (818),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ T+LMTRLTYTLDEIEGP EVSSDG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  164  FQKTRLMTRLTYTLDEIEGPLEVSSDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  223

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G PESFSG+FLVP+YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+
Sbjct  224  LVASGTPESFSGQFLVPAYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENIKD  283

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            V++S G IT SV+ SKPETGEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  284  VSASKGTITLSVSKSKPETGEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  338



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   319 bits (817),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV SDGSVKF+E DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  162  FQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEADGIDYAAVTVQLPGGERVPFLFTVKQ  221

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPE+FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  222  LEASGKPENFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  281

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  282  TAASVGDITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  336



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVTPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESFSG+FLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+
Sbjct  214  LVATGKPESFSGDFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKS  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             + S GKI  SVT +KPETGEVIGVFES+QP DTDLGAKAPK+VKIQG+WYAQLE
Sbjct  274  ASFSKGKIPLSVTKTKPETGEVIGVFESVQPFDTDLGAKAPKDVKIQGVWYAQLE  328



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|ACU19823.1| unknown [Glycine max]
Length=170

 Score =   312 bits (799),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -3

Query  742  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  563
            MTRLTYTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1    MTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  562  PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  383
            P+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS G
Sbjct  61   PDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKG  120

Query  382  KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            KIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+VKIQGIWYAQLE
Sbjct  121  KITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLE  169



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPE+FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  219  LEASGKPENFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  279  TAGSVGDITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  333



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSV+F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVQFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   317 bits (813),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  217  LEASGKPDNFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENVKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  +T SKPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  277  TAASVGEITLKITKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   317 bits (813),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  SAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   317 bits (812),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   317 bits (812),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  157  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  217  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  277  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  331



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   317 bits (812),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDNFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ T+LMTRLTYTLDEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  165  FQKTRLMTRLTYTLDEIEGPLEVSHDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  224

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G P+SFSG+FLVP+YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+
Sbjct  225  LVASGTPDSFSGQFLVPAYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKD  284

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            V++S G+ITFSV+ SKP+TGEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  285  VSASKGEITFSVSKSKPDTGEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   316 bits (810),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV  DGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  160  FQNTKLMTRLTYTLDEIEGPFEVGPDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  219

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKPE+FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  220  LEASGKPENFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  279

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY Q+E
Sbjct  280  TAASVGDITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE  334



>gb|ACJ84218.1| unknown [Medicago truncatula]
Length=170

 Score =   310 bits (794),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  742  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  563
            MTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1    MTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  562  PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  383
            P+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ ASS G
Sbjct  61   PDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKG  120

Query  382  KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            KIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  121  KITLSVTQSKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  169



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ T+LMTRLTYTLDEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  165  FQKTRLMTRLTYTLDEIEGPLEVSHDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  224

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G P+SFSG+FLVP+YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+
Sbjct  225  LVASGTPDSFSGQFLVPAYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKD  284

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            V++S G+ITFSV+ SKP+TGEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  285  VSASKGEITFSVSKSKPDTGEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -3

Query  754  NTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLV  575
              KLMTRLTYTLDEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLV
Sbjct  143  TVKLMTRLTYTLDEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLV  202

Query  574  ATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVA  395
            A+GKP+SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN K+ A
Sbjct  203  ASGKPDSFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELAKENNKSAA  262

Query  394  SSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            SS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+VKI G+WYAQL+
Sbjct  263  SSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDVKITGVWYAQLD  315



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPG ERVPFLFT+KQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGCERVPFLFTVKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP+SF+G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  218  LDASGKPDSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKN  277

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  278  TAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE  332



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ T+LMTRLTYTLDEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  165  FQKTRLMTRLTYTLDEIEGPLEVSQDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  224

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G P+SFSG+FLVP+YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+
Sbjct  225  LVASGTPDSFSGQFLVPAYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKD  284

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            V++S G+ITFSV+ SKP+TGEVIGVFESLQPSDTDLG+KAPK+VKIQGIWYAQ+E
Sbjct  285  VSASKGEITFSVSKSKPDTGEVIGVFESLQPSDTDLGSKAPKDVKIQGIWYAQIE  339



>gb|ABQ85434.1| 33 kDa OEC protein, partial [Salicornia veneta]
Length=170

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  742  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  563
            MTRLTYTLDE+EGPFEVSSD +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GK
Sbjct  1    MTRLTYTLDEMEGPFEVSSDETVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGK  60

Query  562  PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  383
            P+SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN KN ASS G
Sbjct  61   PDSFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELLKENNKNAASSKG  120

Query  382  KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             IT SV+ SKPETGEVIGVF+SLQPSDTDLGAK PK+VKI+GIWYAQLE
Sbjct  121  TITLSVSKSKPETGEVIGVFQSLQPSDTDLGAKTPKDVKIEGIWYAQLE  169



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   313 bits (801),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLT TLDEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  173  FQNTKLMTRLTCTLDEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  232

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++F+G+FLVPSYRG SFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  233  LDASGKPDNFTGKFLVPSYRGPSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  292

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+IT  VT SKPETGEVIGVF+SLQPSDTDLGAK PK+VKIQG+WY QLE
Sbjct  293  TAASVGEITLKVTKSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIQGVWYGQLE  347



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   311 bits (798),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 162/175 (93%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  153  FQNTKLMTRLTYTLDEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ  212

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN
Sbjct  213  LVASGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKN  270

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S GKIT SVT S PE+GEVIGVF+S+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  271  TAASVGKITLSVTKSNPESGEVIGVFQSIQPSDTDLGAKTPKDVKIQGIWYAQLE  325



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   311 bits (796),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 165/175 (94%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPF+V+SDG+V+F EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  146  FQNTKLMTRLTYTLDEIEGPFDVASDGTVRFLEKDGIDYAAVTVQLPGGERVPFLFTIKQ  205

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN
Sbjct  206  LVASGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELDKENNKN  263

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+ITFSVT SKPE+GEVIG+FES+QPSDTDLGAK PK+VKIQGIWYA+LE
Sbjct  264  TAASVGEITFSVTKSKPESGEVIGLFESIQPSDTDLGAKTPKDVKIQGIWYAKLE  318



>gb|AFK46831.1| unknown [Lotus japonicus]
Length=170

 Score =   305 bits (782),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -3

Query  742  MTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK  563
            MTRL YTLDEIEGPFEVSSDG+VKFEEKDGIDYAAVT QLPGGERVP LFTIKQLVA+GK
Sbjct  1    MTRLAYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTAQLPGGERVPSLFTIKQLVASGK  60

Query  562  PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASSTG  383
            P+SFSGEFLVPSYRGSSFLDPKGRG STGYDNAVALPAGGRGDEEEL KEN K+ +SS G
Sbjct  61   PDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKG  120

Query  382  KITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            KIT SVT SKP+TGEVIGVFES+QPSDTDLGAKAPK+VKIQG+WYAQLE
Sbjct  121  KITLSVTQSKPDTGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE  169



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  219  LEASGKPDNFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+   +L
Sbjct  279  TAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVCATEL  332



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   311 bits (796),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+GKP++FSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KEN+KN
Sbjct  219  LEASGKPDNFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKN  278

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+VKIQG+   +L
Sbjct  279  TAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVCATEL  332



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   309 bits (791),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 161/175 (92%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  155  FQNTKLMTRLTYTLDEIEGPFEVASDGKVKFLEKDGIDYAAVTVQLPGGERVPFLFTIKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN
Sbjct  215  LVASGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENSKN  272

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S GKIT SVT S PE+ EVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  273  TAASLGKITLSVTKSNPESREVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE  327



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   309 bits (791),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSQDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF+GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KN
Sbjct  217  LVASGKPESFTGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VA+ TGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  277  VAALTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGSKAPKDVKIQGVWYAQLD  331



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   308 bits (790),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 161/175 (92%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G+PESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+
Sbjct  219  LVASGRPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKD  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
              +S GKITFSVT S PE GEVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  277  TTASLGKITFSVTKSNPERGEVIGVFESIQPSDTDLGAKNPKDVKIQGIWYAQLE  331



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   308 bits (788),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  157  FQKTKLMTRLTYTLDEIEGPFEVSQDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  216

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP++F GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KN
Sbjct  217  LVASGKPDNFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  277  VASSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGSKAPKDVKIQGVWYAQLD  331



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   308 bits (788),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 161/175 (92%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G+PESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+
Sbjct  218  LVASGRPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELSKENNKD  275

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
              +S GKITFSVT S P+T EVIGVFES+QPSDTDLGAK PK+VKIQGIWYAQLE
Sbjct  276  TTASLGKITFSVTKSNPKTREVIGVFESIQPSDTDLGAKNPKDVKIQGIWYAQLE  330



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   307 bits (787),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPF VS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  155  FQKTKLMTRLTYTLDEIEGPFVVSEDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  214

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESF GEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN KN
Sbjct  215  LVASGKPESFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENNKN  274

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+VKIQG+WYAQL+
Sbjct  275  VASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGSKAPKDVKIQGVWYAQLD  329



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   304 bits (778),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F NTKLMTRLTYTLDEIEGPFEV+SDG+V+F EKDG DYAAVTVQLPGGER+PFLFTIKQ
Sbjct  146  FLNTKLMTRLTYTLDEIEGPFEVASDGTVRFLEKDGSDYAAVTVQLPGGERIPFLFTIKQ  205

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN
Sbjct  206  LVATGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELDKENNKN  263

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+ITFSVT SKPE+GEVI +FES+QPSDTDLGAK P++VKIQGIWYA+LE
Sbjct  264  TAASVGEITFSVTKSKPESGEVISLFESIQPSDTDLGAKTPEDVKIQGIWYAKLE  318



