BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029C21

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFP93564.1|  GCS                                                     196   2e-55   Cestrum nocturnum [night jessamine]
ref|XP_009766955.1|  PREDICTED: glutamate--cysteine ligase, chlor...    192   3e-54   Nicotiana sylvestris
ref|XP_009617977.1|  PREDICTED: glutamate--cysteine ligase, chlor...    192   3e-54   Nicotiana tomentosiformis
ref|XP_011072645.1|  PREDICTED: glutamate--cysteine ligase, chlor...    191   1e-53   Sesamum indicum [beniseed]
emb|CDP09740.1|  unnamed protein product                                192   2e-53   Coffea canephora [robusta coffee]
ref|XP_006343987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    189   1e-52   Solanum tuberosum [potatoes]
ref|XP_010529570.1|  PREDICTED: glutamate--cysteine ligase, chlor...    188   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_011080960.1|  PREDICTED: glutamate--cysteine ligase, chlor...    188   2e-52   Sesamum indicum [beniseed]
ref|XP_008392576.1|  PREDICTED: glutamate--cysteine ligase, chlor...    180   2e-52   
ref|XP_008341055.1|  PREDICTED: glutamate--cysteine ligase, chlor...    187   3e-52   Malus domestica [apple tree]
gb|EYU23478.1|  hypothetical protein MIMGU_mgv1a004459mg                187   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_009350437.1|  PREDICTED: glutamate--cysteine ligase, chlor...    187   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_008341054.1|  PREDICTED: glutamate--cysteine ligase, chlor...    187   4e-52   Malus domestica [apple tree]
ref|XP_008341053.1|  PREDICTED: glutamate--cysteine ligase, chlor...    187   4e-52   Malus domestica [apple tree]
ref|XP_002509800.1|  Glutamate--cysteine ligase, chloroplast prec...    187   4e-52   Ricinus communis
dbj|BAD27390.1|  gamma-glutamylcysteine synthetase                      187   5e-52   Zinnia elegans [garden zinnia]
gb|KJB37542.1|  hypothetical protein B456_006G209400                    186   7e-52   Gossypium raimondii
ref|XP_009350436.1|  PREDICTED: glutamate--cysteine ligase, chlor...    186   7e-52   Pyrus x bretschneideri [bai li]
gb|KJB37540.1|  hypothetical protein B456_006G209400                    186   1e-51   Gossypium raimondii
gb|ADR66068.1|  gamma-glutamylcysteine synthetase                       174   1e-51   Cichorium intybus [radicchio]
ref|NP_001234010.1|  glutamate--cysteine ligase, chloroplastic          186   2e-51   
ref|XP_010325297.1|  PREDICTED: glutamate--cysteine ligase, chlor...    186   2e-51   
ref|XP_010540831.1|  PREDICTED: glutamate--cysteine ligase, chlor...    185   2e-51   Tarenaya hassleriana [spider flower]
gb|AFF18844.2|  gamma-glutamylcysteine synthetase                       185   2e-51   Dimocarpus longan [longan]
ref|XP_009402382.1|  PREDICTED: glutamate--cysteine ligase A, chl...    185   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209899.1|  hypothetical protein PRUPE_ppa004151mg             185   2e-51   Prunus persica
gb|ADR66069.1|  gamma-glutamylcysteine synthetase                       173   3e-51   Cichorium intybus [radicchio]
gb|KDP25439.1|  hypothetical protein JCGZ_20595                         184   3e-51   Jatropha curcas
ref|XP_008238836.1|  PREDICTED: glutamate--cysteine ligase, chlor...    184   4e-51   Prunus mume [ume]
gb|KDO76210.1|  hypothetical protein CISIN_1g010751mg                   181   5e-51   Citrus sinensis [apfelsine]
gb|AHC02699.1|  gamma-glutamylcysteine synthetase                       183   6e-51   Pyrus calleryana [Bradford pear]
gb|AHJ60103.1|  gamma-glutamylcysteine synthetase                       184   7e-51   Pyrus betulifolia
emb|CAL59719.1|  gamma-glutamylcysteinyl synthetase                     175   9e-51   Medicago sativa [alfalfa]
gb|KHN16824.1|  Glutamate--cysteine ligase, chloroplastic               183   1e-50   Glycine soja [wild soybean]
ref|XP_010920822.1|  PREDICTED: glutamate--cysteine ligase, chlor...    183   1e-50   Elaeis guineensis
ref|XP_002273626.1|  PREDICTED: glutamate--cysteine ligase, chlor...    183   2e-50   Vitis vinifera
ref|XP_003525397.1|  PREDICTED: glutamate--cysteine ligase, chlor...    182   2e-50   Glycine max [soybeans]
ref|XP_010255398.1|  PREDICTED: glutamate--cysteine ligase, chlor...    183   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010937863.1|  PREDICTED: glutamate--cysteine ligase A, chl...    183   2e-50   Elaeis guineensis
ref|XP_006283533.1|  hypothetical protein CARUB_v10004582mg             182   2e-50   Capsella rubella
ref|XP_008789126.1|  PREDICTED: glutamate--cysteine ligase A, chl...    182   2e-50   Phoenix dactylifera
gb|KDO76209.1|  hypothetical protein CISIN_1g010751mg                   182   2e-50   Citrus sinensis [apfelsine]
gb|KDO76206.1|  hypothetical protein CISIN_1g010751mg                   182   2e-50   Citrus sinensis [apfelsine]
ref|XP_006439553.1|  hypothetical protein CICLE_v10019696mg             182   2e-50   Citrus clementina [clementine]
ref|XP_006476577.1|  PREDICTED: glutamate--cysteine ligase, chlor...    182   3e-50   
ref|XP_006851855.1|  hypothetical protein AMTR_s00041p00090940          180   3e-50   
ref|XP_008437270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    182   3e-50   Cucumis melo [Oriental melon]
ref|XP_004159947.1|  PREDICTED: glutamate--cysteine ligase, chlor...    176   4e-50   
gb|ABK96626.1|  unknown                                                 182   4e-50   Populus trichocarpa x Populus deltoides
gb|KJB37541.1|  hypothetical protein B456_006G209400                    182   4e-50   Gossypium raimondii
ref|XP_011463882.1|  PREDICTED: glutamate--cysteine ligase, chlor...    182   4e-50   Fragaria vesca subsp. vesca
gb|EPS61788.1|  gamma-glutamylcysteine synthetase                       180   4e-50   Genlisea aurea
gb|AAL61610.1|AF401621_1  gamma-glutamylcysteine synthetase             181   5e-50   Allium cepa
ref|XP_011022699.1|  PREDICTED: glutamate--cysteine ligase, chlor...    181   5e-50   Populus euphratica
dbj|BAP47506.1|  gamma-glutamylcysteine synthetase                      181   7e-50   Gentiana triflora
gb|ABK23872.1|  unknown                                                 173   8e-50   Picea sitchensis
ref|XP_009364899.1|  PREDICTED: glutamate--cysteine ligase, chlor...    181   8e-50   Pyrus x bretschneideri [bai li]
ref|XP_007040225.1|  Glutamate-cysteine ligase isoform 1                181   1e-49   
emb|CAC27145.1|  glutamate-cysteine ligase                              173   2e-49   Picea abies
ref|XP_010439228.1|  PREDICTED: glutamate--cysteine ligase, chlor...    180   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010448772.1|  PREDICTED: glutamate--cysteine ligase, chlor...    180   2e-49   Camelina sativa [gold-of-pleasure]
gb|KCW77523.1|  hypothetical protein EUGRSUZ_D01848                     174   2e-49   Eucalyptus grandis [rose gum]
gb|ADR66074.1|  gamma-glutamylcysteine synthetase                       168   2e-49   Zinnia elegans [garden zinnia]
ref|XP_009364919.1|  PREDICTED: glutamate--cysteine ligase, chlor...    179   3e-49   Pyrus x bretschneideri [bai li]
gb|ABM46854.1|  gamma-glutamylcysteine synthetase                       179   3e-49   Chorispora bungeana
ref|XP_008792987.1|  PREDICTED: glutamate--cysteine ligase, chlor...    179   3e-49   Phoenix dactylifera
gb|AAF22136.1|AF128454_1  gamma-glutamylcysteine synthetase precu...    179   4e-49   Phaseolus vulgaris [French bean]
ref|XP_007160058.1|  hypothetical protein PHAVU_002G289200g             179   4e-49   Phaseolus vulgaris [French bean]
gb|AAL16161.1|AF428393_1  AT4g23100/F7H19_290                           179   4e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CAA71075.1|  gamma-glutamylcysteine synthetase                      179   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298035.2|  hypothetical protein POPTR_0001s09340g             179   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_002867730.1|  hypothetical protein ARALYDRAFT_492552             179   5e-49   
ref|NP_194041.1|  glutamate-cysteine ligase                             179   5e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08228.1|  AT4g23100/F7H19_290                                     179   5e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAF22137.1|AF128455_1  gamma-glutamylcysteine synthetase precu...    178   6e-49   Pisum sativum [garden pea]
gb|ADX30738.2|  truncated gamma-glutamyl-cysteine synthetase            176   7e-49   Populus x canadensis [Canadian poplar]
gb|ADE06226.1|  gamma-glutamylcysteine synthetase                       178   8e-49   Hevea brasiliensis [jebe]
ref|XP_008792981.1|  PREDICTED: glutamate--cysteine ligase, chlor...    179   9e-49   
ref|XP_008792975.1|  PREDICTED: glutamate--cysteine ligase, chlor...    179   9e-49   
ref|XP_010433943.1|  PREDICTED: glutamate--cysteine ligase, chlor...    178   9e-49   Camelina sativa [gold-of-pleasure]
ref|XP_011029270.1|  PREDICTED: glutamate--cysteine ligase, chlor...    178   1e-48   Populus euphratica
gb|ABJ98542.1|  gamma-glutamylcysteine synthetase                       178   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010695135.1|  PREDICTED: glutamate--cysteine ligase, chlor...    177   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003630512.1|  Glutamate-cysteine ligase                          177   2e-48   Medicago truncatula
gb|ADK77882.1|  gamma-glutamylcysteine synthetase                       177   2e-48   Cucumis sativus [cucumbers]
gb|KGN50100.1|  hypothetical protein Csa_5G153150                       177   2e-48   Cucumis sativus [cucumbers]
ref|XP_004143907.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    177   2e-48   
ref|XP_007210716.1|  hypothetical protein PRUPE_ppa022884mg             176   2e-48   
ref|XP_006413578.1|  hypothetical protein EUTSA_v10024916mg             177   2e-48   
gb|KCW77522.1|  hypothetical protein EUGRSUZ_D01848                     174   2e-48   Eucalyptus grandis [rose gum]
pdb|2GWD|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    176   3e-48   Brassica juncea [brown mustard]
emb|CAA06613.1|  gamma-glutamylcysteine synthetase                      175   3e-48   Brassica juncea [brown mustard]
sp|O23736.1|GSH1_BRAJU  RecName: Full=Glutamate--cysteine ligase,...    176   3e-48   Brassica juncea [brown mustard]
ref|XP_009136711.1|  PREDICTED: glutamate--cysteine ligase, chlor...    176   4e-48   Brassica rapa
gb|AEA77156.1|  chloroplast gamma glutamyl cysteine synthetase          176   4e-48   Vigna radiata [mung bean]
emb|CAK24967.1|  gamma-glutamylcysteine synthetase                      176   6e-48   Brassica napus [oilseed rape]
emb|CDY41369.1|  BnaC03g65140D                                          174   7e-48   Brassica napus [oilseed rape]
ref|XP_010053262.1|  PREDICTED: glutamate--cysteine ligase, chlor...    176   8e-48   Eucalyptus grandis [rose gum]
ref|XP_010053261.1|  PREDICTED: glutamate--cysteine ligase, chlor...    176   1e-47   Eucalyptus grandis [rose gum]
gb|ADR66071.1|  gamma-glutamylcysteine synthetase                       164   1e-47   Aster amellus [Italian starwort]
emb|CDY41249.1|  BnaA01g12900D                                          174   3e-47   Brassica napus [oilseed rape]
gb|ACX70134.1|  gamma-glutamylcysteine synthetase                       174   3e-47   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_004503722.1|  PREDICTED: glutamate--cysteine ligase, chlor...    173   4e-47   Cicer arietinum [garbanzo]
emb|CAD91714.1|  glutamate-cysteine ligase                              173   6e-47   Brassica juncea [brown mustard]
ref|XP_009137315.1|  PREDICTED: glutamate--cysteine ligase, chlor...    173   7e-47   Brassica rapa
emb|CDY10914.1|  BnaA03g45730D                                          173   7e-47   Brassica napus [oilseed rape]
pdb|2GWC|A  Chain A, Crystal Structure Of Plant Glutamate Cystein...    171   8e-47   Brassica juncea [brown mustard]
ref|XP_009364953.1|  PREDICTED: glutamate--cysteine ligase, chlor...    172   1e-46   Pyrus x bretschneideri [bai li]
gb|AAO45821.1|  gamma-glutamylcysteine synthetase                       171   2e-46   Lotus japonicus
ref|XP_006586325.1|  PREDICTED: glutamate--cysteine ligase, chlor...    171   4e-46   
ref|XP_009380693.1|  PREDICTED: glutamate--cysteine ligase A, chl...    170   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380691.1|  PREDICTED: glutamate--cysteine ligase A, chl...    170   8e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAR82640.1|  putative glutamyl cysteine ligase                      169   2e-45   Brassica napus [oilseed rape]
gb|AAW58147.1|  gamma-glutamylcysteine synthetase                       166   3e-45   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ84988.1|  predicted protein                                      164   8e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADR66075.1|  gamma-glutamylcysteine synthetase                       156   9e-45   Helianthus annuus
ref|XP_003569058.1|  PREDICTED: glutamate--cysteine ligase B, chl...    166   1e-44   Brachypodium distachyon [annual false brome]
ref|XP_010089108.1|  Glutamate--cysteine ligase                         167   1e-44   
gb|EMS60294.1|  Glutamate--cysteine ligase B, chloroplastic             165   2e-44   Triticum urartu
ref|NP_001059579.2|  Os07g0462000                                       156   3e-44   
ref|XP_009362009.1|  PREDICTED: glutamate--cysteine ligase, chlor...    160   4e-44   Pyrus x bretschneideri [bai li]
ref|NP_001168108.1|  uncharacterized protein LOC100381846               156   1e-43   
gb|ACK38262.1|  gamma-glutamylcysteine synthetase                       162   1e-43   Phragmites australis
dbj|BAJ21770.1|  putative gamma-glutamylcysteine synthetase             163   2e-43   Pteris vittata
gb|ADR66079.1|  gamma-glutamylcysteine synthetase                       152   4e-43   Hieracium umbellatum
gb|ADR66073.1|  gamma-glutamylcysteine synthetase                       151   7e-43   Eupatorium cannabinum [hemp agrimony]
gb|ADR66072.1|  gamma-glutamylcysteine synthetase                       151   7e-43   Arnica montana
gb|KFK30813.1|  hypothetical protein AALP_AA6G029500                    161   7e-43   Arabis alpina [alpine rockcress]
gb|ADR66082.1|  gamma-glutamylcysteine synthetase                       151   1e-42   Hieracium scabrum
ref|XP_010435330.1|  PREDICTED: glutamate--cysteine ligase, chlor...    161   1e-42   Camelina sativa [gold-of-pleasure]
gb|ADR66077.1|  gamma-glutamylcysteine synthetase                       150   1e-42   Hieracium porrifolium
ref|XP_009137312.1|  PREDICTED: glutamate--cysteine ligase, chlor...    160   3e-42   Brassica rapa
gb|ADR66070.1|  gamma-glutamylcysteine synthetase                       149   3e-42   Artemisia campestris
ref|XP_002439220.1|  hypothetical protein SORBIDRAFT_09g002470          159   4e-42   Sorghum bicolor [broomcorn]
ref|XP_002867731.1|  hypothetical protein ARALYDRAFT_914292             159   5e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_008375303.1|  PREDICTED: glutamate--cysteine ligase, chlor...    159   5e-42   
ref|XP_004960382.1|  PREDICTED: glutamate--cysteine ligase B, chl...    159   5e-42   Setaria italica
emb|CDX94156.1|  BnaC07g37900D                                          159   6e-42   
gb|ADR66076.1|  gamma-glutamylcysteine synthetase                       149   7e-42   Galinsoga parviflora
gb|ADR66088.1|  gamma-glutamylcysteine synthetase                       149   7e-42   Pilosella onegensis
ref|XP_010440632.1|  PREDICTED: glutamate--cysteine ligase, chlor...    159   9e-42   
gb|ADR66084.1|  gamma-glutamylcysteine synthetase                       148   1e-41   Hieracium intybaceum
gb|ADR66080.1|  gamma-glutamylcysteine synthetase                       148   1e-41   Hieracium umbellatum
ref|XP_008648285.1|  PREDICTED: gamma-glutamylcysteine synthetase...    158   2e-41   Zea mays [maize]
gb|KFK30815.1|  hypothetical protein AALP_AA6G029800                    155   2e-41   Arabis alpina [alpine rockcress]
ref|XP_006654002.1|  PREDICTED: glutamate--cysteine ligase B, chl...    156   3e-41   
ref|XP_008655177.1|  PREDICTED: uncharacterized protein LOC100381...    157   3e-41   
ref|XP_002875199.1|  predicted protein                                  156   4e-41   Arabidopsis lyrata subsp. lyrata
emb|CAD48598.1|  gamma-glutamylcysteine synthetase                      156   4e-41   Oryza sativa Japonica Group [Japonica rice]
gb|ADR66087.1|  gamma-glutamylcysteine synthetase                       147   4e-41   Pilosella lactucella
emb|CAD48599.3|  gamma-glutamylcysteine synthetase                      157   5e-41   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054541.1|  Os05g0129000                                       157   5e-41   
sp|Q8GU95.2|GSH1A_ORYSI  RecName: Full=Glutamate--cysteine ligase...    156   6e-41   Oryza sativa Indica Group [Indian rice]
sp|Q6Z3A3.1|GSH1B_ORYSJ  RecName: Full=Glutamate--cysteine ligase...    156   6e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EEE67118.1|  hypothetical protein OsJ_24143                          157   1e-40   Oryza sativa Japonica Group [Japonica rice]
gb|ADR66085.1|  gamma-glutamylcysteine synthetase                       146   1e-40   Pilosella lactucella
ref|NP_001105142.1|  gamma-glutamylcysteine synthetase1                 155   1e-40   Zea mays [maize]
gb|EEE62203.1|  hypothetical protein OsJ_16990                          159   1e-40   Oryza sativa Japonica Group [Japonica rice]
emb|CDY63259.1|  BnaA03g58670D                                          155   2e-40   Brassica napus [oilseed rape]
ref|XP_001757520.1|  predicted protein                                  154   3e-40   
ref|XP_010433942.1|  PREDICTED: glutamate--cysteine ligase, chlor...    154   3e-40   Camelina sativa [gold-of-pleasure]
sp|A2YL07.2|GSH1B_ORYSI  RecName: Full=Glutamate--cysteine ligase...    154   4e-40   Oryza sativa Indica Group [Indian rice]
gb|EEC81979.1|  hypothetical protein OsI_25896                          154   7e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010448773.1|  PREDICTED: glutamate--cysteine ligase, chlor...    152   1e-39   Camelina sativa [gold-of-pleasure]
gb|ACV71026.1|  gamma-glutamylcysteine synthetase                       145   4e-39   Agropyron cristatum [crested wheatgrass]
ref|XP_010439235.1|  PREDICTED: glutamate--cysteine ligase, chlor...    150   4e-39   
ref|XP_006283598.1|  hypothetical protein CARUB_v10004654mg             151   4e-39   Capsella rubella
ref|XP_001785532.1|  predicted protein                                  151   5e-39   
ref|XP_010439229.1|  PREDICTED: glutamate--cysteine ligase, chlor...    150   8e-39   Camelina sativa [gold-of-pleasure]
gb|AFF18843.1|  gamma-glutamylcysteine synthetase                       140   1e-38   Dimocarpus longan [longan]
gb|AES94043.2|  gamma glutamyl cysteine synthetase                      142   1e-38   Medicago truncatula
ref|XP_010448775.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010448777.1|  PREDICTED: glutamate--cysteine ligase, chlor...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002965328.1|  hypothetical protein SELMODRAFT_83292              149   2e-38   
ref|XP_010439234.1|  PREDICTED: glutamate--cysteine ligase, chlor...    148   3e-38   
ref|XP_003611085.1|  Glutamate-cysteine ligase                          142   9e-38   
ref|XP_002977172.1|  hypothetical protein SELMODRAFT_232900             147   1e-37   
ref|XP_010439231.1|  PREDICTED: glutamate--cysteine ligase, chlor...    146   2e-37   Camelina sativa [gold-of-pleasure]
gb|ADR66089.1|  gamma-glutamylcysteine synthetase                       135   2e-36   Hispidella hispanica
gb|ADR66086.1|  gamma-glutamylcysteine synthetase                       132   9e-36   Andryala pinnatifida
gb|AEN79434.1|  gamma-glutamylcysteine synthetase                       132   1e-35   Hispidella hispanica
ref|XP_004971557.1|  PREDICTED: glutamate--cysteine ligase B, chl...    141   2e-35   
ref|XP_003611086.1|  Glutamate-cysteine ligase                          140   4e-35   
ref|XP_004511574.1|  PREDICTED: glutamate--cysteine ligase, chlor...    137   5e-34   Cicer arietinum [garbanzo]
ref|XP_010540840.1|  PREDICTED: glutamate--cysteine ligase, chlor...    137   5e-34   Tarenaya hassleriana [spider flower]
ref|XP_007158499.1|  hypothetical protein PHAVU_002G157600g             134   8e-33   Phaseolus vulgaris [French bean]
ref|XP_003516702.1|  PREDICTED: glutamate--cysteine ligase, chlor...    134   9e-33   Glycine max [soybeans]
emb|CAA82626.1|  gamma-glutamylcysteine synthetase                      129   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435329.1|  PREDICTED: glutamate--cysteine ligase, chlor...    121   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002985600.1|  hypothetical protein SELMODRAFT_122883             124   1e-29   
ref|XP_002974231.1|  hypothetical protein SELMODRAFT_101407             124   1e-29   
ref|XP_004971558.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--c...    121   1e-28   
ref|XP_008375304.1|  PREDICTED: glutamate--cysteine ligase, chlor...    116   7e-27   
ref|XP_001778732.1|  predicted protein                                  114   5e-26   
ref|WP_006913439.1|  glutamate--cysteine ligase                         109   2e-24   Salinisphaera shabanensis
ref|WP_005000090.1|  glutamate--cysteine ligase                         108   6e-24   Nitrococcus mobilis
ref|WP_022698585.1|  glutamate--cysteine ligase                         108   6e-24   Euryhalocaulis caribicus
ref|WP_037338607.1|  glutamate--cysteine ligase                         108   6e-24   Salinisphaera hydrothermalis
ref|WP_028467521.1|  glutamate--cysteine ligase                         107   1e-23   Nisaea denitrificans
dbj|GAK45010.1|  glutamate--cysteine ligase                             106   3e-23   Tepidicaulis marinus
ref|WP_009803181.1|  glutamate--cysteine ligase                         103   4e-22   Oceanicaulis sp. HTCC2633
gb|AFC88288.1|  gamma-glutamylcysteine synthetase                       102   9e-22   Chlamydomonas sp. ICE-L
ref|WP_042640977.1|  glutamate--cysteine ligase                         102   1e-21   Mesorhizobium sp. ORS 3359
ref|WP_040973710.1|  glutamate--cysteine ligase                         102   1e-21   Mesorhizobium sp. ORS 3324
ref|WP_042597021.1|  glutamate--cysteine ligase                         101   1e-21   Xanthomonas campestris
ref|WP_040990658.1|  glutamate--cysteine ligase                         101   2e-21   Mesorhizobium plurifarium
ref|WP_041004352.1|  glutamate--cysteine ligase                         101   2e-21   Mesorhizobium plurifarium
ref|WP_041010010.1|  glutamate--cysteine ligase                         101   2e-21   Mesorhizobium plurifarium
ref|WP_011038494.1|  glutamate--cysteine ligase                         101   2e-21   Xanthomonas campestris
gb|AEL08593.1|  glutamate--cysteine ligase                              101   2e-21   Xanthomonas campestris pv. raphani 756C
ref|WP_018147083.1|  glutamate--cysteine ligase                         101   2e-21   Henriciella marina
emb|CAP50142.1|  glutamate-cysteine ligase                              101   3e-21   Xanthomonas campestris pv. campestris
ref|WP_014247076.1|  glutamate--cysteine ligase                         100   3e-21   Azospirillum lipoferum
ref|WP_036515476.1|  glutamate--cysteine ligase                         100   4e-21   Oceanicaulis sp. HL-87
ref|XP_002507857.1|  predicted protein                                  101   4e-21   Micromonas commoda
ref|WP_023432400.1|  Glutamate--cysteine ligase                         100   4e-21   Lutibaculum baratangense
ref|XP_003062187.1|  predicted protein                                  100   5e-21   Micromonas pusilla CCMP1545
ref|WP_017463721.1|  glutamate--cysteine ligase                         100   6e-21   Dyella ginsengisoli
ref|WP_027164308.1|  glutamate--cysteine ligase                         100   7e-21   Mesorhizobium sp. WSM3224
ref|WP_019959805.1|  glutamate--cysteine ligase                       99.8    7e-21   Woodsholea maritima
ref|WP_018426605.1|  glutamate--cysteine ligase                       99.8    8e-21   Hoeflea sp. 108
ref|XP_001701647.1|  gamma-glutamylcysteine synthetase                  100   8e-21   Chlamydomonas reinhardtii
ref|WP_012973384.1|  glutamate--cysteine ligase                       99.4    1e-20   Azospirillum lipoferum
ref|WP_022701642.1|  glutamate--cysteine ligase                       99.4    1e-20   Oceanicaulis alexandrii
ref|WP_020591012.1|  hypothetical protein                             99.4    1e-20   Kiloniella laminariae