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 162/175 (93%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG+V+F EKDG DYA VTVQLPGGER+PFLFTIKQ
Sbjct  141  FQNTKLMTRLTYTLDEIEGPFEVASDGTVRFLEKDGSDYATVTVQLPGGERIPFLFTIKQ  200

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN KN
Sbjct  201  LVATGKPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELDKENNKN  258

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+S G+ITFSVT SKPE+GEVI +FES+QPSDT+LGAK P++VKIQGIWYA+LE
Sbjct  259  TAASVGEITFSVTKSKPESGEVISLFESIQPSDTNLGAKTPEDVKIQGIWYAKLE  313



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 160/176 (91%), Gaps = 2/176 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVP-FLFTIK  584
            FQ TKLMT LTYTLDEIEGP EVS DG+VKFEEKDGIDYAAVTV+LPGGERVP FLFTIK
Sbjct  159  FQKTKLMTCLTYTLDEIEGPLEVSPDGTVKFEEKDGIDYAAVTVRLPGGERVPPFLFTIK  218

Query  583  QLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIK  404
            QLVA+GKPE+F  +FLVPSYRGSSFLDP  RGGSTGYDNAVALPAGGRGDEEEL KENIK
Sbjct  219  QLVASGKPENFGVQFLVPSYRGSSFLDPX-RGGSTGYDNAVALPAGGRGDEEELTKENIK  277

Query  403  NVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N +SSTG IT SVT SKPE+GEVIGVFESLQPSDTDLGAK PK+VKIQGI YAQLE
Sbjct  278  NSSSSTGTITLSVTKSKPESGEVIGVFESLQPSDTDLGAKVPKDVKIQGIRYAQLE  333



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   294 bits (752),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 155/170 (91%), Gaps = 2/170 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  159  FQNTKLMTRLTYTLDEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G+PESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+
Sbjct  219  LVASGRPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELAKENNKD  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIW  251
              +S GKITFSVT S PE GEVIGVFES+QPSDTDLGAK PK+VKIQGI 
Sbjct  277  TTASLGKITFSVTKSNPERGEVIGVFESIQPSDTDLGAKNPKDVKIQGIC  326



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 156/175 (89%), Gaps = 3/175 (2%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDE+EGP EV    ++KFEEKDGIDYAAVTVQLPGGERV FLFT+KQ
Sbjct  152  FQKTKLMTRLTYTLDEMEGPLEVRRRRTLKFEEKDGIDYAAVTVQLPGGERVAFLFTVKQ  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPESF   FLVPSYRGSSFLDPKGRGGSTGYDNA ALP GGRGDEEEL KEN+KN
Sbjct  212  LVATGKPESFR-PFLVPSYRGSSFLDPKGRGGSTGYDNAGALPRGGRGDEEELAKENVKN  270

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTG IT SVT SKPETGEVIGVFES+QPSDTDL  +APK+VKIQG+WYAQLE
Sbjct  271  ASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDL--EAPKDVKIQGVWYAQLE  323



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 155/169 (92%), Gaps = 2/169 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  158  FQNTKLMTRLTYTLDEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQ  217

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G+PESF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  RGD+EEL KEN K+
Sbjct  218  LVASGRPESFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RGDDEELSKENNKD  275

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGI  254
              +S GKITFSVT S P+T EVIGVFES+QPSDTDLGAK PK+VKIQGI
Sbjct  276  TTASLGKITFSVTKSNPKTREVIGVFESIQPSDTDLGAKNPKDVKIQGI  324



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   291 bits (745),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLF++K+
Sbjct  163  FTKTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFSVKE  222

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATG+P SF G++LVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GD ++L+KEN+K+
Sbjct  223  LVATGRPSSFGGKYLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGSGDRDDLEKENLKS  282

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +++ G I F+V  S PE+GEV+G FES+QPSDTDLGAK  KEVKI GIWY QL+
Sbjct  283  TSAAEGNIVFTVAQSNPESGEVVGTFESVQPSDTDLGAKQAKEVKISGIWYGQLK  337



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 153/175 (87%), Gaps = 16/175 (9%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVT                Q
Sbjct  88   FQNTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVT----------------Q  131

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEE+L KENIKN
Sbjct  132  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEDLTKENIKN  191

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAK PK+VKIQG+WYAQLE
Sbjct  192  ASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKVPKDVKIQGVWYAQLE  246



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGP  VS +G+++FEEKDGIDYAAVTVQLPGGERVPFLFT+K+
Sbjct  153  FQNTKLMTRLTYTLDEIEGPLTVS-NGNLRFEEKDGIDYAAVTVQLPGGERVPFLFTVKE  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA GKPE F G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN
Sbjct  212  LVAEGKPEKFGGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKN  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+K PKEVKI+GI+YAQLE
Sbjct  272  TAALNGNITFSIAKSNTETGEIAGTFESIQPSDTDLGSKTPKEVKIEGIFYAQLE  326



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            +Q TKLMTRLTYTLDEIEGP  +S +G++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK+
Sbjct  101  YQPTKLMTRLTYTLDEIEGPLTIS-NGNLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKE  159

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATGKPE+F G +LVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN
Sbjct  160  LVATGKPEAFGGSYLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKN  219

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+KAPKEVKI+GI+YAQ+E
Sbjct  220  TAALNGNITFSIAKSNVETGEIAGTFESIQPSDTDLGSKAPKEVKIEGIFYAQVE  274



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            +Q TKLMTRLTYTLDEIEGP  V   G+++FEEKDGIDYAAVTVQLPGGERVPFLFT+K+
Sbjct  153  YQQTKLMTRLTYTLDEIEGPLTVKG-GNLRFEEKDGIDYAAVTVQLPGGERVPFLFTVKE  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA GKPE+F G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN
Sbjct  212  LVAEGKPEAFGGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKN  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+KAPKEVKI+GI+YAQL+
Sbjct  272  TAALNGNITFSIAKSNTETGEIAGTFESIQPSDTDLGSKAPKEVKIEGIFYAQLD  326



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 152/175 (87%), Gaps = 1/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP  V  +G+++FEE DGIDYAAVTVQLPGGERVPFLFT+K+
Sbjct  153  FQPTKLMTRLTYTLDEIEGPLTVQ-NGNLRFEEVDGIDYAAVTVQLPGGERVPFLFTVKE  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA GKPE+F G FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN KN
Sbjct  212  LVAEGKPEAFGGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELAKENEKN  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+  G ITFS+  S  +TGE+ G FES QPSDTDLG+KAPKEVKI+GI+YAQL+
Sbjct  272  TAALNGNITFSIAKSNVQTGEIAGTFESFQPSDTDLGSKAPKEVKIEGIFYAQLD  326



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/148 (92%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  147  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  206

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  207  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  266

Query  400  VASSTGKITFSVTGSKPETGEVIGVFES  317
             AS TGKITF+VT S P+TGEVIGVFES
Sbjct  267  TASLTGKITFTVTKSNPQTGEVIGVFES  294



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   278 bits (712),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            + +TKLMTRLTYTLDEIE    V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+
Sbjct  154  YVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKE  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATG P+ FSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+
Sbjct  214  LVATGSPDGFSGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKD  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             + STG IT  V  S   TGE+ GVFES+QPSDTDLG+KAPKEVKIQGIWYAQL+
Sbjct  274  TSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIWYAQLD  328



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   278 bits (712),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            + +TKLMTRLTYTLDEIE    V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+
Sbjct  154  YVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKE  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATG P+ FSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+
Sbjct  214  LVATGSPDGFSGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKD  273

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             + STG IT  V  S   TGE+ GVFES+QPSDTDLG+KAPKEVKIQGIWYAQL+
Sbjct  274  TSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIWYAQLD  328



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score =   271 bits (693),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  23   FQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  82

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  83   LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  142

Query  400  VASSTGKITFSVTGSKPETGEVIGV  326
            VASSTGKIT SVT SKPETGE+IGV
Sbjct  143  VASSTGKITLSVTKSKPETGEIIGV  167



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEV++DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  121  FQNTKLMTRLTYTLDEIEGPFEVANDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  180

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIKN
Sbjct  181  LVASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELTKENIKN  240

Query  400  VASSTGKITFSVTGSKPETGEVI  332
             ASSTGKIT SVT SKPETGE+I
Sbjct  241  TASSTGKITLSVTKSKPETGELI  263



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   273 bits (698),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            + +TKLMTRLTYTLDEIE    V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+
Sbjct  70   YVDTKLMTRLTYTLDEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKE  129

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVATG P+ FSG FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGG GDEEEL KEN+K+
Sbjct  130  LVATGSPDGFSGSFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGAGDEEELGKENLKD  189

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             + STG IT  V  S   TGE+ GVFES+QPSDTDLG+KAPKEVKIQGIW AQL+
Sbjct  190  TSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEVKIQGIWCAQLD  244



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score =   270 bits (689),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  24   FQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  83

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  84   LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  143

Query  400  VASSTGKITFSVTGSKPETGEVIG  329
            VASSTGKIT SVT SKPETGE+IG
Sbjct  144  VASSTGKITLSVTKSKPETGEIIG  167



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score =   270 bits (689),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  23   FQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  82

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  83   LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  142

Query  400  VASSTGKITFSVTGSKPETGEVIG  329
            VASSTGKIT SVT SKPETGE+IG
Sbjct  143  VASSTGKITLSVTKSKPETGEIIG  166



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  17   FQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  76

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  77   LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  136

Query  400  VASSTGKITFSVTGSKPETGEV  335
            VASSTGKIT SVT SKPETGE+
Sbjct  137  VASSTGKITLSVTKSKPETGEI  158



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  23   FQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  82

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  83   LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  142

Query  400  VASSTGKITFSVTGSKPETGEV  335
            VASSTGKIT SVT SKPETGE+
Sbjct  143  VASSTGKITLSVTKSKPETGEI  164



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score =   259 bits (662),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  23   FQKTKLMTRLTYTLDEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  82

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN KN
Sbjct  83   LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKN  142

Query  400  VASSTGKITFSVTGSKPE  347
            VASSTGKIT SVT SKPE
Sbjct  143  VASSTGKITLSVTKSKPE  160



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   261 bits (667),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F +TKLMTRLTYTLDEI G   V S+GSV+ +E+DGIDYA VTVQLPGGERVPFLFTIKQ
Sbjct  119  FVSTKLMTRLTYTLDEISGKLTVGSNGSVELKEEDGIDYAPVTVQLPGGERVPFLFTIKQ  178

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G  E FSG+F VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN K+
Sbjct  179  LEAKGTLEGFSGDFTVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADSEELAKENTKS  236

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VA+S G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK++KI+G+WYAQL+
Sbjct  237  VAASKGSAAFSVAVVDPATGEIAGVFESIQPSDTDLGAKAPKDIKIKGLWYAQLK  291



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGP EV+ + ++KF E DGIDYAAVTVQL GGERVPFLFT+K+
Sbjct  152  FQKTKLMTRLTYTLDEIEGPLEVNGN-NLKFTEVDGIDYAAVTVQLAGGERVPFLFTVKE  210

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G  +SF G FLVPSYRG++FLDPKGRGGS GYD AVALPAGG GDE+ LQKEN K+
Sbjct  211  LVASGPADSFGGSFLVPSYRGATFLDPKGRGGSQGYDTAVALPAGGFGDEDALQKENQKS  270

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
              + +G ITFSV  S  ETGE+ GVF S+QPSDTD+GAK PK+VKI+GIWYAQL+
Sbjct  271  YKALSGNITFSVAKSNVETGEIGGVFTSVQPSDTDMGAKVPKDVKIEGIWYAQLD  325



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ T+LMTRLTYTLDEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  165  FQKTRLMTRLTYTLDEIEGPLEVSQDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  224

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+G P+SFSG+FLVP+YRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL KENIK+
Sbjct  225  LVASGTPDSFSGQFLVPAYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENIKD  284

Query  400  VASSTGKITFSVTGSKPETGEVIGVFE  320
            V++S G+ITFSV+ SKP+TGEVI V E
Sbjct  285  VSASKGEITFSVSKSKPDTGEVICVRE  311



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   252 bits (644),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYT+DEIEGPFEVS D +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  97   FQKTKLMTRLTYTMDEIEGPFEVSPDSTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  156

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKEN+KN
Sbjct  157  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKN  216

Query  400  VASSTGKITFSVTGSK  353
             AS TGKITF+VT S+
Sbjct  217  TASLTGKITFTVTKSQ  232



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKL+TRLTYTLD+I G F+V +DGSV F E+DGIDYAA TVQLPGGERVPFLFTIK+
Sbjct  88   FVKTKLLTRLTYTLDDISGKFKVGADGSVTFTEEDGIDYAATTVQLPGGERVPFLFTIKE  147

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA G    F G+F+VPSYRGSSFLDPKGRG STGYD AVALPA   GD EEL KEN K+
Sbjct  148  LVAKGNTSQFGGDFVVPSYRGSSFLDPKGRGASTGYDTAVALPAA--GDAEELAKENNKS  205

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             AS TG   F+V      TGE+ GVFES+QPSDTDLGAKAPK+VKI G+WYAQL+
Sbjct  206  AASLTGSAVFNVAKYDAATGEIAGVFESIQPSDTDLGAKAPKDVKITGLWYAQLK  260



>gb|AAR85969.1| ERT12 [Nicotiana tabacum]
Length=132

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -3

Query  634  TVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVAL  455
            TVQLPGGERVPFLFTIKQL A GKPESFSGEFLVPSYRGSSFLDPKGRGGST YDNAVAL
Sbjct  1    TVQLPGGERVPFLFTIKQLAANGKPESFSGEFLVPSYRGSSFLDPKGRGGSTSYDNAVAL  60

Query  454  PAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPK  275
            PAGGRGDEEEL+KEN+KN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK
Sbjct  61   PAGGRGDEEELEKENVKNTSSSTGKITLSVTNSKPETGEVIGVFESIQPSDTDLGAKVPK  120

Query  274  EVKIQGIWYAQL  239
            +VKIQGIWYAQL
Sbjct  121  DVKIQGIWYAQL  132



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F NTKLMTRLTYTLD + G  +V S G+++F+E+DGIDYA  TVQLPGG RVPFLFT+K+
Sbjct  156  FINTKLMTRLTYTLDAMSGTMKVGSGGAIEFKEEDGIDYAPTTVQLPGGSRVPFLFTVKE  215

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G  E+FSGEF VPSYRGS+FLDPKGRG +TGYD AVA+PAGG GDEEEL KEN K+
Sbjct  216  LEAKGDIEAFSGEFSVPSYRGSTFLDPKGRGAATGYDTAVAIPAGGAGDEEELVKENNKS  275

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
            +   +GK   S+    P TGEV GVF+S+QPSDTDLGAK PK++KIQG+WYAQL
Sbjct  276  IKPLSGKAVLSIAKYDPATGEVAGVFQSVQPSDTDLGAKVPKDIKIQGLWYAQL  329



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G F+V SDGSV  +E+DG+DYA VTVQLPGGERVPFLFT+K+
Sbjct  131  FTKTKLMTRLTYTLDGMTGSFKVGSDGSVAIQERDGLDYAPVTVQLPGGERVPFLFTLKE  190

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G    F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  + D +EL KEN KN
Sbjct  191  FTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--KSDADELLKENNKN  248

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VA+  G   F+V    P TGEV GVFES+QPSDTDLG+KAPK+VKI G+WYAQL+
Sbjct  249  VAALKGSAVFNVAKYDPVTGEVAGVFESIQPSDTDLGSKAPKDVKITGLWYAQLQ  303



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPGGERV FLFTIKQ
Sbjct  119  FVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQ  178

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G  ++  G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+KN
Sbjct  179  FDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKN  236

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
              +  G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK++K+ G+WYAQL+
Sbjct  237  TKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKAPKDIKVTGLWYAQLK  291



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  T+LMTRLTYTLD + G F+V SDGSV  +E DG+DYA VTVQLPGGERVPFLFT+K+
Sbjct  128  FSKTRLMTRLTYTLDGMTGSFKVGSDGSVNVQENDGLDYAPVTVQLPGGERVPFLFTLKE  187

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G    F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EELQKEN KN
Sbjct  188  FTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADSEELQKENQKN  245

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+  G   F+V    P TGE+ GVFES+QPSDTDLGAK PK+VKI G+WYA L
Sbjct  246  TAALKGSAVFNVAKYDPATGEIAGVFESIQPSDTDLGAKVPKDVKITGLWYANL  299



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 141/175 (81%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLDE+ G F+V   G V+ +E+DGIDYAA TVQLPGGERVPFLFTIKQ
Sbjct  117  FVKTKLMTRLTYTLDEMSGTFKVDGSGKVELQEEDGIDYAATTVQLPGGERVPFLFTIKQ  176

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G  +SFSG+F+VPSYRGSSFLDPKGRG STGYDNAVALPA  R D EEL KEN K+
Sbjct  177  LNAKGTLDSFSGDFVVPSYRGSSFLDPKGRGASTGYDNAVALPA--RADAEELAKENSKS  234

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             ASS G   FS+    P TGEV GVFES+QPSDTDLGAK PK++KI GIWYAQL+
Sbjct  235  AASSKGSAVFSIAKVDPVTGEVAGVFESIQPSDTDLGAKTPKDIKITGIWYAQLQ  289



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLDEI G F V   G+V F+E+DGIDYA VTVQLPGGERVPFLFTIK+
Sbjct  143  FVKTKLMTRLTYTLDEISGKFSVDGSGNVNFKEEDGIDYAPVTVQLPGGERVPFLFTIKE  202

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G    F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALP  GR D EEL KEN K+
Sbjct  203  LNAKGSLGGFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALP--GRSDSEELAKENNKS  260

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
              +  G+  FSV    P TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  261  TVALKGQAVFSVAKVDPATGEIAGVFESIQPSDTDLGSKAPKDVKITGLWYGQL  314



>gb|AAR20846.1| oxygen-evolving enhancer protein 1 [Pseudochlorella pringsheimii]
Length=173

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KLMTRLTYTLDEI G F++   G+V+ +E+DGIDYAAVTV +PGGERVPFLFTIK+L A 
Sbjct  4    KLMTRLTYTLDEISGDFKIDGSGNVELKEEDGIDYAAVTVXMPGGERVPFLFTIKELEAK  63

Query  568  GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASS  389
            G  ++F GEF VPSYRGSSFLDPKGRGGSTGYDNA ALPA  R D +ELQKEN K+VA+ 
Sbjct  64   GTADAFGGEFTVPSYRGSSFLDPKGRGGSTGYDNAXALPA--RSDPDELQKENNKSVAAL  121

Query  388  TGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             G+  FS+    P TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  122  KGQAVFSIAKVDPATGEIAGVFESIQPSDTDLGSKAPKDVKIIGLWYGQL  171



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   244 bits (624),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 140/174 (80%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F +TKLMTRLTYTLDE+ G F+V   G+V+ +E+DGIDYA VTVQLPGGERVPFLF++KQ
Sbjct  125  FVSTKLMTRLTYTLDEMSGSFKVDGSGNVELKEEDGIDYAPVTVQLPGGERVPFLFSVKQ  184

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G  + F GEF+VPSYRGS+FLDPKGRG +TGYDNAVALPA    D EE  KENIK+
Sbjct  185  LEAKGNADGFGGEFVVPSYRGSTFLDPKGRGAATGYDNAVALPAA--SDAEEFLKENIKS  242