ref|WP_015316493.1|  glutamate--cysteine ligase                       99.0    1e-20   Mesorhizobium australicum
ref|WP_029011247.1|  glutamate--cysteine ligase                       99.0    2e-20   Azospirillum halopraeferens
ref|WP_012116172.1|  glutamate--cysteine ligase                       99.0    2e-20   Xanthobacter autotrophicus
ref|WP_008838626.1|  glutamate--cysteine ligase                       99.0    2e-20   Mesorhizobium alhagi
ref|WP_029558402.1|  glutamate--cysteine ligase                       98.6    2e-20   Xanthobacter sp. 91
ref|WP_041003537.1|  glutamate--cysteine ligase                       98.6    2e-20   Mesorhizobium sp. SOD10
ref|WP_027840761.1|  glutamate--cysteine ligase                       98.6    3e-20   
ref|WP_037014257.1|  glutamate--cysteine ligase                       98.2    3e-20   Rhizobiales bacterium YIM 77505
ref|WP_034834449.1|  glutamate--cysteine ligase                       97.8    4e-20   Inquilinus limosus
ref|WP_005411018.1|  glutamate--cysteine ligase                       97.4    5e-20   Stenotrophomonas maltophilia
ref|WP_024956060.1|  glutamate--cysteine ligase                       97.4    5e-20   Stenotrophomonas
ref|WP_019336459.1|  glutamate--cysteine ligase                       97.4    5e-20   Stenotrophomonas maltophilia
ref|WP_043948471.1|  glutamate--cysteine ligase                       97.4    5e-20   Candidatus Phaeomarinobacter ectocarpi
ref|WP_010480897.1|  glutamate--cysteine ligase [                     97.4    6e-20   Stenotrophomonas maltophilia
ref|NP_001031701.1|  glutamate-cysteine ligase                        97.4    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|WP_014129677.1|  glutamate--cysteine ligase                       97.4    6e-20   Pelagibacterium
ref|WP_032972191.1|  glutamate--cysteine ligase                       97.1    7e-20   Stenotrophomonas maltophilia
ref|WP_014648396.1|  glutamate--cysteine ligase                       97.1    7e-20   Stenotrophomonas maltophilia
ref|WP_014038468.1|  glutamate--cysteine ligase                       97.1    7e-20   Stenotrophomonas
ref|WP_012512090.1|  glutamate--cysteine ligase                       97.1    7e-20   Stenotrophomonas maltophilia
dbj|GAN00159.1|  glutamate--cysteine ligase                           97.1    8e-20   alpha proteobacterium U9-1i
emb|CCP17893.1|  glutamate--cysteine ligase                           97.1    8e-20   Stenotrophomonas maltophilia RA8
ref|WP_022727621.1|  glutamate--cysteine ligase                       97.1    9e-20   Fodinicurvata sediminis
ref|WP_021203943.1|  glutamate--cysteine ligase                       96.7    9e-20   Stenotrophomonas maltophilia
ref|WP_019662096.1|  glutamate--cysteine ligase                       96.7    1e-19   Stenotrophomonas maltophilia
ref|WP_019173053.1|  glutamate--cysteine ligase                       96.7    1e-19   Pseudaminobacter salicylatoxidans
ref|WP_043958070.1|  glutamate--cysteine ligase                       96.3    1e-19   Lysobacter sp. A03
ref|WP_039718559.1|  glutamate--cysteine ligase                       96.3    1e-19   
gb|KIQ97509.1|  Glutamate--cysteine ligase                            96.3    1e-19   Lysobacter sp. A03
ref|WP_024279173.1|  glutamate--cysteine ligase                       96.3    2e-19   Xanthobacter sp. 126
ref|WP_032129893.1|  glutamate--cysteine ligase                       95.9    2e-19   Stenotrophomonas
ref|WP_042696029.1|  glutamate--cysteine ligase                       95.9    2e-19   Azospirillum sp. B506
ref|WP_005419277.1|  glutamate--cysteine ligase                       95.5    2e-19   Stenotrophomonas
ref|WP_007675699.1|  glutamate--cysteine ligase                       95.5    3e-19   alpha proteobacterium BAL199
ref|XP_002949586.1|  hypothetical protein VOLCADRAFT_104352           94.4    3e-19   Volvox carteri f. nagariensis
ref|WP_035029482.1|  MULTISPECIES: glutamate--cysteine ligase         95.5    3e-19   Aquamicrobium defluvii
ref|WP_008265020.1|  glutamate--cysteine ligase                       95.1    3e-19   Stenotrophomonas sp. SKA14
ref|WP_009540610.1|  Glutamate--cysteine ligase                       95.1    4e-19   Caenispirillum salinarum
ref|WP_024588372.1|  glutamate--cysteine ligase                       95.1    4e-19   Aliihoeflea sp. 2WW
ref|WP_011995572.1|  glutamate--cysteine ligase                       95.1    4e-19   Parvibaculum lavamentivorans
ref|WP_043400077.1|  glutamate--cysteine ligase                       95.1    4e-19   Stenotrophomonas maltophilia
ref|XP_005844806.1|  hypothetical protein CHLNCDRAFT_26566            95.1    5e-19   Chlorella variabilis
ref|WP_026873097.1|  glutamate--cysteine ligase                       94.7    5e-19   Inquilinus limosus
ref|WP_010337529.1|  glutamate--cysteine ligase                       94.7    6e-19   Sphingomonadaceae
ref|WP_034794187.1|  glutamate--cysteine ligase                       94.7    6e-19   Hyphomonas beringensis
ref|WP_011413551.1|  glutamate--cysteine ligase                       94.4    6e-19   Erythrobacter litoralis
gb|AEQ94987.1|  glutamate--cysteine ligase                            94.4    6e-19   Xanthomonas oryzae pv. oryzicola BLS256
ref|WP_037513223.1|  glutamate--cysteine ligase                       94.4    7e-19   Sphingobium yanoikuyae
ref|WP_041183612.1|  glutamate--cysteine ligase                       94.4    7e-19   Xanthomonas oryzae
ref|WP_037519317.1|  glutamate--cysteine ligase                       94.4    7e-19   Sphingobium yanoikuyae
ref|WP_004209288.1|  glutamate-cysteine ligase                        94.4    7e-19   Sphingobium
ref|WP_007705830.1|  glutamate--cysteine ligase                       94.4    7e-19   Sphingobium sp. AP49
ref|WP_022694894.1|  glutamate--cysteine ligase                       94.4    7e-19   Ponticaulis koreensis
ref|WP_028098740.1|  glutamate--cysteine ligase                       94.4    7e-19   Dongia sp. URHE0060
gb|AAW77131.1|  glutamate-cysteine ligase precursor                   94.4    7e-19   
ref|WP_041182495.1|  glutamate--cysteine ligase                       94.4    8e-19   
ref|XP_005646648.1|  plant glutamate cysteine ligase in complex w...  94.0    9e-19   
ref|XP_006439556.1|  hypothetical protein CICLE_v10019696mg           94.4    9e-19   
ref|WP_013419374.1|  glutamate--cysteine ligase                       94.0    1e-18   
ref|WP_025874082.1|  MULTISPECIES: glutamate--cysteine ligase         93.6    1e-18   
ref|WP_027135070.1|  glutamate--cysteine ligase                       93.6    1e-18   
ref|WP_007513778.1|  glutamate--cysteine ligase                       93.6    1e-18   
ref|WP_015448887.1|  MULTISPECIES: glutamate--cysteine ligase         93.6    1e-18   
ref|WP_039530743.1|  glutamate--cysteine ligase                       93.6    1e-18   
dbj|GAN45514.1|  glutamate--cysteine ligase                           93.2    2e-18   
gb|KER80321.1|  glutamate--cysteine ligase                            93.6    2e-18   
ref|WP_033013154.1|  glutamate--cysteine ligase                       93.2    2e-18   
ref|WP_033003907.1|  glutamate--cysteine ligase                       93.2    2e-18   
ref|WP_008215925.1|  glutamate--cysteine ligase                       93.2    2e-18   
ref|WP_042841007.1|  glutamate--cysteine ligase                       91.3    2e-18   
ref|WP_033005706.1|  glutamate--cysteine ligase                       93.2    2e-18   
gb|ACD57632.1|  glutamate--cysteine ligase                            93.2    2e-18   
ref|WP_017502900.1|  glutamate--cysteine ligase                       93.2    2e-18   
ref|WP_041637659.1|  glutamate--cysteine ligase                       93.2    2e-18   
emb|CCQ74722.1|  Glutamate--cysteine ligase                           93.2    2e-18   
ref|WP_024927210.1|  MULTISPECIES: glutamate--cysteine ligase         93.2    2e-18   
ref|WP_012568753.1|  glutamate--cysteine ligase                       92.8    2e-18   
gb|ABI66532.1|  glutamate--cysteine ligase                            92.8    2e-18   
ref|WP_039514204.1|  glutamate--cysteine ligase                       92.8    2e-18   
ref|WP_039523512.1|  glutamate--cysteine ligase                       92.8    3e-18   
ref|WP_024939451.1|  glutamate--cysteine ligase                       92.8    3e-18   
gb|EFF42187.1|  glutamate-cysteine ligase precursor                   90.5    3e-18   
ref|WP_008944552.1|  glutamate--cysteine ligase                       92.4    3e-18   
ref|WP_023776646.1|  glutamate--cysteine ligase                       92.4    3e-18   
ref|WP_027494082.1|  glutamate--cysteine ligase                       92.4    3e-18   
ref|WP_007081607.1|  glutamate--cysteine ligase                       92.4    3e-18   
ref|WP_035675217.1|  glutamate--cysteine ligase                       92.4    4e-18   
ref|WP_033069251.1|  glutamate--cysteine ligase                       92.4    4e-18   
ref|WP_014241129.1|  glutamate--cysteine ligase                       92.4    4e-18   
ref|WP_036482412.1|  glutamate--cysteine ligase                       92.4    4e-18   
ref|WP_012171491.1|  glutamate--cysteine ligase                       92.0    4e-18   
ref|WP_029003893.1|  glutamate--cysteine ligase                       92.0    5e-18   
ref|WP_029221192.1|  glutamate--cysteine ligase                       92.0    5e-18   
ref|WP_035612545.1|  glutamate--cysteine ligase                       92.0    5e-18   
ref|WP_024848624.1|  glutamate--cysteine ligase                       92.0    5e-18   
ref|WP_014416028.1|  glutamate--cysteine ligase                       92.0    5e-18   
ref|WP_008389016.1|  glutamate--cysteine ligase                       92.0    5e-18   
ref|WP_023903510.1|  glutamate-cysteine ligase                        92.0    5e-18   
ref|WP_006451634.1|  glutamate--cysteine ligase                       92.0    5e-18   
ref|WP_010377823.1|  glutamate--cysteine ligase                       91.7    6e-18   
ref|WP_005925232.1|  glutamate--cysteine ligase                       91.7    6e-18   
ref|WP_039288065.1|  glutamate--cysteine ligase                       91.7    6e-18   
ref|WP_033006831.1|  MULTISPECIES: glutamate--cysteine ligase         91.7    6e-18   
ref|WP_016850319.1|  glutamate--cysteine ligase                       91.7    6e-18   
ref|WP_043089784.1|  glutamate--cysteine ligase                       91.7    6e-18   
gb|KFA28827.1|  glutamate--cysteine ligase                            91.7    6e-18   
gb|KGK58190.1|  glutamate--cysteine ligase                            91.7    6e-18   
ref|WP_003482597.1|  MULTISPECIES: glutamate--cysteine ligase         91.7    6e-18   
ref|WP_039758036.1|  glutamate--cysteine ligase                       91.7    6e-18   
ref|WP_010365580.1|  glutamate--cysteine ligase                       92.0    6e-18   
ref|WP_039411931.1|  glutamate--cysteine ligase                       91.7    6e-18   
emb|CEH52138.1|  Glutamate--cysteine ligase, chloroplastic            91.7    7e-18   
emb|CEH36892.1|  Glutamate--cysteine ligase, chloroplastic            92.0    7e-18   
ref|WP_006329395.1|  Glutamate--cysteine ligase B, chloroplastic      91.7    7e-18   
ref|WP_037242001.1|  glutamate--cysteine ligase                       91.3    7e-18   
ref|WP_033473523.1|  glutamate--cysteine ligase                       91.7    7e-18   
ref|WP_039419904.1|  glutamate--cysteine ligase                       91.7    7e-18   
ref|WP_033486365.1|  glutamate--cysteine ligase                       91.7    7e-18   
ref|WP_042828083.1|  glutamate--cysteine ligase                       91.3    7e-18   
gb|KAI93336.1|  glutamate--cysteine ligase                            91.3    8e-18   
ref|WP_023756833.1|  glutamate--cysteine ligase                       91.3    8e-18   
ref|WP_023767841.1|  glutamate--cysteine ligase                       91.3    9e-18   
ref|WP_002805033.1|  glutamate--cysteine ligase                       91.3    9e-18   
ref|XP_005981417.1|  PREDICTED: glutamate--cysteine ligase, chlor...  91.3    9e-18   
ref|WP_014089368.1|  glutamate--cysteine ligase                       91.3    9e-18   
ref|WP_042821350.1|  glutamate--cysteine ligase                       91.3    9e-18   
ref|WP_008576760.1|  glutamate--cysteine ligase                       91.3    1e-17   
ref|WP_033837250.1|  glutamate--cysteine ligase                       91.3    1e-17   
ref|WP_031421052.1|  MULTISPECIES: glutamate--cysteine ligase         91.3    1e-17   
ref|XP_002304493.2|  hypothetical protein POPTR_0003s12700g           91.3    1e-17   
gb|EGD09129.1|  glutamate--cysteine ligase, plant type                91.3    1e-17   
ref|WP_013893868.1|  glutamate--cysteine ligase                       90.9    1e-17   
ref|WP_007808142.1|  glutamate--cysteine ligase                       90.9    1e-17   
ref|WP_027035577.1|  glutamate--cysteine ligase                       90.9    1e-17   
ref|WP_026381250.1|  glutamate--cysteine ligase                       90.9    1e-17   
emb|CAJ22413.1|  glutamate-cysteine ligase                            91.3    1e-17   
ref|WP_008877385.1|  Glutamate--cysteine ligase B, chloroplastic      90.9    1e-17   
ref|WP_031339676.1|  glutamate--cysteine ligase                       90.9    1e-17   
ref|WP_027033618.1|  glutamate--cysteine ligase                       90.9    1e-17   
ref|WP_026986595.1|  glutamate--cysteine ligase                       90.9    1e-17   
ref|WP_037474880.1|  glutamate--cysteine ligase                       90.9    1e-17   
ref|WP_033483832.1|  glutamate--cysteine ligase                       90.5    2e-17   
ref|WP_027061439.1|  glutamate--cysteine ligase                       90.5    2e-17   
ref|WP_033480923.1|  MULTISPECIES: glutamate--cysteine ligase         90.5    2e-17   
ref|WP_042806048.1|  glutamate--cysteine ligase                       90.5    2e-17   
ref|WP_019463764.1|  glutamate--cysteine ligase                       90.5    2e-17   
ref|WP_018182707.1|  hypothetical protein                             90.5    2e-17   
ref|WP_038644889.1|  glutamate--cysteine ligase                       90.5    2e-17   
ref|WP_041019034.1|  glutamate--cysteine ligase                       90.5    2e-17   
ref|WP_039573168.1|  glutamate--cysteine ligase                       90.5    2e-17   
ref|WP_022558275.1|  putative glutamate-cysteine ligase               90.5    2e-17   
gb|EFF46544.1|  glutamate-cysteine ligase                             90.5    2e-17   
ref|WP_019860032.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_032933114.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_031448324.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_010914411.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_019183743.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_044559775.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_038686277.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_042614137.1|  glutamate--cysteine ligase                       90.1    2e-17   
ref|WP_024502321.1|  MULTISPECIES: glutamate--cysteine ligase         89.7    3e-17   
ref|WP_037457639.1|  glutamate--cysteine ligase                       89.7    3e-17   
ref|WP_022671788.1|  glutamate--cysteine ligase                       89.7    3e-17   
ref|WP_023809035.1|  glutamate--cysteine ligase                       89.7    3e-17   
ref|WP_013530341.1|  glutamate--cysteine ligase                       89.7    3e-17   
ref|WP_039565660.1|  glutamate--cysteine ligase                       89.7    3e-17   
ref|WP_016902618.1|  glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_025030022.1|  glutamate--cysteine ligase                       89.4    4e-17   
gb|KIY92812.1|  glutamate--cysteine ligase                            84.0    4e-17   
ref|WP_006955629.1|  Glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_007009691.1|  glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_029041764.1|  glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_018971758.1|  glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_012231137.1|  glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_022675027.1|  glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_027056195.1|  glutamate--cysteine ligase                       89.4    4e-17   
ref|WP_019053443.1|  glutamate--cysteine ligase                       89.4    5e-17   
ref|WP_035554031.1|  glutamate--cysteine ligase                       89.0    5e-17   
ref|WP_015397617.1|  glutamate-cysteine ligase                        89.0    6e-17   
gb|KCZ59182.1|  glutamate--cysteine ligase                            89.0    6e-17   
ref|WP_017182936.1|  glutamate--cysteine ligase                       88.6    7e-17   
ref|WP_005773987.1|  glutamate--cysteine ligase                       88.6    7e-17   
ref|WP_023771369.1|  glutamate--cysteine ligase                       88.6    7e-17   
ref|WP_012754787.1|  glutamate--cysteine ligase                       88.6    7e-17   
ref|WP_023782445.1|  MULTISPECIES: glutamate--cysteine ligase         88.6    7e-17   
ref|WP_019220607.1|  glutamate--cysteine ligase                       88.6    7e-17   
ref|WP_036195140.1|  glutamate--cysteine ligase                       88.6    7e-17   
ref|WP_027146167.1|  glutamate--cysteine ligase                       88.6    7e-17   
ref|WP_023710134.1|  MULTISPECIES: glutamate--cysteine ligase         88.6    8e-17   
ref|WP_023692353.1|  MULTISPECIES: glutamate--cysteine ligase         88.6    8e-17   
ref|WP_007553152.1|  glutamate--cysteine ligase                       88.6    8e-17   
ref|WP_010414293.1|  glutamate--cysteine ligase                       88.6    8e-17   
ref|WP_023727719.1|  glutamate--cysteine ligase                       88.6    8e-17   
ref|WP_027042591.1|  glutamate--cysteine ligase                       88.6    8e-17   
ref|WP_023732347.1|  MULTISPECIES: glutamate--cysteine ligase         88.6    9e-17   
ref|WP_023825882.1|  glutamate--cysteine ligase                       88.6    9e-17   
ref|WP_023686820.1|  glutamate--cysteine ligase                       88.6    9e-17   
ref|WP_011388328.1|  glutamate--cysteine ligase                       88.6    9e-17   
ref|WP_011628951.1|  glutamate--cysteine ligase                       88.2    9e-17   
ref|WP_023729092.1|  glutamate--cysteine ligase                       88.2    9e-17   
ref|WP_023681841.1|  MULTISPECIES: glutamate--cysteine ligase         88.2    9e-17   
ref|WP_023740489.1|  glutamate--cysteine ligase                       88.2    9e-17   
ref|WP_040849077.1|  glutamate--cysteine ligase                       88.2    9e-17   
ref|WP_023670558.1|  MULTISPECIES: glutamate--cysteine ligase         88.2    9e-17   
ref|WP_010187657.1|  glutamate--cysteine ligase                       88.2    1e-16   
ref|WP_043153593.1|  glutamate--cysteine ligase                       88.2    1e-16   
ref|WP_023704474.1|  MULTISPECIES: glutamate--cysteine ligase         88.2    1e-16   
ref|WP_044427601.1|  glutamate--cysteine ligase                       88.2    1e-16   
ref|WP_004860676.1|  glutamate--cysteine ligase                       88.2    1e-16   
ref|WP_010217933.1|  glutamate--cysteine ligase                       88.2    1e-16   
ref|WP_027081073.1|  glutamate--cysteine ligase                       87.8    1e-16   
ref|WP_027840020.1|  glutamate--cysteine ligase                       88.2    1e-16   
ref|WP_028795898.1|  glutamate--cysteine ligase                       87.8    1e-16   
ref|WP_009870063.1|  COG3572: Gamma-glutamylcysteine synthetase       87.8    1e-16   
ref|WP_038621702.1|  glutamate--cysteine ligase                       87.8    1e-16   
ref|WP_008593913.1|  glutamate--cysteine ligase                       87.8    1e-16   
ref|WP_034447414.1|  glutamate--cysteine ligase                       87.8    2e-16   
ref|WP_009758961.1|  glutamate--cysteine ligase                       87.8    2e-16   
ref|WP_011180333.1|  glutamate--cysteine ligase                       87.8    2e-16   
ref|WP_023716461.1|  glutamate--cysteine ligase                       87.8    2e-16   
ref|WP_010160442.1|  glutamate--cysteine ligase                       87.8    2e-16   
ref|WP_023680466.1|  glutamate--cysteine ligase                       87.4    2e-16   
ref|WP_027156336.1|  glutamate--cysteine ligase                       87.4    2e-16   
ref|WP_008995338.1|  glutamate--cysteine ligase                       87.4    2e-16   
ref|WP_006925618.1|  glutamate--cysteine ligase                       87.4    2e-16   
ref|WP_006922972.1|  glutamate--cysteine ligase                       87.4    2e-16   
ref|WP_029075850.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_043745404.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_022969328.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_014923808.1|  glutamate--cysteine ligase                       87.0    2e-16   
ref|WP_006206851.1|  glutamate--cysteine ligase                       87.0    3e-16   
dbj|BAE52827.1|  Gamma-glutamylcysteine synthetase                    87.0    3e-16   
ref|WP_008602773.1|  Glutamate--cysteine ligase                       87.0    3e-16   
ref|WP_022684910.1|  glutamate--cysteine ligase                       87.0    3e-16   
ref|WP_023800340.1|  glutamate--cysteine ligase                       87.0    3e-16   
ref|WP_005414465.1|  glutamate--cysteine ligase                       86.7    3e-16   
ref|WP_036149723.1|  glutamate--cysteine ligase                       86.7    3e-16   
ref|WP_043803819.1|  glutamate--cysteine ligase                       86.7    3e-16   
ref|WP_004854162.1|  glutamate--cysteine ligase                       86.7    3e-16   
ref|WP_007163579.1|  glutamate--cysteine ligase                       86.7    3e-16   
ref|WP_010238314.1|  glutamate--cysteine ligase                       86.7    3e-16   
ref|WP_019223408.1|  glutamate--cysteine ligase                       86.7    4e-16   
ref|WP_041270803.1|  glutamate--cysteine ligase                       86.3    4e-16   
gb|AFC85239.1|  glutamate--cysteine ligase, plant type                86.7    4e-16   
ref|WP_026633958.1|  glutamate--cysteine ligase                       86.3    5e-16   
ref|WP_009451554.1|  glutamate--cysteine ligase                       86.3    5e-16   
ref|WP_027230235.1|  glutamate--cysteine ligase                       86.3    5e-16   
ref|WP_028967581.1|  glutamate--cysteine ligase                       86.3    5e-16   
gb|AEQ94991.1|  glutamate--cysteine ligase                            85.5    5e-16   
ref|WP_021244404.1|  glutamate--cysteine ligase                       86.3    5e-16   
ref|WP_011179097.1|  glutamate--cysteine ligase                       86.3    5e-16   
ref|WP_036364173.1|  glutamate--cysteine ligase                       86.3    5e-16   
ref|WP_017931593.1|  hypothetical protein                             86.3    5e-16   
ref|WP_027027673.1|  glutamate--cysteine ligase                       86.3    5e-16   
ref|WP_041183073.1|  glutamate--cysteine ligase                       85.9    6e-16   
ref|WP_014162019.1|  glutamate--cysteine ligase                       85.9    6e-16   
ref|WP_035537514.1|  glutamate--cysteine ligase                       85.9    6e-16   
ref|WP_043099349.1|  glutamate--cysteine ligase                       85.9    6e-16   
ref|WP_039390333.1|  glutamate--cysteine ligase                       85.9    6e-16   
gb|KDA02929.1|  glutamate--cysteine ligase                            85.9    6e-16   
ref|WP_033835224.1|  glutamate--cysteine ligase                       85.9    6e-16   
ref|WP_010700842.1|  glutamate-cysteine ligase                        85.9    7e-16   
ref|WP_010703387.1|  glutamate-cysteine ligase                        85.9    8e-16   
ref|WP_038229828.1|  glutamate--cysteine ligase                       85.5    8e-16   
ref|WP_004089170.1|  glutamate--cysteine ligase                       85.5    8e-16   
ref|WP_037059638.1|  glutamate--cysteine ligase                       85.5    8e-16   
ref|WP_004864473.1|  glutamate--cysteine ligase                       85.5    8e-16   
ref|WP_022734084.1|  glutamate--cysteine ligase                       85.5    8e-16   
ref|WP_010702077.1|  glutamate-cysteine ligase                        85.5    8e-16   
ref|WP_034210140.1|  glutamate--cysteine ligase                       85.5    9e-16   
ref|WP_012284466.1|  glutamate--cysteine ligase                       85.5    9e-16   
ref|WP_034825230.1|  glutamate--cysteine ligase                       85.5    1e-15   
ref|WP_043971591.1|  glutamate--cysteine ligase                       85.5    1e-15   
gb|KCZ51869.1|  glutamate--cysteine ligase                            85.5    1e-15   
ref|XP_005976798.1|  PREDICTED: glutamate--cysteine ligase, chlor...  85.5    1e-15   