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+  G+  FS+    P TGE+ GVFES+QPSDTDLGAKAPK+VKI G+WYAQL
Sbjct  243  TAAMKGQAVFSIAKVDPVTGEIAGVFESVQPSDTDLGAKAPKDVKITGLWYAQL  296



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   244 bits (623),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ T+LMTRLTYTLD + G F+V SDGSV+ +E DG+DYA VTVQLPGGERVPFLFT+K+
Sbjct  129  FQKTRLMTRLTYTLDGMTGDFKVGSDGSVQIKENDGLDYAPVTVQLPGGERVPFLFTLKE  188

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G    F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EELQKEN K+
Sbjct  189  FTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADSEELQKENNKS  246

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+  G   F++    P TGE+ GVFES+QPSDTDLGAK PK+VKI G+WY  +
Sbjct  247  AAALKGSAVFNIAKYDPATGEIAGVFESIQPSDTDLGAKVPKDVKITGLWYGNI  300



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G F+V SDGSV  +E+DG+DYA VTVQLPGGERVPFLFT+K+
Sbjct  130  FVKTKLMTRLTYTLDGMTGSFKVGSDGSVAVQERDGLDYAPVTVQLPGGERVPFLFTLKE  189

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G    F G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  + D +EL KEN KN
Sbjct  190  FTGKGNTSQFGGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--KSDADELLKENNKN  247

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
            VA+  G   F+V      TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WYAQL
Sbjct  248  VAALKGSAVFNVAKYDEVTGEIAGVFESIQPSDTDLGSKAPKDVKITGLWYAQL  301



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -3

Query  751  TKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA  572
            TKLMTRLTYTLD++ G   + SDG V F+E+DGIDYA VTVQLPGGERVPFLFT+++L A
Sbjct  137  TKLMTRLTYTLDDMSGKMTIGSDGKVTFKEEDGIDYAPVTVQLPGGERVPFLFTVRELDA  196

Query  571  TGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVAS  392
             G  +SFSG+F V SYRGSSFLDPKGRGGSTGYDNAVALPA  R D+EEL KEN KN A+
Sbjct  197  KGTLDSFSGDFTVTSYRGSSFLDPKGRGGSTGYDNAVALPA--RSDDEELFKENNKNTAA  254

Query  391  STGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
              G I  SV      TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL
Sbjct  255  LKGSIVLSVAKVDASTGEIAGVFESIQPSDTDLGSKAPKDVKITGLWYGQL  305



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G F+V SDGSV   EKDGIDYA  TVQL GGERVPFLFT+K+
Sbjct  159  FAKTKLMTRLTYTLDAMSGDFKVGSDGSVNVVEKDGIDYAPTTVQLAGGERVPFLFTLKE  218

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G    F G+F+V SYRGSSFLDPKGRGGSTGYDNAVALPA  R D ++LQKEN KN
Sbjct  219  LQAKGNTSQFGGDFVVASYRGSSFLDPKGRGGSTGYDNAVALPA--RSDADDLQKENNKN  276

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VA+  G   F+V      TGE+ GVFES+QPSDTDLG+KAPK+VKI G+WY QL+
Sbjct  277  VAALKGSAVFNVAKYDETTGEIAGVFESIQPSDTDLGSKAPKDVKITGLWYMQLQ  331



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   241 bits (615),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 135/175 (77%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPGGERV FLFTIKQ
Sbjct  119  FVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQ  178

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G  ++  G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K 
Sbjct  179  FDGKGTLDNIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKI  236

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
              +  G   FSV    P TGE+ GVFES+QPSDTDLGAK PK++K+ G+WYAQL+
Sbjct  237  TKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK  291



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 134/175 (77%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G F+V SDGS + +E DGIDYAA TVQLPGGERV FLFTIKQ
Sbjct  119  FVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQ  178

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G  +   G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K 
Sbjct  179  FDGKGTLDGIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKI  236

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
              +  G   FSV    P TGE+ GVFES+QPSDTDLGAK PK++K+ G+WYAQL+
Sbjct  237  TKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK  291



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   239 bits (610),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKL+TRLTYTLDEI G  ++   G V+F+E+DGIDYAAVTVQLPGGERVPFLFTIK+
Sbjct  131  FVPTKLVTRLTYTLDEISGQMKIDGSGGVEFKEEDGIDYAAVTVQLPGGERVPFLFTIKE  190

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G  + F GEF VPSYRGSSFLDPKGRG STGYDNAVALPA   GD EEL+KEN K+
Sbjct  191  LDAKGTADGFKGEFTVPSYRGSSFLDPKGRGASTGYDNAVALPAA--GDSEELEKENNKS  248

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
              +  G+  FS+      TGEV G+FES+QPSDTDLGAK PKEVKI G+WY QL
Sbjct  249  TKALKGEAIFSIAKVDAGTGEVAGIFESIQPSDTDLGAKVPKEVKITGLWYGQL  302



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F + KLMTRLTYTLD + G  +V S G+++F+E+DGIDYA  TVQLPGG RVPFLFT+K+
Sbjct  152  FIDVKLMTRLTYTLDAMSGSMKVGSGGAIEFKEEDGIDYAPTTVQLPGGARVPFLFTVKE  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G   SFSG+F VPSYRGS+FLDPKGRG +TGYD AVA+PAGG GDE+ L KEN K+
Sbjct  212  LDAKGDVSSFSGDFAVPSYRGSTFLDPKGRGAATGYDTAVAIPAGGAGDEDALGKENNKS  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            +    GK   S+      TGEV GVF+S+QPSDTDLGAK PK++KIQG+WYAQL+
Sbjct  272  IKPLAGKAQLSIAKYDAATGEVAGVFQSIQPSDTDLGAKVPKDIKIQGLWYAQLQ  326



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G  +V SDGS + +E+DGIDYAA TVQLPGGERV FLFTIKQ
Sbjct  124  FVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQ  183

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G  ++  G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K+
Sbjct  184  FDGKGTLDNIKGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKS  241

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
              +  G   FSV      TGE+ GVFES+QPSDTDLGAK PK++KI G+WY QL
Sbjct  242  TKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKITGLWYGQL  295



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G  +V SDGS + +E+DGIDYAA TVQLPGGERV FLFTIKQ
Sbjct  120  FVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQ  179

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
                G  ++  G+F+VPSYRGSSFLDPKGRGGSTGYDNAVALPA  R D EEL KEN+K+
Sbjct  180  FDGKGTLDNIKGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKS  237

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
              +  G   FSV      TGE+ GVFES+QPSDTDLGAK PK++KI G+WY QL
Sbjct  238  TKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKITGLWYGQL  291



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F +TKLMTRLTYTLD + G  +V S G+++F E+DGID A  TVQLPGG RVPFLFT+K+
Sbjct  152  FIDTKLMTRLTYTLDAMSGSMKVGSGGAIEFAEEDGIDNAPTTVQLPGGSRVPFLFTVKE  211

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G   +F G+F VPSYRGS+FLDPKGRG +TGYD AVA+PAGG GDEE L KEN K+
Sbjct  212  LNAKGDISAFGGDFSVPSYRGSTFLDPKGRGAATGYDTAVAIPAGGAGDEEALGKENNKS  271

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
            +    GK   S+    P TGEV GVF+S+QPSDTDLGAK PK++K+QG+WYAQL
Sbjct  272  IKPLVGKAQLSIAKYDPATGEVAGVFQSVQPSDTDLGAKVPKDIKVQGVWYAQL  325



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  TKLMTRLTYTLD + G F+V   G+V+ +E DGIDYA VTVQLPGGERVPFLF++KQ
Sbjct  117  FVATKLMTRLTYTLDGMTGTFKVDGSGNVELKEDDGIDYAPVTVQLPGGERVPFLFSVKQ  176

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            + A G  ++F G+F+VPSYRGS+FLDPKGRG S GY++A+AL      D+E + KEN+K+
Sbjct  177  ITAKGAADAFGGDFVVPSYRGSTFLDPKGRGASQGYESAIALQTA--QDDEFVLKENVKS  234

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            VA+S G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK+VKI G+WYAQL+
Sbjct  235  VAASKGSAVFSVAKVDPSTGEIAGVFESVQPSDTDLGAKAPKDVKITGLWYAQLQ  289



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  147  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  206

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKP+SFSG+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEEL+KEN+KN
Sbjct  207  LVASGKPDSFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELEKENLKN  266

Query  400  VASSTGKITFSVTGS  356
             ASS GKITFSVT S
Sbjct  267  TASSRGKITFSVTKS  281



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I     V  DGS   +EKDG+DYAA TVQL GGERVPFLFTIK 
Sbjct  209  FERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVPFLFTIKN  268

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L+A G    F G+F VPSYRG++FLDPKGRGG++GYD AVALPA   GD+EE  KEN K+
Sbjct  269  LLAKGDAGQFLGQFDVPSYRGATFLDPKGRGGASGYDTAVALPAS--GDDEEYAKENSKS  326

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+S G I F V     ETGE+ GVFES+QPSDTDLGAK PK++K  G+WYAQ+
Sbjct  327  TAASVGTIAFKVAKVNAETGEIAGVFESIQPSDTDLGAKVPKDIKTSGVWYAQI  380



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I     V  DGS   +EKDG+DYAA TVQL GGERVPFLFTIK 
Sbjct  163  FERTKLMTRLTYTLDAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVPFLFTIKN  222

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L+A G    F G+F VPSYRG++FLDPKGRGG++GYD AVALPA   GD+EE  KEN K+
Sbjct  223  LLAKGDAGQFLGQFDVPSYRGATFLDPKGRGGASGYDTAVALPAS--GDDEEYAKENSKS  280