>gb|AFP93564.1| GCS [Cestrum nocturnum]
Length=518

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMTADWT EEREMLR KVP +GLKTPFRDGLLKHVAQDV+KLAKEGLERR
Sbjct  413  YDEASLQSVLDMTADWTAEEREMLRNKVPKSGLKTPFRDGLLKHVAQDVMKLAKEGLERR  472

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFLNE+TEVV TG+TPAEKLLDLYH KWGQ+VDPVFEELLY
Sbjct  473  GYKETGFLNEVTEVVRTGVTPAEKLLDLYHGKWGQSVDPVFEELLY  518



>ref|XP_009766955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
sylvestris]
 sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Nicotiana tabacum]
 gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum]
Length=522

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMT+DWT EEREMLR KVP +GLKTPFRDGLLKHVAQDV+KLAKEGLERR
Sbjct  417  YDEVSLQTVLDMTSDWTAEEREMLRNKVPTSGLKTPFRDGLLKHVAQDVVKLAKEGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFLNE+TEVV TG+TPAEKLL+LYH KWG++VDPVFEELLY
Sbjct  477  GYKETGFLNEVTEVVRTGVTPAEKLLELYHGKWGRSVDPVFEELLY  522



>ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana 
tomentosiformis]
Length=522

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMT+DWT EEREMLR KVP +GLKTPFRDGLLKHVAQDV+KLAKEGLERR
Sbjct  417  YDEVSLQTVLDMTSDWTAEEREMLRNKVPTSGLKTPFRDGLLKHVAQDVVKLAKEGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFLNE+TEVV TG+TPAEKLL+LYH KWG++VDPVFEELLY
Sbjct  477  GYKETGFLNEVTEVVKTGVTPAEKLLELYHGKWGRSVDPVFEELLY  522



>ref|XP_011072645.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
 ref|XP_011072650.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ+VLDM ADWT EER+MLR KVP +GLKTPFRDGLLKHVAQ+VLKLAK+GLERR
Sbjct  421  YDEVSLQSVLDMVADWTPEERQMLRNKVPKSGLKTPFRDGLLKHVAQEVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+TEVVNTG+TPAEKLL+LY+ KWGQ+VDPVFEELLY
Sbjct  481  GFKETGFLNEVTEVVNTGVTPAEKLLELYYGKWGQSVDPVFEELLY  526



>emb|CDP09740.1| unnamed protein product [Coffea canephora]
Length=611

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDEISLQ+VLDMTADWT EER+MLR KVP +GL TPFRDGLLKHVAQDV+KLAK+GLERR
Sbjct  506  YDEISLQSVLDMTADWTAEERQMLRNKVPKSGLNTPFRDGLLKHVAQDVVKLAKDGLERR  565

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LYH KWGQ+VDPVFEELLY
Sbjct  566  GFKETGFLNEVAEVVKTGVTPAEKLLELYHGKWGQSVDPVFEELLY  611



>ref|XP_006343987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Solanum 
tuberosum]
Length=523

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMT+DWT EER+MLR KVP +GLKTPFRDGLL HVAQDV+KLAKEGLERR
Sbjct  418  YDEGSLQSVLDMTSDWTAEERDMLRNKVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERR  477

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+TEVV TG+TPAEKLL+LYH KWGQ+VDP+FEELLY
Sbjct  478  GFKETGFLNEVTEVVKTGVTPAEKLLELYHGKWGQSVDPIFEELLY  523



>ref|XP_010529570.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Tarenaya 
hassleriana]
Length=524

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQAVLD+TADWT EEREMLR KVPVTGLKTPFRDG LKHVA+DVLKLAK+GLERR
Sbjct  419  YDEESLQAVLDITADWTAEEREMLRNKVPVTGLKTPFRDGRLKHVAEDVLKLAKDGLERR  478

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFLN + EVVNTG+TPAEKLL+LYH +WGQNV+PVF+ELLY
Sbjct  479  GYKETGFLNAVAEVVNTGVTPAEKLLELYHGEWGQNVEPVFQELLY  524



>ref|XP_011080960.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Sesamum 
indicum]
Length=526

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWT  ER+MLR KVP +GLKTPFRDGLLKHVAQ+V+K AK+GLERR
Sbjct  421  YDEVSLQNVLDMTADWTQGERQMLRNKVPKSGLKTPFRDGLLKHVAQEVVKFAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVVNTG+TPAEKLL LYH KWGQN+DPVFEELLY
Sbjct  481  GFKETGFLNEVMEVVNTGVTPAEKLLALYHGKWGQNIDPVFEELLY  526



>ref|XP_008392576.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Malus 
domestica]
Length=218

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER++LR KVP+TGLKTPFRDGLLKHVAQDV+ LAK+GLERR
Sbjct  113  YDEVSLQNVLDLTADWTPEERQLLRNKVPITGLKTPFRDGLLKHVAQDVVXLAKDGLERR  172

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ E+V  G+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  173  GFKETGFLNEVVELVRAGVTPAEKLLELYNGKWGQQIDPVFEELLY  218



>ref|XP_008341055.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Malus domestica]
Length=526

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLA++GLERR
Sbjct  421  YDEVSLQNVLDLTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  481  GFKETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQIDPVFEELLY  526