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
             A+S G I F V     ETGE+ GVFES+QPSDTDLGAK PK++K  G+WYAQ+
Sbjct  281  TAASVGTIAFKVAKVNAETGEIAGVFESIQPSDTDLGAKVPKDIKTSGVWYAQI  334



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFE-EKDGIDYAAVTVQLPGGERVPFLFTIK  584
            F  TKLMTRLTYTLD + G   V SDGSV F+ + +GID+A  TVQLPGGERVPFLFT K
Sbjct  129  FVKTKLMTRLTYTLDGLSGKMTVGSDGSVDFKKDNEGIDFAPTTVQLPGGERVPFLFTFK  188

Query  583  QLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIK  404
            Q    G  + FSG+F VPSYRGSSFLDPKGRGGSTGYD AV LPA  +GD EEL KENIK
Sbjct  189  QFAGKGTVDGFSGDFTVPSYRGSSFLDPKGRGGSTGYDTAVGLPA--KGDAEELLKENIK  246

Query  403  NVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
            + A+  G   FSV      TGEV G+FES+QPSDTDLGAK PK+VKI G+WY Q+
Sbjct  247  STAALKGSAVFSVAKVDSGTGEVAGIFESVQPSDTDLGAKVPKDVKITGVWYGQI  301



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I     V  DGS K +E DGIDYAA TVQL GGERVPFLFT+K 
Sbjct  172  FEKTKLMTRLTYTLDGIRADLAVGGDGSWKIKEIDGIDYAATTVQLAGGERVPFLFTVKN  231

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+G    F G+F V SYRG++FLDPKGRG +TGYDNAVALPA    D EEL KEN KN
Sbjct  232  LAASGDAGQFLGQFDVASYRGATFLDPKGRGAATGYDNAVALPAA--SDTEELAKENTKN  289

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
            +A S G I F V     ETGEV GVFES+QPSDTDLG+K PK++K  G+WY Q+
Sbjct  290  IAGSVGTIAFKVAKVNTETGEVAGVFESIQPSDTDLGSKVPKDIKTAGVWYGQI  343



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 135/175 (77%), Gaps = 2/175 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            +  TKLMTRLTYTLDEI G   V + G V F E+DGIDYA VTVQLPGGERVPFLFT+K+
Sbjct  131  YVQTKLMTRLTYTLDEISGALTVGAAGDVTFVEEDGIDYAPVTVQLPGGERVPFLFTVKE  190

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G    F G+F VPSYRG++FLDPKGRG +TGYDNAVALPA    D EEL KEN+KN
Sbjct  191  LNAKGNLSQFGGDFTVPSYRGATFLDPKGRGNATGYDNAVALPA--AADAEELLKENVKN  248

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
             A+  G   F+V    P+TGEV GVFES+QPSDTDLGAKAPK+VKI G+WYAQ+ 
Sbjct  249  TAALKGSAVFNVAKFDPKTGEVAGVFESIQPSDTDLGAKAPKDVKITGLWYAQIN  303



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 127/162 (78%), Gaps = 2/162 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F +TKLMTRLTYTLD+I G  ++ SDG V FEE+DGIDYA  T+QLPGGERV FLFT+KQ
Sbjct  182  FVDTKLMTRLTYTLDDISGKLKLGSDGKVTFEEEDGIDYAPTTIQLPGGERVAFLFTVKQ  241

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A+G   + +GEF VPSYRGSSFLDPKGRGGSTGYD AVALPA  RGD+E L KEN KN
Sbjct  242  LRASGSLSNLAGEFNVPSYRGSSFLDPKGRGGSTGYDTAVALPA--RGDDEGLAKENSKN  299

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPK  275
             A+  G I  S     P TGE+ GVF+S+QPSDTDLGAK+PK
Sbjct  300  TAALKGSIVLSAAKVDPATGEIAGVFQSIQPSDTDLGAKSPK  341



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = -3

Query  604  PFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            P  FT+KQLVA+GKP+SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE
Sbjct  139  PTSFTVKQLVASGKPDSFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  198

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L KEN K+ ASS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+VKI G+WYA
Sbjct  199  LAKENNKSAASSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDVKITGVWYA  258

Query  244  QLE  236
            QL+
Sbjct  259  QLD  261



>ref|WP_026721744.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9431]
Length=277

 Score =   210 bits (534),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 132/183 (72%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   KL+TR TY+LD+IEG   V+SDGS+ F EKDG D+ A TVQLPGGERVPFLFTIK 
Sbjct  93   FVAGKLVTRKTYSLDQIEGDLNVNSDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTIKG  152

Query  580  LVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+EE
Sbjct  153  LVAQSQPGMTSINTSTDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDEE  210

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L + N+K V    GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK++GI+YA
Sbjct  211  LLRANVKRVDVLNGKISLSVAKVDSSTGEIAGTFESDQPSDTDLGAGEPKDVKVRGIFYA  270

Query  244  QLE  236
            +LE
Sbjct  271  RLE  273



>ref|WP_026733494.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9605]
Length=276

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR TY+LD+I+G  +++SDGS+ F EKDG D+ A TVQLPGGERVPFLFTIK LVA 
Sbjct  96   KLLTRKTYSLDQIQGDLKINSDGSLTFVEKDGFDFQASTVQLPGGERVPFLFTIKGLVAQ  155

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG +TGYDNAVALPA  + D+EEL + 
Sbjct  156  SQPGMTSINTSTDFEGAFRVPSYRGATFLDPKGRGVATGYDNAVALPA--QSDDEELTRA  213

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VKI+GI+YA++E
Sbjct  214  NVKRTDILNGKISLSVAKVDSATGEIAGTFESEQPSDTDLGAGEPKDVKIRGIFYARVE  272



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  154  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  213

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVAL  455
            LVA+GKPESFSGE+LVPSYRGSSFLDPKGRG STGYDNAVAL
Sbjct  214  LVASGKPESFSGEYLVPSYRGSSFLDPKGRGASTGYDNAVAL  255



>ref|WP_016865127.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   207 bits (527),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 131/183 (72%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   KL+TR TY+LD+IEG  +V+ DGS+ F EKDG D+ A TVQLPGGERVPFLFTIK 
Sbjct  93   FVAGKLVTRKTYSLDQIEGDLKVNPDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTIKG  152

Query  580  LVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVA  +P          F G F VPSYRG++FLDPKGRG +TGYD+AVALPA  + D+EE
Sbjct  153  LVAQSQPGMTSINTSTDFEGTFRVPSYRGATFLDPKGRGVATGYDSAVALPA--QSDDEE  210

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PKEVK++GI+YA
Sbjct  211  LLRANVKRADVLNGKISLSVAKVDSSTGEIAGTFESEQPSDTDLGAGEPKEVKVRGIFYA  270

Query  244  QLE  236
            +LE
Sbjct  271  RLE  273



>ref|WP_016860504.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 132/183 (72%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   KL+TR TY+LD+IEG  +++SDGS+ F EKDG D+ A TVQLPGGERVPFLFT+K 
Sbjct  93   FVAGKLVTRKTYSLDQIEGDLKINSDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTVKG  152

Query  580  LVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+EE
Sbjct  153  LVAQSQPGMTSINTSTDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDEE  210

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L + N+K      GKI+ SV      +GE+ G FES QPSDTDLGA  PK+VK++GI+YA
Sbjct  211  LLRANVKRADVLNGKISLSVAKVDSSSGEIAGTFESDQPSDTDLGAGEPKDVKVRGIFYA  270

Query  244  QLE  236
            +LE
Sbjct  271  RLE  273



>ref|WP_017720228.1| Photosystem II manganese-stabilizing polypeptide [Oscillatoria 
sp. PCC 10802]
Length=274

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 130/179 (73%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T TL +I+G  +  SDG++ FEEKDGID+ A+TVQLPGGE VPFLFTIK LVAT
Sbjct  95   KLLTRYTSTLTQIQGALKFGSDGTLTFEEKDGIDFQAITVQLPGGEGVPFLFTIKNLVAT  154

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G+F VPSYRGSSFLDPKGRG +TGYDNAVA PAG   D EEL + 
Sbjct  155  SQPGLTEINTSTDFEGQFKVPSYRGSSFLDPKGRGEATGYDNAVATPAG--ADREELIRA  212

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K    S GKI+  ++     TGE+ G+FES QPSDTDLGA+ P EVKI+G++Y +++
Sbjct  213  NVKRAEVSKGKISLQISKVDSSTGEIAGIFESEQPSDTDLGAQEPLEVKIRGVFYGRVQ  271



>ref|WP_009456798.1| MULTISPECIES: photosystem II manganese-stabilizing protein PsbO 
[Fischerella]
 gb|EHC13949.1| photosystem II manganese-stabilizing protein PsbO [Fischerella 
sp. JSC-11]
Length=277

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 130/183 (71%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   KL+TR TY+LD+IEG  +++ DGS+ F EKDG D+   TVQLPGGERVPFLFTIK 
Sbjct  93   FVAGKLVTRKTYSLDQIEGDLKINPDGSLTFVEKDGFDFQPTTVQLPGGERVPFLFTIKG  152

Query  580  LVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVA  +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+EE
Sbjct  153  LVAQSQPGMTSINTSTDFEGTFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDEE  210

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PKEVK++GI+YA
Sbjct  211  LLRANVKRADVMNGKISLSVAKVDSSTGEIAGTFESEQPSDTDLGAGEPKEVKVRGIFYA  270

Query  244  QLE  236
            +LE
Sbjct  271  RLE  273



>ref|WP_017310215.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9339]
Length=277