>gb|EYU23478.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
 gb|EYU23479.1| hypothetical protein MIMGU_mgv1a004459mg [Erythranthe guttata]
Length=526

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE++LQ VLD+TADWT EER+MLR KVPV+GLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  421  YDEVALQNVLDLTADWTKEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVNFAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+TEVV TGITPAEKLL+LYH KWGQ++DPVFEELLY
Sbjct  481  GFKETGFLNEVTEVVKTGITPAEKLLELYHGKWGQSIDPVFEELLY  526



>ref|XP_009350437.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=503

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLA++GLERR
Sbjct  398  YDEVSLQNVLDLTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERR  457

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  458  GFKETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQMDPVFEELLY  503



>ref|XP_008341054.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=547

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLA++GLERR
Sbjct  442  YDEVSLQNVLDLTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERR  501

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  502  GFKETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQIDPVFEELLY  547



>ref|XP_008341053.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=550

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLA++GLERR
Sbjct  445  YDEVSLQNVLDLTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERR  504

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  505  GFKETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQIDPVFEELLY  550



>ref|XP_002509800.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF51187.1| Glutamate--cysteine ligase, chloroplast precursor, putative [Ricinus 
communis]
Length=526

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDEISLQ VLDMTADWT EEREMLR KVP TGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  421  YDEISLQNVLDMTADWTPEEREMLRNKVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLNE+TEVV TG+TPAE+LL+LY+ KWGQ+VDPVFEELLY
Sbjct  481  GYKEIGFLNEVTEVVRTGVTPAERLLELYNGKWGQSVDPVFEELLY  526



>dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia elegans]
Length=523

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ VLDMTADWT EER+MLR KVPV GLKTPFRDGLLKHVA++VLK AK+GLERR
Sbjct  418  YDDISLQNVLDMTADWTQEERQMLRNKVPVAGLKTPFRDGLLKHVAEEVLKFAKDGLERR  477

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFLNE+ EVV TG+TPAEKLL+LYH KWGQ+VDPVFEELLY
Sbjct  478  GYKETGFLNEVAEVVRTGLTPAEKLLELYHGKWGQSVDPVFEELLY  523



>gb|KJB37542.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=490

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ++LDMTADWT EEREMLR KVP TGLKTPFRDGLL H+A+DVLKLAK+GLERR
Sbjct  385  YDEVSLQSILDMTADWTSEEREMLRNKVPKTGLKTPFRDGLLWHIAEDVLKLAKDGLERR  444

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAEKLL+LY+ KWGQ+VDPVFEELLY
Sbjct  445  GFKESGFLNEVAEVVRTGVTPAEKLLELYNGKWGQSVDPVFEELLY  490



>ref|XP_009350436.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=526

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLA++GLERR
Sbjct  421  YDEVSLQNVLDLTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  481  GFKETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQMDPVFEELLY  526



>gb|KJB37540.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37543.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
 gb|KJB37544.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=526

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ++LDMTADWT EEREMLR KVP TGLKTPFRDGLL H+A+DVLKLAK+GLERR
Sbjct  421  YDEVSLQSILDMTADWTSEEREMLRNKVPKTGLKTPFRDGLLWHIAEDVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAEKLL+LY+ KWGQ+VDPVFEELLY
Sbjct  481  GFKESGFLNEVAEVVRTGVTPAEKLLELYNGKWGQSVDPVFEELLY  526



>gb|ADR66068.1| gamma-glutamylcysteine synthetase, partial [Cichorium intybus]
Length=101

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EEREMLR KVPVTGLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  5    YDDVSLQNVLDMTADWTAEEREMLRNKVPVTGLKTPFRDGLLKHVAQEVVNFAKDGLERR  64

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNV  396
            G+KETGFLNE+TEVV TG+TPAEKLLDLYH KWGQNV
Sbjct  65   GYKETGFLNEVTEVVRTGLTPAEKLLDLYHGKWGQNV  101



>ref|NP_001234010.1| glutamate--cysteine ligase, chloroplastic [Solanum lycopersicum]
 sp|O22493.1|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Solanum lycopersicum]
 gb|AAB71230.1| gamma-glutamylcysteine synthetase [Solanum lycopersicum]
Length=523

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMT DWT EER+MLR KVP +GLKTPFRDGLL HVAQDV+KLAKEGLERR
Sbjct  418  YDEGSLQSVLDMTFDWTAEERDMLRNKVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERR  477

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LYH KWGQ+VDP+FEELLY
Sbjct  478  GFKETGFLNEVAEVVKTGVTPAEKLLELYHGKWGQSVDPIFEELLY  523



>ref|XP_010325297.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Solanum lycopersicum]
 gb|ACQ91100.1| GSH1 [Solanum lycopersicum]
Length=523

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMT DWT EER+MLR KVP +GLKTPFRDGLL HVAQDV+KLAKEGLERR
Sbjct  418  YDEGSLQSVLDMTFDWTAEERDMLRNKVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERR  477

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LYH KWGQ+VDP+FEELLY
Sbjct  478  GFKETGFLNEVAEVVKTGVTPAEKLLELYHGKWGQSVDPIFEELLY  523



>ref|XP_010540831.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=524

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMTADWT EEREMLRKKVPVTGLKTPFRDG LKHV +DVLKLAK+GLERR
Sbjct  419  YDEESLQSVLDMTADWTPEEREMLRKKVPVTGLKTPFRDGRLKHVTEDVLKLAKDGLERR  478

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFLN + EVV TGITPAEKLL+LYH +WGQ+VDPVF+ELLY
Sbjct  479  GYKETGFLNAVAEVVQTGITPAEKLLELYHGEWGQSVDPVFKELLY  524



>gb|AFF18844.2| gamma-glutamylcysteine synthetase [Dimocarpus longan]
Length=511

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ  LD+TADWT EER+MLR KVP TGLKTPFRDGLL+HVAQD+LKLAK+GLERR
Sbjct  406  YDEVSLQNALDLTADWTSEERQMLRNKVPKTGLKTPFRDGLLRHVAQDILKLAKDGLERR  465

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLN + EVV TG+TPAEKLL++YH KWGQ+VDPVFEELLY
Sbjct  466  GFKESGFLNAVAEVVRTGVTPAEKLLEMYHGKWGQSVDPVFEELLY  511



>ref|XP_009402382.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=517

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWT+EER+MLR+KVP+TGLKTPFRDGLL+HVA++VL+L+K+GLERR
Sbjct  412  YDEVSLQNVLDMTADWTMEERQMLRRKVPITGLKTPFRDGLLRHVAEEVLQLSKDGLERR  471

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+T+VV TG+TPAEKLL+LYH KWG+NVDPVFEELLY
Sbjct  472  GYKEAGFLKEVTDVVQTGVTPAEKLLELYHGKWGRNVDPVFEELLY  517



>ref|XP_007209899.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
 gb|EMJ11098.1| hypothetical protein PRUPE_ppa004151mg [Prunus persica]
Length=526

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE++LQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLAK+GLERR
Sbjct  421  YDEVALQNVLDITADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAE+LL+LY+ KWGQ +DPVFEELLY
Sbjct  481  GFKESGFLNEVAEVVRTGVTPAERLLELYNGKWGQQIDPVFEELLY  526



>gb|ADR66069.1| gamma-glutamylcysteine synthetase, partial [Cichorium intybus]
Length=101

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EEREMLR KVPVTGLKTPFRDGLLKHVAQ+V+ +AK+GLERR
Sbjct  5    YDDVSLQNVLDMTADWTAEEREMLRNKVPVTGLKTPFRDGLLKHVAQEVVNMAKDGLERR  64

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNV  396
            G+KETGFLNE+TEVV TG+TPAEKLL+LYH KWGQNV
Sbjct  65   GYKETGFLNEVTEVVRTGLTPAEKLLELYHGKWGQNV  101



>gb|KDP25439.1| hypothetical protein JCGZ_20595 [Jatropha curcas]
Length=471

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDEISLQ VLDM ADWT EER+MLR KVPVTGLKTPFRDGLL+HVA+DVL+LAK+GL+RR
Sbjct  366  YDEISLQHVLDMVADWTPEERQMLRNKVPVTGLKTPFRDGLLRHVAEDVLQLAKDGLQRR  425

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLNE+ EVV TG+TPAEKLL+LY+ KWGQ+VDPVFEELLY
Sbjct  426  GFKEVGFLNEVAEVVRTGVTPAEKLLELYNGKWGQSVDPVFEELLY  471



>ref|XP_008238836.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238837.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238838.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
 ref|XP_008238840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Prunus 
mume]
Length=526

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE++LQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLAK+GLERR
Sbjct  421  YDEVALQNVLDITADWTPEERQMLRDKVPITGLKTPFRDGLLKHVAQDVVKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAE+LL+LY+ KWGQ +DPVFEELLY
Sbjct  481  GFKESGFLNEVAEVVRTGVTPAERLLELYNGKWGQQIDPVFEELLY  526



>gb|KDO76210.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=396

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDMTADWT  ER+MLR KVP TGLKTPFRDGLL+HVAQDVLKL+K+GLERR
Sbjct  291  YDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERR  350

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLLD+YH KW ++VDPVFEELLY
Sbjct  351  GFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY  396



>gb|AHC02699.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
 gb|AHC02700.1| gamma-glutamylcysteine synthetase [Pyrus calleryana]
Length=490

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ  LD TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLA++GLERR
Sbjct  385  YDEVSLQNALDRTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERR  444

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  445  GFKETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQMDPVFEELLY  490



>gb|AHJ60103.1| gamma-glutamylcysteine synthetase [Pyrus betulifolia]
Length=526

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ  LD TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLA++GLERR
Sbjct  421  YDEVSLQNALDRTADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLARDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  481  GFKETGFLNEVAEVVRTGVTPAEKLLELYNGKWGQQMDPVFEELLY  526



>emb|CAL59719.1| gamma-glutamylcysteinyl synthetase [Medicago sativa]
Length=206

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWTLEEREMLR KV VTGLKTPFRDGLLKHVA++VL+LAK+GLERR
Sbjct  101  YDEVSLQRVLDMTADWTLEEREMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERR  160

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLN + EVV TG+TPAE+LL+LYH KW Q+VD VF+ELLY
Sbjct  161  GFKESGFLNAVAEVVRTGVTPAERLLELYHGKWEQSVDHVFDELLY  206



>gb|KHN16824.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=510

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ+VLDMTADWT EER+MLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  405  YDEVSLQSVLDMTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  464

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAE+LL+LYH KW Q+VD V+EELLY
Sbjct  465  GFKESGFLNEVAEVVRTGVTPAERLLELYHGKWEQSVDHVYEELLY  510



>ref|XP_010920822.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010920823.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis 
guineensis]
Length=523

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWT EER+MLR+KVPVTGL+TPFRDGLL+HVA+DVLKLAK+GLERR
Sbjct  418  YDEVSLQNVLDMTADWTEEERQMLREKVPVTGLRTPFRDGLLRHVAEDVLKLAKDGLERR  477

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             +KE GFLNE+TEVV TG+TPAEKLL+LYH KWG +VDPVF+ELLY
Sbjct  478  SYKEAGFLNEVTEVVRTGVTPAEKLLELYHGKWGCSVDPVFKELLY  523



>ref|XP_002273626.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660724.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 ref|XP_010660727.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Vitis vinifera]
 emb|CBI34672.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ  LD+ ADWTLEER+MLR KVP TGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  421  YDEVSLQNALDIIADWTLEERQMLRNKVPKTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLN + EVV TG+TPAEKLL++YH  WGQ VDPVFEELLY
Sbjct  481  GFKETGFLNAVAEVVRTGVTPAEKLLEMYHGPWGQCVDPVFEELLY  526



>ref|XP_003525397.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Glycine max]
 ref|XP_006580590.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Glycine max]
 gb|KHN23647.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=504

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SL++VLDMTADWT EER+MLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  399  YDELSLKSVLDMTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  458

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAE+LL+LYH KW Q+VD VFEELLY
Sbjct  459  GFKESGFLNEVAEVVRTGVTPAERLLELYHGKWEQSVDHVFEELLY  504



>ref|XP_010255398.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nelumbo 
nucifera]
Length=526

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ +LDMTADWTLEER+MLR KVP TGLKTPFRDGLL+HVA+DVL+LAK+GLERR
Sbjct  421  YDEVSLQHILDMTADWTLEERQMLRNKVPKTGLKTPFRDGLLRHVAEDVLELAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFL E+TEVV TG+TPAEKLL+LYH  W Q VDP+FEELLY
Sbjct  481  GYKETGFLKEVTEVVRTGVTPAEKLLELYHGSWSQCVDPIFEELLY  526



>ref|XP_010937863.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
 ref|XP_010937864.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis 
guineensis]
Length=522

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMT+DWT +ER+MLR+KVPVTGLKTPFRDGLL+HVA++VLKLAK+GLERR
Sbjct  417  YDEVSLQNVLDMTSDWTEQERQMLRRKVPVTGLKTPFRDGLLRHVAEEVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+TEVV+TG+TPAEKLL+LYH KWG +VDPVFEELLY
Sbjct  477  GYKEAGFLKEVTEVVSTGVTPAEKLLELYHGKWGCSVDPVFEELLY  522



>ref|XP_006283533.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
 gb|EOA16431.1| hypothetical protein CARUB_v10004582mg [Capsella rubella]
Length=525

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLK AK+GLERR
Sbjct  420  YDEDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKHAKDGLERR  479

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAEKLL++YH +WGQ+VDPVFEELLY
Sbjct  480  GYKEAGFLNAVTEVVRTGVTPAEKLLEMYHGEWGQSVDPVFEELLY  525



>ref|XP_008789126.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Phoenix 
dactylifera]
Length=522

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWT +EREMLR+KVPVTGLKTPFRDGLL++VA++VLKLAK+GLERR
Sbjct  417  YDEVSLQNVLDMTADWTEQEREMLRRKVPVTGLKTPFRDGLLRYVAEEVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+TEVV+TG+TPAEKLL+LYH KWG +VDPVFEELLY
Sbjct  477  GYKEAGFLKEVTEVVSTGVTPAEKLLELYHGKWGCSVDPVFEELLY  522



>gb|KDO76209.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=502

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDMTADWT  ER+MLR KVP TGLKTPFRDGLL+HVAQDVLKL+K+GLERR
Sbjct  397  YDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERR  456

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLLD+YH KW ++VDPVFEELLY
Sbjct  457  GFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY  502



>gb|KDO76206.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76207.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
 gb|KDO76208.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis]
Length=488

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDMTADWT  ER+MLR KVP TGLKTPFRDGLL+HVAQDVLKL+K+GLERR
Sbjct  383  YDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERR  442

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLLD+YH KW ++VDPVFEELLY
Sbjct  443  GFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY  488



>ref|XP_006439553.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 ref|XP_006439554.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52793.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
 gb|ESR52794.1| hypothetical protein CICLE_v10019696mg [Citrus clementina]
Length=526

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDMTADWT  ER+MLR KVP TGLKTPFRDGLL+HVAQDVLKL+K+GLERR
Sbjct  421  YDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLLD+YH KW ++VDPVFEELLY
Sbjct  481  GFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY  526



>ref|XP_006476577.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476578.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=526

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDMTADWT  ER+MLR KVP TGLKTPFRDGLL+HVAQDVLKL+K+GLERR
Sbjct  421  YDEDSLQNVLDMTADWTTGERQMLRNKVPKTGLKTPFRDGLLRHVAQDVLKLSKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLLD+YH KW ++VDPVFEELLY
Sbjct  481  GFKETGFLNEVAEVVRTGVTPAEKLLDMYHGKWRESVDPVFEELLY  526



>ref|XP_006851855.1| hypothetical protein AMTR_s00041p00090940 [Amborella trichopoda]
 gb|ERN13322.1| hypothetical protein AMTR_s00041p00090940 [Amborella trichopoda]
Length=439

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE++LQ VLDMT DWT+EER+MLR K+P TGL+TPFRDGLL+HVAQDV+KLAKEGLERR
Sbjct  334  YDEVALQTVLDMTYDWTVEERQMLRTKIPKTGLRTPFRDGLLRHVAQDVVKLAKEGLERR  393

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFLNE+ EVV TG+TPAEKLLDLYH KW   VDPV+EELLY
Sbjct  394  GYKETGFLNEVAEVVRTGVTPAEKLLDLYHGKWENRVDPVYEELLY  439



>ref|XP_008437270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
 ref|XP_008437272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Cucumis 
melo]
Length=525

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT  ER+MLR KVPV+GL TPFRDGL+KHVAQD++KLAK+GLERR
Sbjct  420  YDEVSLQNVLDITADWTQGERQMLRNKVPVSGLNTPFRDGLVKHVAQDIVKLAKDGLERR  479

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+TEV  TG+TPAEKLL+LY+ KWG+NVDPVFEELLY
Sbjct  480  GFKESGFLNEVTEVARTGVTPAEKLLELYNGKWGRNVDPVFEELLY  525



>ref|XP_004159947.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cucumis 
sativus]
Length=291

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+ ADWT  ER+MLR KVPV+GLKTPFRDGL+KHVAQD++KLAK+GLERR
Sbjct  186  YDEVSLQNVLDIIADWTQGERQMLRNKVPVSGLKTPFRDGLVKHVAQDIVKLAKDGLERR  245

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+TEV  TG+TPAEKLL+LY+ KW Q VDPVFEELLY
Sbjct  246  GFKESGFLNEVTEVARTGVTPAEKLLELYNGKWEQKVDPVFEELLY  291



>gb|ABK96626.1| unknown [Populus trichocarpa x Populus deltoides]
Length=526

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMTADWT EER+MLR KVP TGLKTPFRDGLL+HVA++VLKLAK+GLERR
Sbjct  421  YDEDSLQSVLDMTADWTSEERQMLRNKVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLN + EV +TGITPAEKLL+LYH KWGQ++DP FEELLY
Sbjct  481  GFKEVGFLNAVAEVASTGITPAEKLLELYHGKWGQSIDPAFEELLY  526



>gb|KJB37541.1| hypothetical protein B456_006G209400 [Gossypium raimondii]
Length=527

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 1/107 (1%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLR-KKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLER  510
            YDE+SLQ++LDMTADWT EEREMLR K+VP TGLKTPFRDGLL H+A+DVLKLAK+GLER
Sbjct  421  YDEVSLQSILDMTADWTSEEREMLRNKQVPKTGLKTPFRDGLLWHIAEDVLKLAKDGLER  480

Query  509  RGFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            RGFKE+GFLNE+ EVV TG+TPAEKLL+LY+ KWGQ+VDPVFEELLY
Sbjct  481  RGFKESGFLNEVAEVVRTGVTPAEKLLELYNGKWGQSVDPVFEELLY  527



>ref|XP_011463882.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=516

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER+MLR KVP+TGLKTPFRDGLLKHVAQDV+KLAK+GLERR
Sbjct  411  YDEVSLQNVLDITADWTPEERQMLRNKVPITGLKTPFRDGLLKHVAQDVVKLAKDGLERR  470

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE+GFLNE+ EVV TG+TPAE+LL+LY+ KW Q +DPVFEELLY
Sbjct  471  GYKESGFLNEVAEVVRTGVTPAERLLELYNGKWEQQIDPVFEELLY  516



>gb|EPS61788.1| gamma-glutamylcysteine synthetase, partial [Genlisea aurea]
Length=454

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ  LD+TADWT EER MLR KVP +GLKTPFRDGLLKHVAQ+V+K AK+GLERR
Sbjct  349  YDDISLQNALDLTADWTPEERLMLRNKVPKSGLKTPFRDGLLKHVAQEVVKFAKDGLERR  408

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+TEVVNTG+TPAEKLL+LYH KW  +VDPVFEELLY
Sbjct  409  GFKETGFLNEVTEVVNTGVTPAEKLLELYHGKWNGSVDPVFEELLY  454



>gb|AAL61610.1|AF401621_1 gamma-glutamylcysteine synthetase [Allium cepa]
Length=496

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+I+LQ+V+++TADWT EER+MLR+KVPVTGLKTPFRDGLLKHVA+DVLKLA+ GLERR
Sbjct  391  YDDIALQSVIEITADWTREERDMLRRKVPVTGLKTPFRDGLLKHVAEDVLKLAQGGLERR  450

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVVNTG+TPAEKLL+LYH KWG NVDP+F+ELLY
Sbjct  451  GYKEVGFLREVAEVVNTGVTPAEKLLELYHGKWGCNVDPIFQELLY  496



>ref|XP_011022699.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMTADWT EER+MLR KVP TGLKTPFRDGLL+HVA++VLKLAK+GLERR
Sbjct  421  YDEDSLQSILDMTADWTSEERQMLRNKVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLN + EV +TGITPAE+LL+LYH KWGQ++DPVFEELLY
Sbjct  481  GFKEVGFLNAVAEVASTGITPAEQLLELYHGKWGQSIDPVFEELLY  526



>dbj|BAP47506.1| gamma-glutamylcysteine synthetase [Gentiana triflora]
Length=526

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ+VLD+ ADWT  EREMLRKKV  +GL TPFRDGLLKHVAQDV+KLAK+GLERR
Sbjct  421  YDDISLQSVLDLVADWTSAEREMLRKKVAQSGLNTPFRDGLLKHVAQDVVKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ EVV TG+TPAEKLL+LYH KWG NV+PVFEELLY
Sbjct  481  GFKETGFLNEVAEVVKTGVTPAEKLLELYHGKWGGNVEPVFEELLY  526



>gb|ABK23872.1| unknown [Picea sitchensis]
Length=209

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLD+T DWTLEE +MLR KVP  GLKTPFRD LL+HVA+D+L+LAKEGL+RR
Sbjct  104  YDETSLQSVLDITKDWTLEEMQMLRNKVPKMGLKTPFRDSLLRHVAEDILQLAKEGLQRR  163

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G KE+GFLNE+ EVV TGITPAE+LLDLYH KWG  VDPVFEELLY
Sbjct  164  GCKESGFLNEVAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY  209



>ref|XP_009364899.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364900.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364901.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364902.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364956.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Pyrus x bretschneideri]
Length=526

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+TADWT EER++LR KVP+TGLKTPFRDGLLKHVAQDV+ LAK+GLERR
Sbjct  421  YDEVSLQNVLDLTADWTPEERQLLRNKVPLTGLKTPFRDGLLKHVAQDVVTLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ E+V  G+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  481  GFKETGFLNEVVELVRAGVTPAEKLLELYNGKWGQQIDPVFEELLY  526



>ref|XP_007040225.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 ref|XP_007040226.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24726.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
 gb|EOY24727.1| Glutamate-cysteine ligase isoform 1 [Theobroma cacao]
Length=525

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ +LDM ADWT EEREMLR KVP TGLKTPFRDG L+HVA+DVL LAK+GLERR
Sbjct  420  YDEVSLQNILDMIADWTPEEREMLRNKVPKTGLKTPFRDGFLQHVAEDVLTLAKDGLERR  479

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLN + +VV TG+TPAEKLL+LYH KWGQ+VDPVFEELLY
Sbjct  480  GFKESGFLNAVADVVRTGVTPAEKLLELYHGKWGQSVDPVFEELLY  525



>emb|CAC27145.1| glutamate-cysteine ligase [Picea abies]
Length=230

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLD+T DWTLEE +MLR KVP  GLKTPFRD LL+HVA+D+L+LAKEGL+RR
Sbjct  125  YDETSLQSVLDITKDWTLEEMQMLRNKVPKMGLKTPFRDSLLRHVAEDILQLAKEGLQRR  184

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G KE+GFLNE+ EVV TGITPAE+LLDLYH KWG  VDPVFEELLY
Sbjct  185  GCKESGFLNEVAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY  230



>ref|XP_010439228.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Camelina 
sativa]
Length=528

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLK AK+GLERR
Sbjct  423  YDEGSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKHAKDGLERR  482

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  483  GYKEAGFLNAVTEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  528



>ref|XP_010448772.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=528

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLK AK+GLERR
Sbjct  423  YDEESLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKHAKDGLERR  482

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  483  GYKEAGFLNAVTEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  528



>gb|KCW77523.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=291

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR KVP TGLKTPFRDG L+H+A+ V++LAK+GLERR
Sbjct  186  YDEVSLQNVLDMVADWTPEERQMLRNKVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERR  245

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAEKLL++Y+ KWGQ+VDPVFEELLY
Sbjct  246  GFKESGFLNEVKEVVRTGVTPAEKLLEMYNGKWGQSVDPVFEELLY  291



>gb|ADR66074.1| gamma-glutamylcysteine synthetase, partial [Zinnia violacea]
Length=105

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ VLDMTADWT +ER+MLR KVPVTGLKTPFRDGLLKHVA++VLK AK+GLERR
Sbjct  9    YDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNV  396
            G+KETGFLNE+ EVV TG+TPAEK+LDLYH KWGQ V
Sbjct  69   GYKETGFLNEVAEVVRTGLTPAEKILDLYHEKWGQTV  105



>ref|XP_009364919.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364920.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364921.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009364922.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=526

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLD+TADWT EER++LR KVP+TGLKTPFRDGLLKHVAQDV+ LAK+GLERR
Sbjct  421  YDEASLQNVLDLTADWTPEERQLLRNKVPLTGLKTPFRDGLLKHVAQDVVTLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKETGFLNE+ E+V  G+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  481  GFKETGFLNEVVELVRAGVTPAEKLLELYNGKWGQQIDPVFEELLY  526



>gb|ABM46854.1| gamma-glutamylcysteine synthetase [Chorispora bungeana]
Length=524

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +LQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  419  YDDDTLQAILDLTADWTAAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  478

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN ++EVV TG+TPAEKLL+LY+ +WGQ+VDPVF+ELLY
Sbjct  479  GYKEAGFLNAVSEVVRTGVTPAEKLLELYNGEWGQSVDPVFQELLY  524



>ref|XP_008792987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792991.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008792999.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
 ref|XP_008793008.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Phoenix dactylifera]
Length=522

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR+KV +TGLKTPFRDGLL+HVA+DVLKLAK+GLERR
Sbjct  417  YDEVSLQNVLDMIADWTEEERQMLREKVTITGLKTPFRDGLLRHVAEDVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             +KE GFLNE+TEVV TG+TPAEKLL+LYH KWG +VDPVFEELLY
Sbjct  477  CYKEAGFLNEVTEVVRTGVTPAEKLLELYHGKWGCSVDPVFEELLY  522



>gb|AAF22136.1|AF128454_1 gamma-glutamylcysteine synthetase precursor [Phaseolus vulgaris]
Length=508

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LD+TADWT EER+MLR KVPVTGLKTPFRDGLLKHVA+DVL+LAK+GLERR
Sbjct  403  YDEASLQSLLDLTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERR  462

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAE+LL+LYH KW Q+VD VFEELLY
Sbjct  463  GFKESGFLNEVAEVVRTGVTPAERLLELYHGKWEQSVDHVFEELLY  508



>ref|XP_007160058.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
 gb|ESW32052.1| hypothetical protein PHAVU_002G289200g [Phaseolus vulgaris]
Length=508

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LD+TADWT EER+MLR KVPVTGLKTPFRDGLLKHVA+DVL+LAK+GLERR
Sbjct  403  YDEASLQSLLDLTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERR  462

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAE+LL+LYH KW Q+VD VFEELLY
Sbjct  463  GFKESGFLNEVAEVVRTGVTPAERLLELYHGKWEQSVDHVFEELLY  508



>gb|AAL16161.1|AF428393_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  417  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  477  GYKEAGFLNAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  522



>emb|CAA71075.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  417  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  477  GYKEAGFLNAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  522



>ref|XP_002298035.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
 gb|EEE82840.2| hypothetical protein POPTR_0001s09340g [Populus trichocarpa]
Length=526

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMTADWT EER+MLR KVP TGLKTPFR GLL+HVA++VLKLAK+GLERR
Sbjct  421  YDEDSLQSVLDMTADWTSEERQMLRNKVPKTGLKTPFRGGLLRHVAEEVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLN +++VV+TG+TPAEKLL+LYH KWG+++DPVFEELLY
Sbjct  481  GFKEVGFLNAVSDVVSTGVTPAEKLLELYHGKWGRSIDPVFEELLY  526



>ref|XP_002867730.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43989.1| hypothetical protein ARALYDRAFT_492552 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  415  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  474

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  475  GYKEAGFLNAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  520



>ref|NP_194041.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 ref|NP_001190808.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 sp|P46309.2|GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; AltName: Full=Protein ROOT MERISTEMLESS 
1; Short=AtGCL; AltName: Full=Protein cadmium-sensitive 2; 
AltName: Full=Protein phytoalexin-deficient 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL31908.1|AF419576_1 AT4g23100/F7H19_290 [Arabidopsis thaliana]
 emb|CAA19826.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAD14544.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 emb|CAB79265.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
 gb|AAN28909.1| At4g23100/F7H19_290 [Arabidopsis thaliana]
 gb|AEE84706.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gb|AEE84708.1| glutamate-cysteine ligase [Arabidopsis thaliana]
Length=522

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  417  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  477  GYKEAGFLNAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  522



>gb|AAL08228.1| AT4g23100/F7H19_290 [Arabidopsis thaliana]
Length=522

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  417  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  477  GYKEAGFLNAVDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  522



>gb|AAF22137.1|AF128455_1 gamma-glutamylcysteine synthetase precursor [Pisum sativum]
Length=499

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWTLEEREMLR KV VTGLKTPFRDGLLKHVA++VL+LAK+GLERR
Sbjct  394  YDEVSLQRVLDMTADWTLEEREMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERR  453

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLN + EVV TG+TPAE+LL+LYH KW Q+VD VFEELLY
Sbjct  454  GFKESGFLNAVAEVVRTGVTPAERLLELYHGKWEQSVDHVFEELLY  499



>gb|ADX30738.2| truncated gamma-glutamyl-cysteine synthetase, partial [Populus 
x canadensis]
Length=415

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMTADWT EER+MLR KVP TGLKTPFR GLL+HVA++VLKLAK+GLERR
Sbjct  310  YDEDSLQSVLDMTADWTSEERQMLRIKVPKTGLKTPFRGGLLRHVAEEVLKLAKDGLERR  369

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLN +++VV+TG+TPAEKLL+LYH KWG+++DPVFEELLY
Sbjct  370  GFKEVGFLNAVSDVVSTGVTPAEKLLELYHGKWGRSIDPVFEELLY  415



>gb|ADE06226.1| gamma-glutamylcysteine synthetase [Hevea brasiliensis]
Length=523

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDEISLQ V+DM ADWT EE +MLR KVP TGLKTPFRDGLLKHVA DVLK AK+GLERR
Sbjct  418  YDEISLQNVMDMVADWTPEETQMLRNKVPKTGLKTPFRDGLLKHVAVDVLKFAKDGLERR  477

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLNE+ EVV TG+TPAEKLL+LY  KWGQ+VDPVFEELLY
Sbjct  478  GFKEIGFLNEVAEVVRTGVTPAEKLLELYDGKWGQSVDPVFEELLY  523



>ref|XP_008792981.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=575

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR+KV +TGLKTPFRDGLL+HVA+DVLKLAK+GLERR
Sbjct  470  YDEVSLQNVLDMIADWTEEERQMLREKVTITGLKTPFRDGLLRHVAEDVLKLAKDGLERR  529

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             +KE GFLNE+TEVV TG+TPAEKLL+LYH KWG +VDPVFEELLY
Sbjct  530  CYKEAGFLNEVTEVVRTGVTPAEKLLELYHGKWGCSVDPVFEELLY  575



>ref|XP_008792975.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=582

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR+KV +TGLKTPFRDGLL+HVA+DVLKLAK+GLERR
Sbjct  477  YDEVSLQNVLDMIADWTEEERQMLREKVTITGLKTPFRDGLLRHVAEDVLKLAKDGLERR  536

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             +KE GFLNE+TEVV TG+TPAEKLL+LYH KWG +VDPVFEELLY
Sbjct  537  CYKEAGFLNEVTEVVRTGVTPAEKLLELYHGKWGCSVDPVFEELLY  582



>ref|XP_010433943.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=529

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLK A++GLERR
Sbjct  424  YDEESLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKHAQDGLERR  483

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  484  GYKEVGFLNAVTEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY  529



>ref|XP_011029270.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029271.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011029272.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Populus 
euphratica]
Length=526

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMTADWT EER+MLR KVP TGLKTPFRDGLL+HVA++VLKLAK+GLERR
Sbjct  421  YDEDSLQSVLDMTADWTSEERQMLRNKVPKTGLKTPFRDGLLRHVAEEVLKLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLN +++VV+TG+TPAEKLL+LYH KW +++DPVFEELLY
Sbjct  481  GFKEVGFLNAVSDVVSTGVTPAEKLLELYHGKWERSIDPVFEELLY  526



>gb|ABJ98542.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=522

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  417  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV +G+TPAEKLL++Y+ +WGQ+VDPVFEELLY
Sbjct  477  GYKEAGFLNAVDEVVRSGVTPAEKLLEMYNGEWGQSVDPVFEELLY  522



>ref|XP_010695135.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695136.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695137.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMT DWT+EEREMLR KVP  GLKTPFRDG +KH+A++VLKLAK+GLERR
Sbjct  389  YDEDSLQSVLDMTYDWTVEEREMLRNKVPKLGLKTPFRDGYVKHIAEEVLKLAKDGLERR  448

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE GFLNE+ EVV TG+TPAE+LL++Y+ KWGQNVDPVFEELLY
Sbjct  449  GFKEIGFLNEVAEVVRTGVTPAERLLEMYNGKWGQNVDPVFEELLY  494



>ref|XP_003630512.1| Glutamate-cysteine ligase [Medicago truncatula]
 sp|Q9ZNX6.1|GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Medicago truncatula]
 gb|AAC82334.1| gamma-glutamylcysteine synthetase [Medicago truncatula]
 gb|AET04988.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=508

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWTLEEREMLR KV VTGLKTPFRDGLLKHVA++VL+LAK+GLERR
Sbjct  403  YDEVSLQRVLDMTADWTLEEREMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERR  462

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLN + EVV TG+TPAE+LL+LYH KW Q+VD VF+ELLY
Sbjct  463  GFKESGFLNAVAEVVRTGVTPAERLLELYHGKWEQSVDHVFDELLY  508



>gb|ADK77882.1| gamma-glutamylcysteine synthetase [Cucumis sativus]
Length=525

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+ ADWT  ER+MLR KVPV+GLKTPFRDGL+KHVAQD++KLAK+GLERR
Sbjct  420  YDEVSLQNVLDIIADWTQGERQMLRNKVPVSGLKTPFRDGLVKHVAQDIVKLAKDGLERR  479

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+TEV  TG+TPAEKLL+LY+ KW Q VDPVFEELLY
Sbjct  480  GFKESGFLNEVTEVARTGVTPAEKLLELYNGKWEQKVDPVFEELLY  525



>gb|KGN50100.1| hypothetical protein Csa_5G153150 [Cucumis sativus]
Length=501

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+ ADWT  ER+MLR KVPV+GLKTPFRDGL+KHVAQD++KLAK+GLERR
Sbjct  396  YDEVSLQNVLDIIADWTQGERQMLRNKVPVSGLKTPFRDGLVKHVAQDIVKLAKDGLERR  455

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+TEV  TG+TPAEKLL+LY+ KW Q VDPVFEELLY
Sbjct  456  GFKESGFLNEVTEVARTGVTPAEKLLELYNGKWEQKVDPVFEELLY  501



>ref|XP_004143907.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase, chloroplastic-like 
[Cucumis sativus]
Length=508

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLD+ ADWT  ER+MLR KVPV+GLKTPFRDGL+KHVAQD++KLAK+GLERR
Sbjct  403  YDEVSLQNVLDIIADWTQGERQMLRNKVPVSGLKTPFRDGLVKHVAQDIVKLAKDGLERR  462

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+TEV  TG+TPAEKLL+LY+ KW Q VDPVFEELLY
Sbjct  463  GFKESGFLNEVTEVARTGVTPAEKLLELYNGKWEQKVDPVFEELLY  508



>ref|XP_007210716.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
 gb|EMJ11915.1| hypothetical protein PRUPE_ppa022884mg, partial [Prunus persica]
Length=463

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ V+DM ADWT EER+MLR +VP TGLKTPFR  LLKHVAQDV++ AK GLERR
Sbjct  358  YDEVSLQNVIDMIADWTAEERQMLRDQVPKTGLKTPFRGRLLKHVAQDVVRFAKAGLERR  417

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GF ETGFLNE+ EV  TG+TPAEKLL+LY+RKWGQN+DPVFEELLY
Sbjct  418  GFNETGFLNELEEVARTGVTPAEKLLELYYRKWGQNIDPVFEELLY  463



>ref|XP_006413578.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413579.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 ref|XP_006413580.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 dbj|BAJ34068.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55031.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55032.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
 gb|ESQ55033.1| hypothetical protein EUTSA_v10024916mg [Eutrema salsugineum]
Length=524

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +LQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  419  YDEDTLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  478

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  479  GYKEAGFLNAVAEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  524



>gb|KCW77522.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=396

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR KVP TGLKTPFRDG L+H+A+ V++LAK+GLERR
Sbjct  291  YDEVSLQNVLDMVADWTPEERQMLRNKVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERR  350

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAEKLL++Y+ KWGQ+VDPVFEELLY
Sbjct  351  GFKESGFLNEVKEVVRTGVTPAEKLLEMYNGKWGQSVDPVFEELLY  396



>pdb|2GWD|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With Mg2+ And L-glutamate
Length=449

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQ+VLD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  344  YDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  403

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  404  GYKEVGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  449



>emb|CAA06613.1| gamma-glutamylcysteine synthetase [Brassica juncea]
Length=436

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQA LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  331  YDEDVLQAALDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  390