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 130/179 (73%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR TY+LD+IEG  +++SDGS+ F EKDG D+ A TVQL GGERVPFLFTIK LVA 
Sbjct  97   KLVTRKTYSLDQIEGDLKINSDGSLTFVEKDGFDFQATTVQLAGGERVPFLFTIKGLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+EEL + 
Sbjct  157  SQPGMTSINTSTDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDEELLRA  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK++GI+YA+LE
Sbjct  215  NVKRADVLNGKISLSVAKVDSSTGEIAGTFESDQPSDTDLGAGEPKDVKVRGIFYARLE  273



>gb|AIR09396.1| psbO, partial [Trachelomonas abrupta]
Length=151

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 113/153 (74%), Gaps = 2/153 (1%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KLMTRLTYTLD I     V  DGS K +E DGIDYAA TVQL GGERVPFLFT+K L A 
Sbjct  1    KLMTRLTYTLDGIRADLTVGGDGSWKIKEIDGIDYAATTVQLAGGERVPFLFTVKNLDAK  60

Query  568  GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKNVASS  389
            G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD EEL KEN K+ A+S
Sbjct  61   GDANQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDSEELAKENYKSTAAS  118

Query  388  TGKITFSVTGSKPETGEVIGVFESLQPSDTDLG  290
             G I F V     ETGEV GVFES+QP+DTDLG
Sbjct  119  VGTIAFKVAKVNAETGEVAGVFESIQPTDTDLG  151



>ref|WP_009768009.1| Manganese-stabilising protein / photosystem II polypeptide [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ68898.1| Manganese-stabilising protein / photosystem II polypeptide [Oscillatoriales 
cyanobacterium JSC-12]
Length=274

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 133/183 (73%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F  +KLMTR T T+DE++G  +++ DGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK+
Sbjct  91   FVPSKLMTRYTSTIDEVQGQLKLNPDGSLTFIEEDGLDFQAITVQLPGGERVPFLFTIKE  150

Query  580  LVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVAT +P          F GEF VPSYR ++FLDPKGRG +TGYDNAVALPA  + D EE
Sbjct  151  LVATTQPGLSAINASTDFEGEFKVPSYRTANFLDPKGRGLTTGYDNAVALPA--QADSEE  208

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L KEN+K      GKI+  VT     TGE+ G FES QPS+TD+G+   KEVKI+G++Y 
Sbjct  209  LVKENVKRFQLDKGKISLQVTRVDGSTGEIAGNFESNQPSETDMGSHEAKEVKIRGVFYG  268

Query  244  QLE  236
            ++E
Sbjct  269  RVE  271



>ref|WP_012411115.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme]
 gb|ACC83159.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme 
PCC 73102]
Length=277

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 130/179 (73%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D+++G  +++SD S+ FEE DG+D+ A+TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVQGNLKINSDNSLTFEETDGLDFQAITVQLPGGERVPFLFTIKNLVAQ  156

Query  568  GKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL + 
Sbjct  157  TQPSLSSINTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEELTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K   +  GKI+  +      +GE+ G FES QPSDTDLGA  PKEVKI+G+++A++E
Sbjct  215  NVKRAENLNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFFARVE  273



>ref|WP_015115272.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
 gb|AFY45079.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
Length=277

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 131/183 (72%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   KL+TR T T+D+++GP + +SDGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK 
Sbjct  93   FVAGKLLTRYTSTIDQVQGPLKFNSDGSLTFVEEDGLDFQAITVQLPGGERVPFLFTIKD  152

Query  580  LVATGK--------PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVA  +           F GEF VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EE
Sbjct  153  LVAQTQSGLTSINTSTDFEGEFKVPSYRGAAFLDPKGRGIVSGYDNAVALPA--QADDEE  210

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++YA
Sbjct  211  LTRANVKRAEILKGKISLQVAKIDNSSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYA  270

Query  244  QLE  236
            ++E
Sbjct  271  RVE  273



>gb|AFK26084.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena stellata]
Length=248

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I    +V  DGS   +EKDGIDYAA TVQL GGERVPFLFT+K 
Sbjct  96   FEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDGIDYAATTVQLAGGERVPFLFTVKN  155

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE  KEN K+
Sbjct  156  LEAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEFAKENSKS  213

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTD  296
             AS  G I F V     ETGE+ GVFES+QPSDTD
Sbjct  214  TASGVGTIAFKVAKVNAETGEIAGVFESIQPSDTD  248



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 113/144 (78%), Gaps = 14/144 (10%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQ TKLMTRLTYTLDEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ
Sbjct  147  FQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  206

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            LVA+GKPESFSG+FLVPSYRGSSFLDPKGRG             GG  + E       K 
Sbjct  207  LVASGKPESFSGDFLVPSYRGSSFLDPKGRGWIHWL--------GGAPERER------KE  252

Query  400  VASSTGKITFSVTGSKPETGEVIG  329
               STGKITF+VT S P+TGEVIG
Sbjct  253  YRVSTGKITFTVTKSNPQTGEVIG  276



>gb|AFK26085.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Monomorphina pyrum]
Length=237

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I    +V  DGS K +E DGIDYAA TVQL GGERVPFLFT+K 
Sbjct  86   FEKTKLMTRLTYTLDGIRADLQVGGDGSWKIKEIDGIDYAATTVQLAGGERVPFLFTVKN  145

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE  KEN K+
Sbjct  146  LQAQGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEFAKENAKS  203

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDT  299
             ASS G I F V     ETGEV GVFES+QP DT
Sbjct  204  AASSVGTIAFKVAKVNAETGEVAGVFESIQPGDT  237



>gb|AFK26083.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena pseudostellata]
Length=249

 Score =   199 bits (506),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I    +V  DGS   +EKDGIDYAA TVQL GGERVPFLFT+K 
Sbjct  97   FEKTKLMTRLTYTLDGIRADLQVGGDGSWTLKEKDGIDYAATTVQLAGGERVPFLFTVKN  156

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE  KEN K+
Sbjct  157  LEAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEFAKENSKS  214

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTD  296
             AS  G I F V     ETGE+ GVFES+QPSDTD
Sbjct  215  TASGVGTIAFKVAKVNAETGEIAGVFESIQPSDTD  249



>emb|CAA33560.1| manganese-stabilzing protein (MSP) precursor [Nostoc sp. PCC 
7120]
Length=273

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRGS+FLDPKGRG  +GYDNAVALPA  + D+E+L + 
Sbjct  157  TQPGLSSLNTSTDFEGTFKVPSYRGSAFLDPKGRGVVSGYDNAVALPA--QADDEDLTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVKI+GI+YA++E
Sbjct  215  NVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVKIRGIFYARVE  273



>ref|WP_016872421.1| Photosystem II manganese-stabilizing polypeptide [Chlorogloeopsis 
fritschii]
Length=277

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR TY+LD+I+G  +V+ DGS+ F EKDG D+ A TV+LPGGE VPFLFT+K LVA 
Sbjct  97   KLLTRKTYSLDQIQGDLKVNPDGSLTFVEKDGFDFQAATVKLPGGEMVPFLFTVKGLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + DEE+L + 
Sbjct  157  SQPGMTSINTSTDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDEEQLLRA  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+ S+      TGE+ G FES QPSDTDLGA  P+EVK++GI+YA++E
Sbjct  215  NVKRADVLEGKISLSIAKVDSATGEIAGTFESEQPSDTDLGADEPEEVKVRGIFYARVE  273



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 127/172 (74%), Gaps = 5/172 (3%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F +TKL+TRLTYTLDE+EG F V SDGS++  E++G+D+AAVTVQ+PGGERVPFLFT+K+
Sbjct  68   FSDTKLLTRLTYTLDEMEGKFVVGSDGSLRVTEEEGLDFAAVTVQMPGGERVPFLFTVKE  127

Query  580  LVATGKPE-SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIK  404
            L   GK + +  G FLVPSYRGS+FLDPKGRGGSTGY+    +  G + D E  + +N K
Sbjct  128  LDLKGKVDGNLEGSFLVPSYRGSTFLDPKGRGGSTGYN----VVQGVQADAENEEFKNEK  183

Query  403  NVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  248
               S TGK  FS+    P TG V GVFE++ PSDTDLGAK  ++VK  GIWY
Sbjct  184  TTESGTGKAVFSIAKVDPSTGGVAGVFETVSPSDTDLGAKEARDVKTNGIWY  235



>ref|WP_041036292.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
campylonemoides]
 gb|KIJ75950.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
campylonemoides VB511288]
Length=277

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR TY+LD+I G  +V+ D S+ F EKDG D+ A+TV+LPGGE VPFLFT+K LVA 
Sbjct  97   KLLTRRTYSLDQIIGDLKVNPDNSLTFVEKDGFDFQAITVKLPGGESVPFLFTVKGLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG+SFLDPKGRG ++GYDNAVALPA  + D+EEL++ 
Sbjct  157  TQPGLTSINTSTDFEGSFRVPSYRGASFLDPKGRGVTSGYDNAVALPA--QSDDEELRRA  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  V      TGE+ G FES QPSDTDLGAK P+EVK++G++YA++E
Sbjct  215  NVKQAEILKGKISLQVAKVDNSTGEIAGTFESEQPSDTDLGAKEPEEVKVRGLFYARVE  273



>gb|AFK26082.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena granulata]
Length=239

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 113/155 (73%), Gaps = 2/155 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I     V  DGS    EKDGIDYAA TVQL GGERVPFLFT+K 
Sbjct  87   FERTKLMTRLTYTLDGIRADLTVGGDGSWSIXEKDGIDYAATTVQLAGGERVPFLFTVKN  146

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            + A G    F G+F VPSYRG++FLDPKGRGG+TGYD AVALPA   GD+EE  KEN+K+
Sbjct  147  MEAKGDAGQFLGQFDVPSYRGATFLDPKGRGGATGYDTAVALPAA--GDDEEYAKENVKS  204