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  391  GYKEAGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  436



>sp|O23736.1|GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: 
Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine 
synthetase; Flags: Precursor [Brassica juncea]
 emb|CAA71801.1| gamma-glutamylcysteine synthetase [Brassica juncea]
 emb|CAD91712.1| glutamate-cysteine ligase [Brassica juncea]
Length=514

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQ+VLD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  409  YDEDVLQSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  468

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  469  GYKEVGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  514



>ref|XP_009136711.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136719.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 ref|XP_009136726.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Brassica 
rapa]
 emb|CAD91713.1| glutamate-cysteine ligase [Brassica juncea]
Length=511

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQA LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  406  YDEDVLQAALDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  465

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  466  GYKEAGFLNAVTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  511



>gb|AEA77156.1| chloroplast gamma glutamyl cysteine synthetase [Vigna radiata]
Length=508

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQ+VLD+TADWT EER MLR KVPVTGLKTPFRDGLLKHVA+DVL+LAK+GLERR
Sbjct  403  YDDASLQSVLDLTADWTPEERLMLRNKVPVTGLKTPFRDGLLKHVAEDVLQLAKDGLERR  462

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TP EKLL+LYH KW Q+VD VFEELLY
Sbjct  463  GFKESGFLNEVAEVVRTGVTPXEKLLELYHGKWEQSVDHVFEELLY  508



>emb|CAK24967.1| gamma-glutamylcysteine synthetase [Brassica napus]
 emb|CDY53137.1| BnaC01g41470D [Brassica napus]
Length=514

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQA LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  409  YDEDVLQAALDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  468

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  469  GYKEAGFLNALTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  514



>emb|CDY41369.1| BnaC03g65140D [Brassica napus]
Length=460

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQA+LD+TADWT  EREMLR KVPVTGLKTPFRDG LKHVA+DVLKLAK+GLERR
Sbjct  355  YDEDVLQAILDLTADWTHAEREMLRNKVPVTGLKTPFRDGFLKHVAEDVLKLAKDGLERR  414

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAE LLD+Y+ +WGQ+VDPVF+ELLY
Sbjct  415  GYKEVGFLNAVGEVVRTGVTPAENLLDMYNGEWGQSVDPVFQELLY  460



>ref|XP_010053262.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Eucalyptus grandis]
 gb|KCW77521.1| hypothetical protein EUGRSUZ_D01848 [Eucalyptus grandis]
Length=526

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR KVP TGLKTPFRDG L+H+A+ V++LAK+GLERR
Sbjct  421  YDEVSLQNVLDMVADWTPEERQMLRNKVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERR  480

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAEKLL++Y+ KWGQ+VDPVFEELLY
Sbjct  481  GFKESGFLNEVKEVVRTGVTPAEKLLEMYNGKWGQSVDPVFEELLY  526



>ref|XP_010053261.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=556

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR KVP TGLKTPFRDG L+H+A+ V++LAK+GLERR
Sbjct  451  YDEVSLQNVLDMVADWTPEERQMLRNKVPKTGLKTPFRDGYLRHIAEYVVQLAKDGLERR  510

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAEKLL++Y+ KWGQ+VDPVFEELLY
Sbjct  511  GFKESGFLNEVKEVVRTGVTPAEKLLEMYNGKWGQSVDPVFEELLY  556



>gb|ADR66071.1| gamma-glutamylcysteine synthetase, partial [Aster amellus]
Length=103

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+I+LQ+VLDMTADWT  EREMLR KVPV+GLKTPFRDGLLKHVA++VL  AK+GLERR
Sbjct  9    YDDIALQSVLDMTADWTQAEREMLRNKVPVSGLKTPFRDGLLKHVAEEVLTFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQ  402
            G+KETGFLNE+ EVV TG+TPAEKLLDLYH KWGQ
Sbjct  69   GYKETGFLNEVAEVVRTGLTPAEKLLDLYHGKWGQ  103



>emb|CDY41249.1| BnaA01g12900D [Brassica napus]
Length=511

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQA LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLA +GLERR
Sbjct  406  YDEDVLQAALDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLATDGLERR  465

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  466  GYKEAGFLNALTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  511



>gb|ACX70134.1| gamma-glutamylcysteine synthetase [Brassica rapa subsp. chinensis]
Length=511

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQA LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLA +GLERR
Sbjct  406  YDEDVLQAALDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLATDGLERR  465

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  466  GYKEAGFLNALTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  511



>ref|XP_004503722.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=504

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDEISLQ+VLD+T DWTLEER+MLR KV VTGL+TPFRDGLLKHVA++VLKLAK+GLERR
Sbjct  399  YDEISLQSVLDLTEDWTLEERQMLRNKVTVTGLRTPFRDGLLKHVAEEVLKLAKDGLERR  458

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLN + EVV TG+TPAE+LL+LY+ KW Q+VD VFEELLY
Sbjct  459  GFKESGFLNAVAEVVRTGVTPAERLLELYNGKWEQSVDHVFEELLY  504



>emb|CAD91714.1| glutamate-cysteine ligase [Brassica juncea]
Length=515

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQAVLD+ ADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GL+RR
Sbjct  410  YDEDVLQAVLDLIADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLDRR  469

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  470  GYKEAGFLNAVAEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  515



>ref|XP_009137315.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=515

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQAVLD+ ADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GL+RR
Sbjct  410  YDEDVLQAVLDLIADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLDRR  469

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  470  GYKEAGFLNAVAEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  515



>emb|CDY10914.1| BnaA03g45730D [Brassica napus]
Length=517

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQAVLD+ ADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GL+RR
Sbjct  412  YDEDVLQAVLDLIADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLDRR  471

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  472  GYKEAGFLNAVAEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  517



>pdb|2GWC|A Chain A, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|B Chain B, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|C Chain C, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|D Chain D, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|E Chain E, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|F Chain F, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|G Chain G, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
 pdb|2GWC|H Chain H, Crystal Structure Of Plant Glutamate Cysteine Ligase 
In Complex With A Transition State Analogue
Length=449

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQ+VLD+TADWT  ERE LR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  344  YDEDVLQSVLDLTADWTPAEREXLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  403

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN +TEVV TG+TPAE LL+ Y+ +WGQ+VDPVF+ELLY
Sbjct  404  GYKEVGFLNAVTEVVRTGVTPAENLLEXYNGEWGQSVDPVFQELLY  449



>ref|XP_009364953.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364954.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009364955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Pyrus x bretschneideri]
Length=537

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 11/117 (9%)
 Frame = -2

Query  686  YDEISL-----------QAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDV  540
            YDE+SL           Q VLD+TADWT EER++LR KVP+TGLKTPFRDGLLKHVAQDV
Sbjct  421  YDEVSLXXXXXXXXXXLQNVLDLTADWTPEERQLLRNKVPLTGLKTPFRDGLLKHVAQDV  480

Query  539  LKLAKEGLERRGFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            + LAK+GLERRGFKETGFLNE+ E+V  G+TPAEKLL+LY+ KWGQ +DPVFEELLY
Sbjct  481  VTLAKDGLERRGFKETGFLNEVVELVRAGVTPAEKLLELYNGKWGQQIDPVFEELLY  537



>gb|AAO45821.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
 gb|AAO27827.1| gamma-glutamylcysteine synthetase [Lotus japonicus]
Length=495

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLD+TADWT +ER+MLR KV V+GLKTPFRDGLLKHVA+DVLKLAK+GLE+R
Sbjct  390  YDEDSLQGVLDLTADWTQQERQMLRNKVTVSGLKTPFRDGLLKHVAEDVLKLAKDGLEKR  449

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GFKE+GFLNE+ EVV TG+TPAE+LL+LY  KW Q+VD VFEELLY
Sbjct  450  GFKESGFLNEVAEVVRTGVTPAERLLELYDGKWNQSVDHVFEELLY  495



>ref|XP_006586325.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Glycine 
max]
Length=507

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ+VLDMTADWT EER+MLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  405  YDEVSLQSVLDMTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  464

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNV  396
            GFKE+GFLNE+ EVV TG+TPAE+LL+LYH KW Q+V
Sbjct  465  GFKESGFLNEVAEVVRTGVTPAERLLELYHGKWEQSV  501



>ref|XP_009380693.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=524

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ V +M +DWT EEREMLRKKVPVTGLKTPFR GLL+HVA+DVLKLAK+GLERR
Sbjct  419  YDEVSLQNVSEMISDWTREEREMLRKKVPVTGLKTPFRGGLLRHVAEDVLKLAKDGLERR  478

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+TE V TG+TPAEKLL+LY+ KWG  V PVF+ELLY
Sbjct  479  GYKEAGFLKEVTETVQTGVTPAEKLLELYNGKWGGRVGPVFQELLY  524



>ref|XP_009380691.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009380692.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ V +M +DWT EEREMLRKKVPVTGLKTPFR GLL+HVA+DVLKLAK+GLERR
Sbjct  434  YDEVSLQNVSEMISDWTREEREMLRKKVPVTGLKTPFRGGLLRHVAEDVLKLAKDGLERR  493

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+TE V TG+TPAEKLL+LY+ KWG  V PVF+ELLY
Sbjct  494  GYKEAGFLKEVTETVQTGVTPAEKLLELYNGKWGGRVGPVFQELLY  539



>emb|CAR82640.1| putative glutamyl cysteine ligase [Brassica napus]
 emb|CDX94161.1| BnaC07g37950D [Brassica napus]
Length=503

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQAVLD+ AD T  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  398  YDEDVLQAVLDLIADLTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  457

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN + EVV TG+TPAE LL++Y+ +WGQ+VDPVF+ELLY
Sbjct  458  GYKEAGFLNAVAEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY  503



>gb|AAW58147.1| gamma-glutamylcysteine synthetase [Triticum aestivum]
Length=374

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQ+++DMTADWT EEREMLR+KVPVTGLKTPFRDG ++ +A+DVL+LAK GLERR
Sbjct  269  YDDESLQSIIDMTADWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERR  328

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAEKLL+LY  KW ++VDPVFEELLY
Sbjct  329  GYKEVGFLREVDEVVRTGVTPAEKLLNLYEMKWQRSVDPVFEELLY  374



>dbj|BAJ84988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   164 bits (416),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQ+++DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+DVL+LAK GLERR
Sbjct  269  YDDESLQSIIDMTSDWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERR  328

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAEKLL+LY  KW ++VDPVFEELLY
Sbjct  329  GYKEVGFLREVDEVVRTGVTPAEKLLNLYETKWQRSVDPVFEELLY  374



>gb|ADR66075.1| gamma-glutamylcysteine synthetase, partial [Helianthus annuus]
Length=94

 Score =   156 bits (394),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ VLDMTADWT  ER+MLR KVPVTGLKTPFRDGLLKHVA++VL+LAK+GLERR
Sbjct  5    YDDISLQNVLDMTADWTQGERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLQLAKDGLERR  64

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYH  417
            G+KETGFLNE+ EVV TG+TPAEKLL+LYH
Sbjct  65   GYKETGFLNEVAEVVRTGLTPAEKLLELYH  94



>ref|XP_003569058.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic [Brachypodium 
distachyon]
Length=497

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMTADWT  EREMLR+KVPVTGLKTPFRDG ++ +A+DVLKLAK GLERR
Sbjct  392  YDEESLQSILDMTADWTNAEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLKLAKSGLERR  451

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAEKLL+LY  KW ++VDPVF+ELLY
Sbjct  452  GYKEVGFLREVDEVVRTGVTPAEKLLNLYETKWQRSVDPVFQELLY  497



>ref|XP_010089108.1| Glutamate--cysteine ligase [Morus notabilis]
 gb|EXB37355.1| Glutamate--cysteine ligase [Morus notabilis]
Length=582

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 91/102 (89%), Gaps = 0/102 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDMTADWT EER+MLR KVP TGLKTPFRDG L+HVA+DVL LAK+GLERR
Sbjct  429  YDEVSLQNVLDMTADWTPEERQMLRNKVPKTGLKTPFRDGYLRHVAEDVLHLAKDGLERR  488

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFE  381
            GFKE+GFLN + EVV TG+TPAEKLL+LY+ +WGQ+VDPV E
Sbjct  489  GFKESGFLNAVAEVVRTGVTPAEKLLELYNGEWGQSVDPVKE  530



>gb|EMS60294.1| Glutamate--cysteine ligase B, chloroplastic [Triticum urartu]
Length=426

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQ+++DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+DVL+LAK GLERR
Sbjct  321  YDDESLQSIIDMTSDWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERR  380

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAEKLL+LY  KW ++VDPVFEELLY
Sbjct  381  GYKEVGFLREVDEVVRTGVTPAEKLLNLYETKWQRSVDPVFEELLY  426



>ref|NP_001059579.2| Os07g0462000 [Oryza sativa Japonica Group]
 dbj|BAF21493.2| Os07g0462000, partial [Oryza sativa Japonica Group]
Length=137

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  32   YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  91

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  92   GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  137



>ref|XP_009362009.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=262

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+ LR KVP TGLKTPFR GLL+HVA++V+K AK+GLERR
Sbjct  157  YDEVSLQNVLDMIADWTTEERQTLRDKVPKTGLKTPFRGGLLQHVAENVVKFAKDGLERR  216

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E+GFL+ + EV  TG+ PAEKLL LY+ +WGQN+DPVFEEL Y
Sbjct  217  GVNESGFLDGVVEVARTGVAPAEKLLQLYYGEWGQNIDPVFEELRY  262



>ref|NP_001168108.1| uncharacterized protein LOC100381846 [Zea mays]
 gb|ACN27107.1| unknown [Zea mays]
Length=186

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMT DWT EEREMLR KVP+TGLKTPFRDG ++ +A++VLKLAK GLERR
Sbjct  81   YDEESLQSILDMTFDWTQEEREMLRHKVPLTGLKTPFRDGYVRDLAEEVLKLAKNGLERR  140

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAE+LL LY  KW +NVD VFE LLY
Sbjct  141  GYKEVGFLREVDEVVRTGVTPAERLLHLYETKWQRNVDHVFEHLLY  186



>gb|ACK38262.1| gamma-glutamylcysteine synthetase [Phragmites australis]
Length=374

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMT DWT EEREMLR+KVP+TGLKTPFRDG ++ +A+DVLKLAK GLERR
Sbjct  269  YDEESLQSILDMTFDWTKEEREMLRRKVPLTGLKTPFRDGYVRDLAEDVLKLAKSGLERR  328

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TP+E+LL+LY  KW ++VDPVFE LLY
Sbjct  329  GYKEVGFLREVDEVVRTGVTPSERLLNLYETKWQRSVDPVFEHLLY  374



>dbj|BAJ21770.1| putative gamma-glutamylcysteine synthetase [Pteris vittata]
Length=502

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SL+  L++  DWT EER MLR+KVP  GLKTPFRDGLL+HVAQDV+KLAKEGL+RR
Sbjct  397  YDETSLEGALEIIKDWTQEERLMLRRKVPSLGLKTPFRDGLLRHVAQDVMKLAKEGLQRR  456

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL+EI EVVNTGITPAEKLL+ Y   W +NVDPV+EELLY
Sbjct  457  GYKEAGFLSEIVEVVNTGITPAEKLLEKYKGDWKENVDPVYEELLY  502



>gb|ADR66079.1| gamma-glutamylcysteine synthetase, partial [Hieracium umbellatum]
Length=96

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EER+MLR KVPV+GLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  9    YDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDL  423
            G+KETGFLNE+TEVV TG+TPAEKLL+L
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEKLLEL  96



>gb|ADR66073.1| gamma-glutamylcysteine synthetase, partial [Eupatorium cannabinum]
Length=93

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ VLDMTADWT EER+MLR KVPVTGLKTPFRDGLLKHVA++VLK AK+GLERR
Sbjct  5    YDDISLQNVLDMTADWTPEERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFAKDGLERR  64

Query  506  GFKETGFLNEITEVVNTGITPAEKLLD  426
            G+KETGFLNE+ EV+ TG+TPAEKLLD
Sbjct  65   GYKETGFLNEVAEVLRTGLTPAEKLLD  91



>gb|ADR66072.1| gamma-glutamylcysteine synthetase, partial [Arnica montana]
Length=93

 Score =   151 bits (382),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ VLDMTADWT +ER+MLR KVPVTGLKTPFRDGLLKHVA++VLK AK+GLERR
Sbjct  5    YDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFAKDGLERR  64

Query  506  GFKETGFLNEITEVVNTGITPAEKLLD  426
            G+KETGFLNE+ EVV TG+TPAEK+LD
Sbjct  65   GYKETGFLNEVAEVVRTGLTPAEKILD  91



>gb|KFK30813.1| hypothetical protein AALP_AA6G029500 [Arabis alpina]
Length=479

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDMT+DWT EEREMLR++VP+TGLKT FR GLLKHVA+DV+KLA +GLERR
Sbjct  374  YDEESLQTVLDMTSDWTAEEREMLRRQVPITGLKTVFRGGLLKHVAEDVVKLANDGLERR  433

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KETGFL  + EV  TGITPAEKLL+LY+  WGQ++D V+EEL Y
Sbjct  434  GYKETGFLKGVAEVAKTGITPAEKLLELYNGVWGQSIDHVYEELQY  479



>gb|ADR66082.1| gamma-glutamylcysteine synthetase, partial [Hieracium scabrum]
 gb|ADR66083.1| gamma-glutamylcysteine synthetase, partial [Hieracium scabrum]
Length=96

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ V+DMTADWT EER+MLR KVPV+GLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  9    YDDVSLQNVVDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDL  423
            G+KETGFLNE+TEVV TG+TPAEKLL+L
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEKLLEL  96



>ref|XP_010435330.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010435331.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=492

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDM  DW LEEREMLR  VP+ GLKT FR G LKHVA+DVLKLA +GLERR
Sbjct  387  YDEKSLQTVLDMIVDWNLEEREMLRTHVPIAGLKTMFRGGPLKHVAEDVLKLAMDGLERR  446

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFLN I EVV TG+TPA KLLDLY+ +WGQN+D VFEEL Y
Sbjct  447  GYNETGFLNPIAEVVRTGVTPAHKLLDLYNGEWGQNIDHVFEELRY  492



>gb|ADR66077.1| gamma-glutamylcysteine synthetase, partial [Hieracium porrifolium]
 gb|ADR66078.1| gamma-glutamylcysteine synthetase, partial [Hieracium porrifolium]
 gb|ADR66081.1| gamma-glutamylcysteine synthetase, partial [Hieracium cf. guatemalense 
KK-2010]
Length=96

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EER+MLR KVPV+GLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  9    YDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDL  423
            G+KETGFLNE+TEVV TG+TPAEKLL+ 
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEKLLEC  96



>ref|XP_009137312.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
 ref|XP_009137313.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Brassica 
rapa]
Length=491

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE  LQAVLDM ADWT EEREMLR +VPVT LKT FRDG LKHVA+DVLKLAK+GLERR
Sbjct  386  YDEECLQAVLDMIADWTTEEREMLRTQVPVTALKTMFRDGPLKHVAEDVLKLAKDGLERR  445