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTD  296
             A + G I F V     ETGE+ GVFES+QPSDTD
Sbjct  205  AAGAVGTIAFKVAKVDVETGEIAGVFESIQPSDTD  239



>ref|WP_015209602.1| Manganese-stabilising protein / photosystem II polypeptide [Cylindrospermum 
stagnale]
 gb|AFZ26360.1| Manganese-stabilising protein / photosystem II polypeptide [Cylindrospermum 
stagnale PCC 7417]
Length=277

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 128/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D+++G  +++ D S+ F E DG+D+ A+TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVQGNLKINPDNSLTFVETDGLDFQAITVQLPGGERVPFLFTIKNLVAQ  156

Query  568  GKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL + 
Sbjct  157  TQPSLTSINTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEELTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K     +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  215  NVKRAEILSGKISLQVAKVDNSSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYARVE  273



>dbj|BAJ61705.1| oxygen-evolving enhancer protein [Porphyridium purpureum]
Length=287

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 130/183 (71%), Gaps = 9/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F +TKLMTR TYTL  IEGP  V+++G ++F+EKDGIDYAA TVQLPGGERVPFLFT+K+
Sbjct  102  FVDTKLMTRATYTLTGIEGPLTVNANGDLEFQEKDGIDYAATTVQLPGGERVPFLFTVKE  161

Query  580  LVATGKPES------FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALP---AGGRGDEE  428
            LVAT K +S      F GEF VPSYR   FLDPKGRGG TGYD AVALP   A G   ++
Sbjct  162  LVATAKGDSIGSGTEFGGEFTVPSYRTGLFLDPKGRGGVTGYDMAVALPGMMADGAEGQD  221

Query  427  ELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWY  248
            EL KE  K    + G+I   V    P T E+ GVF S Q +DTD+GAKAPK + ++G++Y
Sbjct  222  ELFKETNKVFQVTKGEIEMGVQKVDPSTNEIAGVFVSEQLTDTDMGAKAPKNILLKGVFY  281

Query  247  AQL  239
            A++
Sbjct  282  ARI  284



>ref|WP_010997995.1| manganese-stabilzing protein [Nostoc sp. PCC 7120]
 sp|P13907.2|PSBO_NOSS1 RecName: Full=Photosystem II manganese-stabilizing polypeptide; 
Short=MSP; Flags: Precursor [Nostoc sp. PCC 7120]
 dbj|BAB75553.1| manganese-stabilzing protein precursor [Nostoc sp. PCC 7120]
Length=273

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+E+L + 
Sbjct  157  TQPGLSSLNTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEDLTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVKI+GI+YA++E
Sbjct  215  NVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVKIRGIFYARVE  273



>ref|WP_011318645.1| photosystem II manganese-stabilizing protein PsbO [Anabaena variabilis]
 gb|ABA21465.1| Photosystem II manganese-stabilizing protein PsbO [Anabaena variabilis 
ATCC 29413]
Length=273

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+E+L + 
Sbjct  157  TQPGLSSLNTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEDLTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVKI+GI+YA++E
Sbjct  215  NVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVKIRGIFYARVE  273



>ref|WP_040939353.1| Photosystem II manganese-stabilizing polypeptide [Prochloron 
didemni]
Length=277

 Score =   198 bits (503),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 128/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T +LD++ G  +V+ DGS+ F E+DGID+ A+TVQ+PGGE+ PF FTIK LVAT
Sbjct  98   KLLTRSTSSLDQVSGSIKVNEDGSLTFLEEDGIDFQAITVQVPGGEQTPFFFTIKNLVAT  157

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             KP          F GEF VPSYRG+ FLDPKGRG +TGY+NAVALPAG   D +E  + 
Sbjct  158  TKPGQDKIDSSTDFEGEFKVPSYRGAGFLDPKGRGAATGYENAVALPAG--ADRDEYARS  215

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K + +  G I+  +T     TGE+ GVFES QPSDTDLGA  P+EVKI+GI+Y +++
Sbjct  216  NMKQIDTGKGNISLQITKVDGTTGEIAGVFESEQPSDTDLGADEPEEVKIKGIFYGRIQ  274



>ref|WP_015117115.1| Manganese-stabilising protein / photosystem II polypeptide [Rivularia 
sp. PCC 7116]
 gb|AFY53537.1| Manganese-stabilising protein / photosystem II polypeptide [Rivularia 
sp. PCC 7116]
Length=279

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 132/183 (72%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   + +TR T +LD+I+G  +V+ DGS+ FEEKDG D+ A+TVQLPGGE+VPFLFT+K 
Sbjct  96   FIGARQLTRKTSSLDQIQGDLKVNQDGSLTFEEKDGFDFQAITVQLPGGEQVPFLFTVKD  155

Query  580  LVATGKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVA  +P+         F G+F VPSYRG++FLDPKGRG ++GYDNAVALP+  + D EE
Sbjct  156  LVAQTQPDLTSINTSTDFEGDFKVPSYRGATFLDPKGRGVASGYDNAVALPS--QADSEE  213

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L++ N+K V S  G I+ +V     ETGE+ G F S QPSDTDLGA    +VK++G++YA
Sbjct  214  LRRANVKRVESGNGHISLNVAKVDSETGEIAGTFVSDQPSDTDLGAGEALDVKVRGLFYA  273

Query  244  QLE  236
            ++E
Sbjct  274  RVE  276



>ref|WP_017322486.1| Photosystem II manganese-stabilizing polypeptide [cyanobacterium 
PCC 7702]
Length=277

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR TY+LD+I+G  +V+ DGS+ FEEK+G D+  +TV+LPGGE VPFLFTIK LVA 
Sbjct  97   KLLTRQTYSLDQIQGDLKVNPDGSLTFEEKEGFDFQPITVKLPGGETVPFLFTIKGLVAQ  156

Query  568  GKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG ++GYD AVALPA  + D+EEL + 
Sbjct  157  SQPSMTSINTSTDFEGTFRVPSYRGATFLDPKGRGVASGYDAAVALPA--QSDDEELLRA  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK++GI+YA++E
Sbjct  215  NVKRAEVLNGKISLSVAKVDSATGEIAGTFESEQPSDTDLGADEPKDVKVRGIFYARVE  273



>ref|WP_036480960.1| Photosystem II manganese-stabilizing polypeptide [Myxosarcina 
sp. GI1]
Length=275

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 127/179 (71%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T TLD++ G  E + DGS+ F E DGID+ A TVQLPGGE VPFLFTIK+LVAT
Sbjct  96   KLLTRYTSTLDQVRGTVESNEDGSLTFTELDGIDFQAATVQLPGGEEVPFLFTIKELVAT  155

Query  568  GKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             K           F GEF VPSYRG  FLDPKGR  ++GYDNAVALPA  R D+EE  + 
Sbjct  156  SKSGSSSIDSSTDFEGEFSVPSYRGQVFLDPKGRSLASGYDNAVALPA--RADDEEFTRA  213

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K   S  G+++ +VT    ETGE+ GVFES QPS TDLGA+ P+EVK++GI+Y ++E
Sbjct  214  NVKEFVSRKGRMSLNVTKVDTETGEIAGVFESEQPSATDLGAEEPEEVKVRGIFYGRVE  272



>ref|WP_017286598.1| hypothetical protein [Leptolyngbya boryana]
Length=275

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 128/182 (70%), Gaps = 10/182 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   KLMTR T ++D + G  + +SDGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK 
Sbjct  92   FVPAKLMTRYTSSIDAVSGTLKSNSDGSLTFTEEDGLDFQAITVQLPGGERVPFLFTIKG  151

Query  580  LVATGKPES--------FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVAT  P S        F+GEF VPSYR S+FLDPKGRG +TGYDNAVALPA    D EE
Sbjct  152  LVATTDPGSSSINTSTDFTGEFRVPSYRTSNFLDPKGRGLTTGYDNAVALPAS--ADSEE  209

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L+KEN+K      G I+  V      +GE+ G FES QPS+TD+G++   EVKI+G++YA
Sbjct  210  LRKENVKRFQLDKGTISLQVAKIDSASGEIAGTFESDQPSETDMGSREASEVKIRGLFYA  269

Query  244  QL  239
            ++
Sbjct  270  RV  271



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   193 bits (491),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            FQNTKLMTRLTYTLDEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQ
Sbjct  73   FQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQ  132

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  467
            L A+GKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN
Sbjct  133  LTASGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDN  170



>gb|AFK26080.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Discoplastis spathirhyncha]
Length=239

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F+ TKLMTRLTYTLD I     V  DGS   +E DGIDYAA TVQL GGERVPFLFT+K 
Sbjct  86   FEKTKLMTRLTYTLDGIRADLTVGGDGSWTIKEIDGIDYAATTVQLAGGERVPFLFTVKN  145

Query  580  LVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENIKN  401
            L A G    F G+F V SYRG++FLDPKGRGG+TGYD AVALPA   GD EE  KEN K+
Sbjct  146  LQAKGDAGQFIGQFDVASYRGATFLDPKGRGGATGYDTAVALPAA--GDSEEYAKENSKS  203

Query  400  VASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDL  293
             A S G I F V     ETGEV GVFES+QPSDTDL
Sbjct  204  TAGSVGTIAFKVAKVNAETGEVAGVFESIQPSDTDL  239



>ref|WP_015139796.1| Manganese-stabilising protein / photosystem II polypeptide [Nostoc 
sp. PCC 7524]
 gb|AFY49369.1| Manganese-stabilising protein / photosystem II polypeptide [Nostoc 
sp. PCC 7524]
Length=277

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D++ G  +++ D S+ F E DG+D+ A+TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVSGDLKINPDNSLTFVENDGLDFQAITVQLPGGERVPFLFTIKGLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL + 
Sbjct  157  TQPGLTSVNTSTDFEGSFKVPSYRGAAFLDPKGRGIVSGYDNAVALPA--QADDEELTRA  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++YA++E
Sbjct  215  NVKRAEILNGKISLQVAKVDSSSGEIAGTFESNQPSDTDLGADEPKEVKIRGLFYARVE  273



>ref|WP_015127963.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
sp. PCC 7507]
 gb|AFY32146.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
sp. PCC 7507]
Length=278

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   KL+TR T T+D+++G  +++ D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK 
Sbjct  94   FVAGKLLTRYTSTIDQVQGDLKINPDNSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKN  153

Query  580  LVATGKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVA  +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D++E
Sbjct  154  LVAQSQPGLSSVSTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDDE  211

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L + N+K   + +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++Y 
Sbjct  212  LTRTNVKRAENLSGKISLQVAKIDGVSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYG  271

Query  244  QLE  236
            ++E
Sbjct  272  RVE  274



>gb|KIE10612.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
bouteillei VB521301]
Length=275

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR TY+LD+I G  +V+SDGS+ F EKDG D+ A TV+LPGGE +PFLFT+K LVA 
Sbjct  96   KLLTRRTYSLDQIMGDLDVNSDGSLTFVEKDGFDFQAATVKLPGGESIPFLFTVKGLVAQ  155

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+ EL   
Sbjct  156  SQPGLSSINTSTDFEGTFKVPSYRGATFLDPKGRGVASGYDNAVALPA--QADDRELVNA  213

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  V      TGE+ G FES QPSDTDLGAK P+EVKI+G++YA+LE
Sbjct  214  NVKRTDVLKGKISLQVAKVDNVTGEIGGTFESEQPSDTDLGAKEPEEVKIRGLFYARLE  272



>ref|WP_039748810.1| Photosystem II manganese-stabilizing polypeptide [Hassallia byssoidea]
 gb|KIF33095.1| Photosystem II manganese-stabilizing polypeptide [Hassallia byssoidea 
VB512170]
Length=276

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 128/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D+++G  +V+ D S+ F EKDG+D+ A TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVQGDIKVNPDNSLTFVEKDGLDFQATTVQLPGGERVPFLFTIKNLVAK  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F GEF VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+++L + 
Sbjct  157  SQPGLTSINTSTDFEGEFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADKKDLTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      G+I+ S+      TGE+ G F+S QPSDTDLGA  PKEVKI+G++Y ++E
Sbjct  215  NVKRAEVLKGRISLSIAKVDSATGEIAGTFQSDQPSDTDLGAGEPKEVKIRGLFYGRVE  273



>ref|WP_017745622.1| Photosystem II manganese-stabilizing polypeptide [Scytonema hofmanni]
Length=275

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR TY+LD+I G   V+SDGS+ F EKDG D+ A TV+LPGGE +PFLFT+K LVA 
Sbjct  96   KLLTRRTYSLDQISGDLNVNSDGSLTFVEKDGFDFQAATVKLPGGESIPFLFTVKGLVAQ  155

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+ EL   
Sbjct  156  SQPGLTSINTSTDFEGSFKVPSYRGATFLDPKGRGVASGYDNAVALPA--QADDSELVNA  213

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  V      TGE+ G FES QPSDTDLGAK P+EVKI+G++YA+LE
Sbjct  214  NVKRTDVLKGKISLQVAKVDNGTGEIGGTFESEQPSDTDLGAKEPEEVKIRGLFYARLE  272



>ref|WP_015204171.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum]
 gb|AFZ14065.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum PCC 9333]
Length=277

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 127/178 (71%), Gaps = 10/178 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T +LD+I G  +VS +GS+ F E+DGID+  +TV+L GGE+VPF FTIK LVA+
Sbjct  97   KLLTRFTSSLDQISGTIKVSKNGSLTFTEEDGIDFQPITVRLAGGEQVPFFFTIKNLVAS  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F GEF VPSYRG+ FLDPKGRG ++GYDNAVALP+    D E+L++ 
Sbjct  157  SQPGMDSINTSTDFEGEFNVPSYRGAVFLDPKGRGVASGYDNAVALPS--EADSEQLRRA  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQL  239
            N+K V +  GKI+  V      TGEV G FES QPSDTDLGA  PKEVK++GI+YA++
Sbjct  215  NVKRVETGKGKISLQVAKVDSNTGEVAGTFESEQPSDTDLGADDPKEVKVRGIFYARI  272



>ref|WP_019494816.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
PCC 7103]
Length=276

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 128/183 (70%), Gaps = 10/183 (5%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQ  581
            F   K++TR T +LD+I+G   V+ DGS+ F EKDG D+ A TV+LPGGE +PFLFT+K 
Sbjct  93   FITGKVVTRKTSSLDQIQGDVNVNPDGSLTFIEKDGFDFQATTVKLPGGELIPFLFTVKG  152

Query  580  LVATGKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEE  425
            LVAT +P          F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  R D EE
Sbjct  153  LVATTQPNLTSINTSTDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVALPA--RSDAEE  210

Query  424  LQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYA  245
            L +EN+K      G ++ SV      +GE+ G FES+QPSDTDLG+  PKEVKI+GI+Y 
Sbjct  211  LTRENVKRAQVLEGNVSLSVAKINSASGEIAGTFESIQPSDTDLGSGDPKEVKIRGIFYG  270

Query  244  QLE  236
            ++E
Sbjct  271  RIE  273



>ref|WP_028090302.1| Photosystem II manganese-stabilizing polypeptide [Dolichospermum 
circinale]
Length=276

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            K+MTR T T+D+++G   V+SD S+ F EKDG+D+ A+TV+LPGGE VPFLFTIK LVA 
Sbjct  97   KVMTRYTSTIDQVQGKLTVNSDNSLTFTEKDGLDFQAITVKLPGGELVPFLFTIKNLVAQ  156

Query  568  GKPE--------SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL + 
Sbjct  157  TQPNLTSINTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEELTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++Y ++E
Sbjct  215  NVKRAEVLKGKISLQVAKVDNTSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYGRIE  273



>ref|WP_016949009.1| Photosystem II manganese-stabilizing polypeptide [Anabaena sp. 
PCC 7108]
Length=277

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 128/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D+++G  +++SD S+ F E DG+D+ A+TV+LPGGE VPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVQGNLKINSDNSLTFVEADGLDFQAITVKLPGGELVPFLFTIKNLVAQ  156

Query  568  GKPES--------FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P S        F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D+EEL + 
Sbjct  157  TQPNSTSINTSTDFEGSFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDEELTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K     +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++Y ++E
Sbjct  215  NVKRAEILSGKISLRVAKVDSASGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYGRVE  273



>ref|WP_035156929.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
336/3]
 gb|KFB85527.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
336/3]
Length=276

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 127/179 (71%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            K++TR T +LD+I+G   V+ DGS+ F+E DG D+ A+TVQLPGGERVPF FT+K LVA 
Sbjct  97   KVLTRKTSSLDQIQGDLIVNKDGSITFKEIDGFDFQAITVQLPGGERVPFFFTVKNLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +           F G F VPSYRG++FLDPKGRG ++GYDNAVALPA  + D+EEL + 
Sbjct  157  SQAGLTSINTSTDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVALPA--QSDDEELTRA  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K      GKI+ ++      TGE+ G FES QPSDTDLGA  PKEVK++G++YA++E
Sbjct  215  NVKRTEVLNGKISLNIAKVNSSTGEIAGTFESEQPSDTDLGAGEPKEVKVRGLFYARVE  273



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 128/195 (66%), Gaps = 23/195 (12%)
 Frame = -3

Query  760  FQNTKLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDG--IDYAAVTVQLPGGERVPFLFTI  587
            + NTKL+TR T  L +IE   +V  +G+V  +E D   ++ A +TVQLPGGERVPFLFTI
Sbjct  77   WSNTKLLTRQTTNLSDIEADLKVGPNGAVVLKESDSYSLNLAPITVQLPGGERVPFLFTI  136

Query  586  K-------------------QLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNA  464
            K                   +L A+G   SF G+  VPSYRGS+FLDPKGRGGSTGYD A
Sbjct  137  KARPHHNTFGYYSSSSHMPLELEASGDLSSFGGQIRVPSYRGSTFLDPKGRGGSTGYDTA  196

Query  463  VALPAGGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAK  284
             AL    R D+E L+ EN+K   S  G++ FSV    P TGEV GVFES+QPSDTD+GAK
Sbjct  197  HALHT--RADDEALESENLKKFDSGIGQVVFSVAKVDPGTGEVAGVFESVQPSDTDMGAK  254

Query  283  APKEVKIQGIWYAQL  239
             PK+VK+QG+WY QL
Sbjct  255  VPKQVKVQGLWYGQL  269



>ref|WP_017656098.1| Photosystem II manganese-stabilizing polypeptide [Microchaete 
sp. PCC 7126]
Length=277

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 128/179 (72%), Gaps = 10/179 (6%)
 Frame = -3

Query  748  KLMTRLTYTLDEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVAT  569
            KL+TR T T+D+++G  +++ D S+ F E+DG+D+ A+TVQLPGGERVPFLFTIK LVA 
Sbjct  97   KLLTRYTSTIDQVQGDLKINQDNSLTFVEQDGLDFQAITVQLPGGERVPFLFTIKNLVAQ  156

Query  568  GKP--------ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKE  413
             +P          F G F VPSYRG++FLDPKGRG  +GYDNAVALPA  + D++EL + 
Sbjct  157  SQPGLSSVSTSTDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVALPA--QADDDELTRT  214

Query  412  NIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIWYAQLE  236
            N+K     +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVKI+G++Y ++E
Sbjct  215  NVKRTDILSGKISLQVAKIDSGSGEIAGTFESEQPSDTDLGAGEPKEVKIRGLFYGRVE  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680