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             +KETGFL+ + EV  TG+TPAEKLL LY+  WGQ+VDP+F E+ Y
Sbjct  446  NYKETGFLDAVAEVAITGVTPAEKLLKLYNGDWGQSVDPLFHEMQY  491



>gb|ADR66070.1| gamma-glutamylcysteine synthetase, partial [Artemisia campestris]
Length=90

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ VLDMTADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVL  AK+GLERR
Sbjct  5    YDDISLQNVLDMTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLTFAKDGLERR  64

Query  506  GFKETGFLNEITEVVNTGITPAEKLL  429
            G+KETGFLNE+ EVV TG+TPAEKLL
Sbjct  65   GYKETGFLNEVAEVVRTGLTPAEKLL  90



>ref|XP_002439220.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
 gb|EES17650.1| hypothetical protein SORBIDRAFT_09g002470 [Sorghum bicolor]
Length=501

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+++DMT DWT EEREMLR+KVPVTGLKTPFRDG ++ +A++VLKLAK GLERR
Sbjct  396  YDEESLQSIIDMTFDWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEEVLKLAKSGLERR  455

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAE+LL+LY  KW +NVD VFE LLY
Sbjct  456  GYKEVGFLREVDEVVRTGVTPAERLLNLYETKWQRNVDHVFEHLLY  501



>ref|XP_002867731.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43990.1| hypothetical protein ARALYDRAFT_914292 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQAVLDM  DWT EEREMLR +VP+TGLKT FRD  L+HVA+D+LKLAK+GLERR
Sbjct  385  YDEDSLQAVLDMIYDWTPEEREMLRTQVPITGLKTMFRDIPLRHVAEDLLKLAKDGLERR  444

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFLN +TEVV TG+TPAEKLL LY+ +WGQN+D VF+ L Y
Sbjct  445  GYNETGFLNAVTEVVKTGVTPAEKLLKLYNGEWGQNIDHVFQGLRY  490



>ref|XP_008375303.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Malus domestica]
Length=488

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR KVP TGLKTPFR  LL+HVA++V+K AK+GLERR
Sbjct  383  YDEVSLQNVLDMIADWTXEERQMLRDKVPKTGLKTPFRGELLQHVAENVVKFAKDGLERR  442

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E+GFL+ + EV  TG+ PAEKLL LY+ +WGQN+DPVFEEL Y
Sbjct  443  GLNESGFLDGVVEVARTGVAPAEKLLQLYYGEWGQNIDPVFEELRY  488



>ref|XP_004960382.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=498

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMT DWT EEREMLR+KVPVTG KTPFRDG ++H+A++VL LAK GLERR
Sbjct  393  YDEESLQSILDMTFDWTKEEREMLRRKVPVTGFKTPFRDGYVRHLAEEVLTLAKNGLERR  452

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ +VV+TG+TPAE+LL+LY  KW +NVD VF+ LLY
Sbjct  453  GYKEVGFLREVEQVVSTGVTPAERLLNLYETKWQRNVDHVFQHLLY  498



>emb|CDX94156.1| BnaC07g37900D [Brassica napus]
Length=491

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQ VLDM ADWT EEREMLR +VPVTGLKT FRDG LKHVA+DVLK AK+GLERR
Sbjct  386  YDDESLQTVLDMIADWTTEEREMLRTQVPVTGLKTMFRDGPLKHVAEDVLKQAKDGLERR  445

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             +KETGFL+ +TEV  TG+TPAEKLL LY+  WGQ+VDP+F E+ Y
Sbjct  446  NYKETGFLDVVTEVAITGVTPAEKLLKLYNGDWGQSVDPLFHEMQY  491



>gb|ADR66076.1| gamma-glutamylcysteine synthetase, partial [Galinsoga parviflora]
Length=94

 Score =   149 bits (375),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ISLQ VLDMTADWT +ER+MLR KVPVTGLKTPFRDGLLKHVA++VLK AK+GLERR
Sbjct  9    YDDISLQNVLDMTADWTQDERQMLRNKVPVTGLKTPFRDGLLKHVAEEVLKFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLL  429
            G+KETGFLNE+ EVV TG+TPAEK+L
Sbjct  69   GYKETGFLNEVAEVVRTGLTPAEKIL  94



>gb|ADR66088.1| gamma-glutamylcysteine synthetase, partial [Pilosella onegensis]
Length=94

 Score =   149 bits (375),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+++LQ VLDMTADWT EER+MLR KVPV+GLKTPFRDGLLKHVAQ V+  AK+GLERR
Sbjct  9    YDDVALQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLL  429
            G+KETGFLNE+TEVV TG+TPAEKLL
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEKLL  94



>ref|XP_010440632.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010440634.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=492

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDM  DW LEEREMLR +VP+TGLKT FR G LK VA+DVLKLA +GLERR
Sbjct  387  YDEKSLQTVLDMIVDWNLEEREMLRIQVPITGLKTMFRGGPLKDVAEDVLKLAMDGLERR  446

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFLN I EVV TG+TPA KLLDLY+ +WGQN+D VFEEL Y
Sbjct  447  GYNETGFLNPIVEVVKTGVTPANKLLDLYNGEWGQNIDHVFEELRY  492



>gb|ADR66084.1| gamma-glutamylcysteine synthetase, partial [Hieracium intybaceum]
Length=95

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EER MLR KVPV+GLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  9    YDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLD  426
            G+KETGFLNE+TEVV TG+TPAEKLL+
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEKLLE  95



>gb|ADR66080.1| gamma-glutamylcysteine synthetase, partial [Hieracium umbellatum]
Length=96

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EER+MLR KVPV+GLKTP RDGLLKHVAQ+V+  AK+GLERR
Sbjct  9    YDDVSLQNVLDMTADWTAEERQMLRNKVPVSGLKTPLRDGLLKHVAQEVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDL  423
            G+KETGFLNE+TEVV TG+TPAEKLL+ 
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEKLLEC  96



>ref|XP_008648285.1| PREDICTED: gamma-glutamylcysteine synthetase1 isoform X1 [Zea 
mays]
 gb|AFW74704.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=503

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMT DWT EEREMLR+KVP TGLKTPFRDG ++ +A++VLKLAK GLERR
Sbjct  398  YDEESLQSILDMTFDWTKEEREMLRRKVPSTGLKTPFRDGYVRDLAEEVLKLAKNGLERR  457

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAE+LL+LY  KW +NVD VFE LLY
Sbjct  458  GYKEVGFLREVDEVVRTGVTPAERLLNLYETKWQRNVDHVFEHLLY  503



>gb|KFK30815.1| hypothetical protein AALP_AA6G029800 [Arabis alpina]
Length=349

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ +LDM +DWT EEREMLR  VPVTGLKT FRDG LKHVA+DV+KLAK+G ERR
Sbjct  244  YDEGSLQTILDMISDWTTEEREMLRTHVPVTGLKTMFRDGPLKHVAEDVIKLAKDGFERR  303

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G++E GFL  + EVV  G+TPAEKLL+LY+  WGQ++DP+F++L Y
Sbjct  304  GYREIGFLEPLVEVVRIGVTPAEKLLELYNGDWGQSIDPLFQKLKY  349



>ref|XP_006654002.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Oryza 
brachyantha]
Length=438

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A++VL+L+K GLERR
Sbjct  333  YDEESLQSISDMTSDWTNEEREMLRQKVPVTGLKTPFRDGYVRDLAEEVLQLSKNGLERR  392

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  VV++G+TPAE+LL+LY  KW  +VDPVF+ELLY
Sbjct  393  GYKEVGFLREVDAVVSSGVTPAERLLNLYETKWQHSVDPVFQELLY  438



>ref|XP_008655177.1| PREDICTED: uncharacterized protein LOC100381846 isoform X1 [Zea 
mays]
 gb|AFW82737.1| hypothetical protein ZEAMMB73_015174 [Zea mays]
Length=500

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMT DWT EEREMLR KVP+TGLKTPFRDG ++ +A++VLKLAK GLERR
Sbjct  395  YDEESLQSILDMTFDWTQEEREMLRHKVPLTGLKTPFRDGYVRDLAEEVLKLAKNGLERR  454

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAE+LL LY  KW +NVD VFE LLY
Sbjct  455  GYKEVGFLREVDEVVRTGVTPAERLLHLYETKWQRNVDHVFEHLLY  500



>ref|XP_002875199.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51458.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=448

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDM  DWT EEREMLR +VP+TGLKT FRD  LKHVA+DVLKLAK+GLERR
Sbjct  343  YDEDSLQTVLDMIDDWTTEEREMLRTQVPITGLKTMFRDRPLKHVAEDVLKLAKDGLERR  402

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFL  + EVV TG+TPAEKLL+LY+  WGQN+D VF+ L Y
Sbjct  403  GYNETGFLKALAEVVRTGVTPAEKLLELYNGDWGQNIDSVFQGLRY  448



>emb|CAD48598.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=438

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  333  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  392

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  393  GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  438



>gb|ADR66087.1| gamma-glutamylcysteine synthetase, partial [Pilosella lactucella]
Length=96

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+++LQ VLDMTADWT EER+MLR KVPV+GLKTPFRDGLLKHVAQ V+  AK+GLERR
Sbjct  9    YDDVALQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDL  423
            G+KETGFLNE+TEVV TG+TPAE LL+ 
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEMLLEC  96



>emb|CAD48599.3| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=492

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  387  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  446

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  447  GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  492



>ref|NP_001054541.1| Os05g0129000 [Oryza sativa Japonica Group]
 sp|Q688Q9.1|GSH1A_ORYSJ RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|AAU10747.1| putative gamma-glutamylcysteine synthetase [Oryza sativa Japonica 
Group]
 dbj|BAF16455.1| Os05g0129000 [Oryza sativa Japonica Group]
 dbj|BAG96011.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  387  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  446

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  447  GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  492



>sp|Q8GU95.2|GSH1A_ORYSI RecName: Full=Glutamate--cysteine ligase A, chloroplastic; AltName: 
Full=Gamma-ECS A; Short=GCS A; AltName: Full=Gamma-glutamylcysteine 
synthetase A; Flags: Precursor [Oryza sativa 
Indica Group]
 gb|EEC78447.1| hypothetical protein OsI_18304 [Oryza sativa Indica Group]
Length=492

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  387  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  446

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  447  GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  492



>sp|Q6Z3A3.1|GSH1B_ORYSJ RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAC84166.1| gamma-glutamylcysteine synthetase [Oryza sativa Japonica Group]
Length=496

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  391  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  450

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  451  GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  496



>gb|EEE67118.1| hypothetical protein OsJ_24143 [Oryza sativa Japonica Group]
Length=579

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  474  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  533

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  534  GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  579



>gb|ADR66085.1| gamma-glutamylcysteine synthetase, partial [Pilosella lactucella]
Length=96

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+++LQ VLDMTADWT EER+MLR KVPV+GLKTPFRDGLLKHVAQ V+  AK+GLER 
Sbjct  9    YDDVALQNVLDMTADWTAEERQMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFAKDGLERG  68

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDL  423
            G+KETGFLNE+TEVV TG+TPAEKLL+ 
Sbjct  69   GYKETGFLNEVTEVVRTGLTPAEKLLEC  96



>ref|NP_001105142.1| gamma-glutamylcysteine synthetase1 [Zea mays]
 emb|CAC83005.1| putative gamma-glutamylcysteine synthetase [Zea mays]
Length=438

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++LDMT DWT EEREMLR+KVP TGLKTPFRDG ++ +A++VLKLAK GLERR
Sbjct  333  YDEESLQSILDMTFDWTKEEREMLRRKVPSTGLKTPFRDGYVRDLAEEVLKLAKNGLERR  392

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFL E+ EVV TG+TPAE+LL  Y  KW +NVD VFE LLY
Sbjct  393  GYKEVGFLREVDEVVRTGVTPAERLLSPYETKWQRNVDHVFEHLLY  438



>gb|EEE62203.1| hypothetical protein OsJ_16990 [Oryza sativa Japonica Group]
Length=1281

 Score =   159 bits (403),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 70/106 (66%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  686   YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
             YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  1176  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  1235

Query  506   GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             G+KE GFL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  1236  GYKEVGFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  1281



>emb|CDY63259.1| BnaA03g58670D [Brassica napus]
Length=491

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SL+ VLDM ADWT EEREML  +VPVTGLKT FRD  LKHVA+DVLKLAK+GLERR
Sbjct  386  YDDESLRTVLDMIADWTTEEREMLMTQVPVTGLKTMFRDVTLKHVAEDVLKLAKDGLERR  445

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
             +KETGFL+ +TEV  TG+TPAEKLL LY+  WGQ+VDP+F E+ Y
Sbjct  446  NYKETGFLDAVTEVAITGVTPAEKLLKLYNGDWGQSVDPLFHEMQY  491



>ref|XP_001757520.1| predicted protein [Physcomitrella patens]
 gb|EDQ77577.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  LD+  DWT  ER MLR KVP  GL  PFRDGLLKHVAQDV KLAK+GL RR
Sbjct  356  YDEESLQGALDIINDWTERERAMLRSKVPKLGLNVPFRDGLLKHVAQDVFKLAKDGLTRR  415

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  ETGFL +I E V TG TPAE +L+LYH KWG+NVDPVFE+LLY
Sbjct  416  GLNETGFLKDIEETVRTGKTPAEHILELYHGKWGENVDPVFEKLLY  461



>ref|XP_010433942.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=447

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 88/106 (83%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWTLEE EMLR +VP+TGLKT FRD  LKHVA+DVLKLAK+GLERR
Sbjct  342  YDENSLQTTLNMIDDWTLEELEMLRTQVPITGLKTMFRDKPLKHVAEDVLKLAKDGLERR  401

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETG+L+ + EVV TG+TPAEKLL+LY+ +WGQNVD VF EL Y
Sbjct  402  GYNETGYLDAVAEVVRTGVTPAEKLLELYNGEWGQNVDHVFRELQY  447



>sp|A2YL07.2|GSH1B_ORYSI RecName: Full=Glutamate--cysteine ligase B, chloroplastic; AltName: 
Full=Gamma-ECS B; Short=GCS B; AltName: Full=Gamma-glutamylcysteine 
synthetase B; Flags: Precursor [Oryza sativa 
Indica Group]
Length=496

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  391  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  450

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE  FL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  451  GYKEVSFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  496



>gb|EEC81979.1| hypothetical protein OsI_25896 [Oryza sativa Indica Group]
Length=670

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ++ DMT+DWT EEREMLR+KVPVTGLKTPFRDG ++ +A+++L+L+K GLERR
Sbjct  565  YDEESLQSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR  624

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE  FL E+  V+++G+TPAE+LL+LY  KW ++VDPVF+ELLY
Sbjct  625  GYKEVSFLREVDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY  670



>ref|XP_010448773.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010448774.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWT EE EMLR +VP+TGLKT FRD  LKHVA++VLKLAK+GLERR
Sbjct  344  YDEDSLQTTLNMIDDWTPEELEMLRTQVPITGLKTMFRDKPLKHVAEEVLKLAKDGLERR  403

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFLN + EVV TG+TPAEKLL+LY+  WGQNVD VF EL Y
Sbjct  404  GYNETGFLNAVAEVVRTGVTPAEKLLELYNGDWGQNVDHVFRELRY  449



>gb|ACV71026.1| gamma-glutamylcysteine synthetase [Agropyron cristatum]
Length=215

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQ+++DMTADWT EEREMLR+KVPVTGLKTPFRDG ++ +A+DVL+LAK GLERR
Sbjct  122  YDDESLQSIIDMTADWTKEEREMLRRKVPVTGLKTPFRDGYVRDLAEDVLQLAKNGLERR  181

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKW  408
            G+KE GFL E+ EVV TG+TPAEKLL+LY  KW
Sbjct  182  GYKEVGFLREVDEVVRTGVTPAEKLLNLYEMKW  214



>ref|XP_010439235.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X3 [Camelina sativa]
Length=448

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWTLEE EMLR +VP+TGLKT FRD  LKHVA+DVLKLAK+GLERR
Sbjct  343  YDEDSLQTTLNMIDDWTLEELEMLRTQVPITGLKTMFRDKPLKHVAEDVLKLAKDGLERR  402

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETG+L+ + EVV TG+TPAEKLL+LY+ +WGQN+D VF  L Y
Sbjct  403  GYNETGYLDAVAEVVRTGVTPAEKLLELYNGEWGQNIDHVFRGLQY  448



>ref|XP_006283598.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
 gb|EOA16496.1| hypothetical protein CARUB_v10004654mg [Capsella rubella]
Length=495

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ VLDM ADW LEEREMLR +VPVTGL+T FR G L+HVA+DVLKLA +GLERR
Sbjct  390  YDENSLQTVLDMIADWNLEEREMLRTQVPVTGLQTMFRGGSLQHVAEDVLKLAVDGLERR  449

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ET FLN + EVV TG T A KLL+LY+  WGQN+D VF+EL Y
Sbjct  450  GYNETSFLNPVAEVVRTGTTQAHKLLELYNGDWGQNIDHVFKELRY  495



>ref|XP_001785532.1| predicted protein [Physcomitrella patens]
 gb|EDQ49666.1| predicted protein [Physcomitrella patens]
Length=484

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQ   D+  DWT +ER MLR KVP  GL  PFRDGLLKHVAQD+ KLAK+GL RR
Sbjct  379  YDDESLQGAFDIINDWTEKERAMLRNKVPKEGLNVPFRDGLLKHVAQDIFKLAKDGLTRR  438

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E GFL +I E+V TG TPAE+LLDLYH KW +NVD VFEELLY
Sbjct  439  GLNEAGFLKDIEEIVQTGKTPAERLLDLYHEKWNRNVDTVFEELLY  484



>ref|XP_010439229.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010439230.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=449

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWT EE EMLR +VP+TGL+T FRD  LKHVA+DVLKLAK+GLERR
Sbjct  344  YDEDSLQTTLNMIDDWTPEELEMLRTQVPITGLRTIFRDKPLKHVAEDVLKLAKDGLERR  403

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ET FLN + EVV TG+TPAEKLL+LY+  WGQNVD VF EL Y
Sbjct  404  GYNETDFLNAVAEVVRTGVTPAEKLLELYNGDWGQNVDHVFRELRY  449



>gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimocarpus longan]
Length=78

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -2

Query  602  PVTGLKTPFRDGLLKHVAQDVLKLAKEGLERRGFKETGFLNEITEVVNTGITPAEKLLDL  423
            P TGLKTPFRDGLL+HVAQD+LKLAK+GLERRGFKE+GFLN + EVV TG+TPAEKLL++
Sbjct  1    PKTGLKTPFRDGLLRHVAQDILKLAKDGLERRGFKESGFLNAVAEVVRTGVTPAEKLLEM  60

Query  422  YHRKWGQNVDPVFEELLY  369
            YH KWGQ+VDPVFEELLY
Sbjct  61   YHGKWGQSVDPVFEELLY  78



>gb|AES94043.2| gamma glutamyl cysteine synthetase [Medicago truncatula]
Length=139

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SL  VLDM ADWT E+R+ LR +VP TGLKT F+  LL+HVA+DVLK AK GLERR
Sbjct  34   YDEVSLHNVLDMIADWTTEDRQYLRNQVPFTGLKTLFQGRLLQHVAEDVLKWAKAGLERR  93

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
               E+ FL+ + EVV TG+TPA+KLL++Y++KWG N+DPVF E  Y
Sbjct  94   CLNESIFLDPLIEVVGTGMTPADKLLEMYNKKWGSNIDPVFRECCY  139



>ref|XP_010448775.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWTLEE EMLR +VP+TGLKT FRD  LKHVA+DVLKLAK+GL+RR
Sbjct  343  YDEDSLQTTLNMIDDWTLEELEMLRTQVPITGLKTMFRDKPLKHVAEDVLKLAKDGLKRR  402

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ET +L+ + EVV TG+TPAEKLL+LY+  WGQN+D VF EL Y
Sbjct  403  GYNETSYLDAVAEVVRTGVTPAEKLLELYNGDWGQNIDHVFRELQY  448



>ref|XP_010448777.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=448

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWT EE EMLR +VP+TGLKT FRD  LKHVA+D+LKLAK+GL+RR
Sbjct  343  YDEDSLQTTLNMIDDWTPEEIEMLRTQVPITGLKTMFRDMPLKHVAEDILKLAKDGLDRR  402

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFLN + EVV TG+TPAEKLL+LY+  WGQN+D VF  L Y
Sbjct  403  GYNETGFLNAVAEVVRTGVTPAEKLLELYNGDWGQNIDHVFRGLQY  448



>ref|XP_002965328.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
 gb|EFJ34166.1| hypothetical protein SELMODRAFT_83292 [Selaginella moellendorffii]
Length=464

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L++   M   WT  ER MLR KVP  GL TPFRDG LKHVAQDV KLA++GL+RR
Sbjct  359  YDEEALESASKMVEGWTEGERAMLRSKVPRLGLSTPFRDGQLKHVAQDVFKLARDGLQRR  418

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN+I E+V TG+TPAEKLL LY  KW ++VDPVF+ELLY
Sbjct  419  GYKEAGFLNDIAEIVRTGVTPAEKLLSLYEGKWNKSVDPVFQELLY  464



>ref|XP_010439234.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=448

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 86/106 (81%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWT EE EMLR++VP+TGLKT FRD  LKHVA+D+LKLAK+GL+RR
Sbjct  343  YDEDSLQTTLNMIDDWTPEEIEMLRRQVPITGLKTMFRDMPLKHVAEDILKLAKDGLDRR  402

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFLN +  VV TG+TPAEKLL+LY+ +WGQN+D VF  L Y
Sbjct  403  GYNETGFLNAVAAVVRTGVTPAEKLLELYNGEWGQNIDHVFRGLQY  448



>ref|XP_003611085.1| Glutamate-cysteine ligase [Medicago truncatula]
Length=207

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SL  VLDM ADWT E+R+ LR +VP TGLKT F+  LL+HVA+DVLK AK GLERR
Sbjct  102  YDEVSLHNVLDMIADWTTEDRQYLRNQVPFTGLKTLFQGRLLQHVAEDVLKWAKAGLERR  161

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
               E+ FL+ + EVV TG+TPA+KLL++Y++KWG N+DPVF E  Y
Sbjct  162  CLNESIFLDPLIEVVGTGMTPADKLLEMYNKKWGSNIDPVFRECCY  207



>ref|XP_002977172.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
 gb|EFJ21781.1| hypothetical protein SELMODRAFT_232900 [Selaginella moellendorffii]
Length=438

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L++   M   WT  ER MLR KVP  GL TPFRDG LKHVAQ+V KLA++GL+RR
Sbjct  333  YDEEALESASKMVEGWTEGERAMLRSKVPRLGLSTPFRDGQLKHVAQEVFKLARDGLQRR  392

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+KE GFLN+I E+V TG+TPAEKLL LY  KW ++VDPVF+ELLY
Sbjct  393  GYKEAGFLNDIAEIVRTGVTPAEKLLSLYEGKWNKSVDPVFQELLY  438



>ref|XP_010439231.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439232.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010439233.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=448

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ  L+M  DWT EE EMLR++VP+TGLKT FRD  LKHVA+D+LKLAK+GL+RR
Sbjct  343  YDEDSLQTTLNMIDDWTPEEIEMLRRQVPITGLKTMFRDMPLKHVAEDILKLAKDGLDRR  402

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ETGFLN +  VV TG+TPAEKLL+LY+  WG+N+D VF  L Y
Sbjct  403  GYNETGFLNAVAAVVRTGVTPAEKLLELYNGDWGKNIDHVFRGLQY  448



>gb|ADR66089.1| gamma-glutamylcysteine synthetase, partial [Hispidella hispanica]
Length=86

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EER MLR KVPV+GLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  9    YDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNTG  453
            G+KETGFLNE+TEVV TG
Sbjct  69   GYKETGFLNEVTEVVRTG  86



>gb|ADR66086.1| gamma-glutamylcysteine synthetase, partial [Andryala pinnatifida]
Length=81

 Score =   132 bits (333),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EER MLR KVPV+GLKTPFRDGLLKHVAQ V+  AK+GLERR
Sbjct  5    YDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQQVVSFAKDGLERR  64

Query  506  GFKETGFLNEITEVVNT  456
            G+KETGFLNE+TEVV T
Sbjct  65   GYKETGFLNEVTEVVRT  81



>gb|AEN79434.1| gamma-glutamylcysteine synthetase [Hispidella hispanica]
Length=85

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD++SLQ VLDMTADWT EER MLR KVPV+GLKTPFRDGLLKHVAQ+V+  AK+GLERR
Sbjct  9    YDDVSLQNVLDMTADWTAEERLMLRNKVPVSGLKTPFRDGLLKHVAQEVVSFAKDGLERR  68

Query  506  GFKETGFLNEITEVVNT  456
            G+KETGFLNE+TEVV T
Sbjct  69   GYKETGFLNEVTEVVRT  85



>ref|XP_004971557.1| PREDICTED: glutamate--cysteine ligase B, chloroplastic-like [Setaria 
italica]
Length=489

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SL+ + DM ADWT EER+MLR KVP+TGLKT FR G ++ +A++++KLAK+GL+RR
Sbjct  384  YDEESLRCITDMIADWTNEERDMLRIKVPITGLKTQFRGGYVRDLAENIVKLAKDGLQRR  443

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E GFLNE+ E+V TG+T AEKL +LY  KW  NVDPVF E +Y
Sbjct  444  GHMEVGFLNEVDEIVGTGVTQAEKLANLYMAKWQHNVDPVFREFIY  489



>ref|XP_003611086.1| Glutamate-cysteine ligase [Medicago truncatula]
 gb|AES94044.1| glutamate-cysteine ligase B [Medicago truncatula]
Length=512

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SL  VLDM ADWT E+++ LR +VP TGLKTPF+  LL+HVA+DVLK AK+GL+RR
Sbjct  407  YDEVSLHNVLDMIADWTDEDKQYLRNQVPFTGLKTPFQGRLLQHVAEDVLKWAKDGLDRR  466

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
               E+ FL+ + EVV TG+TPAEKLL++Y+ KWG N+D VF E  Y
Sbjct  467  CLNESIFLDPLIEVVGTGMTPAEKLLEMYNNKWGSNIDSVFRECCY  512



>ref|XP_004511574.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Cicer 
arietinum]
Length=511

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SL  VLDM  DW+ E+R+ LR +VP TGL+TPF+  LL+HVA+DVLK AK+GL+RR
Sbjct  406  YDEVSLHNVLDMIGDWSTEDRQYLRNQVPFTGLRTPFQGRLLQHVAEDVLKWAKDGLDRR  465

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
               E+ FL+ + EVV TG+TPA+KL+++Y+ KWG N+D VF E  Y
Sbjct  466  CLNESVFLDPLMEVVETGMTPADKLVEMYYSKWGNNIDHVFRECCY  511



>ref|XP_010540840.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=508

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ+VLDMTADWT EEREMLRKKVPVTGLKTPFRDG LKHV +DVLKLAK+GLERR
Sbjct  419  YDEESLQSVLDMTADWTPEEREMLRKKVPVTGLKTPFRDGRLKHVTEDVLKLAKDGLERR  478

Query  506  GFKETGFLNEITEVVNTG  453
            G+KETGFLN + EVV TG
Sbjct  479  GYKETGFLNAVAEVVQTG  496



>ref|XP_007158499.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
 gb|ESW30493.1| hypothetical protein PHAVU_002G157600g [Phaseolus vulgaris]
Length=493

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT E+ + LR  VP+TGL+T  +  LL+H+A+DVLK AKEGL+RR
Sbjct  388  YDEVSLQNVLDMIADWTTEDLQNLRNMVPITGLRTSIQGRLLRHIAEDVLKWAKEGLDRR  447

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E+ FL+ + EVV TG T A+KLL+LYH  WG+N+D VF E  Y
Sbjct  448  GLNESVFLDPLKEVVFTGFTQADKLLELYHSNWGKNIDHVFRECCY  493



>ref|XP_003516702.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006573776.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Glycine max]
 gb|KHN25701.1| Glutamate--cysteine ligase, chloroplastic [Glycine soja]
Length=506

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT E+ + LR KVP+TGL TP +  LL+H+A+D LK AK+GL+RR
Sbjct  401  YDEVSLQNVLDMIADWTPEDIQNLRNKVPITGLTTPVQGRLLQHIAEDTLKWAKDGLDRR  460

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
               E+ FL+ + EVV TG+T A+KLL++Y+ KWG N+DPVF E  Y
Sbjct  461  CLNESVFLDPLKEVVGTGLTQADKLLEMYNNKWGNNIDPVFRERCY  506



>emb|CAA82626.1| gamma-glutamylcysteine synthetase [Arabidopsis thaliana]
Length=533

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK+GLERR
Sbjct  417  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR  476

Query  506  GFKETGFLNEITEV-VNTGITPAEKLLDLYHR  414
            G+KE GFLN + EV  N      E L D+  R
Sbjct  477  GYKEAGFLNAVDEVGQNRSYACGEALGDVQWR  508



>ref|XP_010435329.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Camelina 
sativa]
Length=134

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  611  KKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERRGFKETGFLNEITEVVNTGITPAEKL  432
            K+VP+ GLKT FR G LKHVA+DVLKLA +GLERRG+ ETGFLN I EVV TG+TPA KL
Sbjct  54   KQVPIAGLKTMFRGGPLKHVAEDVLKLAMDGLERRGYNETGFLNPIAEVVRTGVTPAHKL  113

Query  431  LDLYHRKWGQNVDPVFEELLY  369
            L+LY+ +WGQN+D VFEEL Y
Sbjct  114  LELYNGEWGQNIDHVFEELRY  134



>ref|XP_002985600.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
 gb|EFJ13178.1| hypothetical protein SELMODRAFT_122883 [Selaginella moellendorffii]
Length=455

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L++   +  DW+  ER MLR++ P  GLKT FR+G LK VAQ+VLKLAKEGLERR
Sbjct  350  YDEEALESAYQLIKDWSRAERAMLRREAPKLGLKTRFRNGTLKDVAQEVLKLAKEGLERR  409

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ E  FL  + E+V TG+TPAE+LL+LY+ KW + VDP+F  L Y
Sbjct  410  GYNEVKFLEGVAEIVETGVTPAERLLELYNGKWDKCVDPMFHVLEY  455



>ref|XP_002974231.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
 gb|EFJ24453.1| hypothetical protein SELMODRAFT_101407 [Selaginella moellendorffii]
Length=455

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L++   +  DW+  ER MLR++ P  GLKT FR+G LK VAQ+VL+LAKEGLERR
Sbjct  350  YDEEALESAYQLIEDWSRAERAMLRREAPKLGLKTRFRNGTLKDVAQEVLELAKEGLERR  409

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ E  FL  + E+V TG+TPAE+LL+LY+ KW + VDP+F  L Y
Sbjct  410  GYNEVKFLEGVAEIVETGVTPAERLLELYNGKWNKCVDPMFHALEY  455



>ref|XP_004971558.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--cysteine ligase A, 
chloroplastic-like [Setaria italica]
Length=445

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SLQ + DM ADWT  ER +LR++VPV+GLKTPF+ G ++ +A+ V+KLAKEGL+RR
Sbjct  339  YDEESLQNITDMIADWTNNERNILRREVPVSGLKTPFQGGYVRDLAEYVVKLAKEGLQRR  398

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQ-NVDPVFEELLY  369
            G  E  FLNE+ EV   G+T AE+L +LY  KW   NVD VF EL Y
Sbjct  399  GHNEVDFLNEVDEVARIGMTLAERLTNLYKTKWQHINVDMVFYELAY  445



>ref|XP_008375304.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform 
X2 [Malus domestica]
Length=465

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE+SLQ VLDM ADWT EER+MLR KVP TGLKTPFR  LL+HVA++V+K AK+GLERR
Sbjct  383  YDEVSLQNVLDMIADWTXEERQMLRDKVPKTGLKTPFRGELLQHVAENVVKFAKDGLERR  442

Query  506  GFKETGFLNEITEVVNTGI  450
            G  E+GFL+ + EV  TG+
Sbjct  443  GLNESGFLDGVVEVARTGV  461



>ref|XP_001778732.1| predicted protein [Physcomitrella patens]
 gb|EDQ56430.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SL+  LD+  DW+ ++R  LRK+VP  G+ TPFR+G L+ VA+DVLKLAK+GL RR
Sbjct  397  YDEQSLKNCLDIIRDWSNDDRGFLRKEVPNQGILTPFREGTLQDVAKDVLKLAKDGLARR  456

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEEL  375
            G +E  FL  + EV  TG+T AE++L LY  +W   VDP+F EL
Sbjct  457  GLQEGKFLAPLEEVATTGVTLAERMLKLYEEEWDGRVDPIFNEL  500



>ref|WP_006913439.1| glutamate--cysteine ligase [Salinisphaera shabanensis]
 gb|ERJ18647.1| Glutamate-cysteine ligase protein [Salinisphaera shabanensis 
E1L3A]
Length=454

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD  +L A   +  D+T +ER MLR++ PV GLKTPFRDG L+ +A+ V+ +A+ GLERR
Sbjct  343  YDSEALDAAWQLCRDFTADERNMLRREAPVQGLKTPFRDGTLQDIAKQVVAIARGGLERR  402

Query  506  G------FKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                     E  +L+++ E+  TG+TPAE LLDLY  +W ++VDPVF E  Y
Sbjct  403  ARLDSQDRDERMYLDQLAEIAETGVTPAETLLDLYTGRWNESVDPVFTEFAY  454



>ref|WP_005000090.1| glutamate--cysteine ligase [Nitrococcus mobilis]
 gb|EAR22135.1| glutamate-cysteine ligase precursor [Nitrococcus mobilis Nb-231]
Length=455

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE++L A   + ADWT  ERE LR  VP  GL+TPFR  LL+ VA++ L +A++GL RR
Sbjct  344  YDELALDAASHLVADWTQAEREELRSAVPRWGLRTPFRGHLLQEVARETLGIAEQGLRRR  403

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  ET FL E+ E+  +GITPAE+LL+ + ++W  +V+PVFEE  Y
Sbjct  404  ARLNEAGGDETRFLVELQEIAESGITPAERLLESWEQRWHHSVEPVFEEHAY  455



>ref|WP_022698585.1| glutamate--cysteine ligase [Maricaulis sp. JL2009]
Length=454

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD  SL A  D+  DWT EERE +R +     LKTPFR   L+ +A+  L ++++GL RR
Sbjct  343  YDSASLDAAWDLVKDWTAEERETMRMEAARIALKTPFRGRTLQDIAKQALDISRQGLSRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+EI E+ ++G+TPAE LLD Y+ +WG++VDPVF+ L Y
Sbjct  403  ERLNAHGENESLFLDEIQEIADSGVTPAEALLDSYYNEWGEDVDPVFKTLAY  454



>ref|WP_037338607.1| glutamate--cysteine ligase [Salinisphaera hydrothermalis]
 gb|KEZ76969.1| gamma-glutamylcysteine synthetase [Salinisphaera hydrothermalis 
C41B8]
Length=454

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD ++L    ++ +D+T EER  LR + P+ GLKTPFR G L  +A++ +++A+ GL RR
Sbjct  343  YDSVALDEAWNLVSDFTREERNHLRDQAPMYGLKTPFRGGTLGDIARETIRIAQGGLRRR  402

Query  506  G------FKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                     E+ FL+++ E+  TG+TPAE+LL LYH +W ++VDPVFEE  Y
Sbjct  403  AQLDSTDRDESMFLDQLAEIAETGVTPAEQLLTLYHGRWNESVDPVFEEFAY  454



>ref|WP_028467521.1| glutamate--cysteine ligase [Nisaea denitrificans]
Length=455

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD  S QA  DM ADWT+EE   LR  VP  GL+TPFRDG ++ +A+ ++++++ GL+RR
Sbjct  344  YDSDSQQAAADMIADWTVEEMSALRDAVPKLGLQTPFRDGTVQDLAKRMIEISRHGLKRR  403

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFE  381
                  G  E+GFLN + +V  +G T A+ LLDLYH +W  +VDP+FE
Sbjct  404  ARIDAAGNDESGFLNWLQDVAESGKTSADHLLDLYHGEWNGSVDPIFE  451



>dbj|GAK45010.1| glutamate--cysteine ligase [alpha proteobacterium MA2]
Length=456

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD   L A  DM  DW+ EER+ LR +VP  GLKTPFR G ++ +A+ +L LA+EGL+RR
Sbjct  345  YDGGVLDAAWDMVKDWSAEERQRLRDEVPKLGLKTPFRGGTVQDLARQMLDLAQEGLKRR  404

Query  506  GFKE-TG-----FLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  + TG     FL+ I E+V  G TPAE+LLDLYH +W   V P+++E  +
Sbjct  405  GAGDGTGADERIFLSSIEEIVEKGKTPAEELLDLYHGRWNGTVAPIYDEFAF  456



>ref|WP_009803181.1| glutamate--cysteine ligase [Oceanicaulis sp. HTCC2633]
 gb|EAP90814.1| glutamate-cysteine ligase precursor [Oceanicaulis alexandrii 
HTCC2633]
Length=457

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  DWT EER+ +R     T LKTPFR+  L+ +AQ  L +++ GL+ R
Sbjct  346  YDQTALDAAWDLVKDWTAEERDAMRAGAAKTALKTPFRNTTLQEIAQQALAISRSGLKAR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E  FL+++ E+  TGI+PAE+LL+ YH  W ++V+P+FEE  Y
Sbjct  406  QRLNAHGENEALFLDDLDEIAKTGISPAERLLERYHGAWNESVEPIFEEAAY  457



>gb|AFC88288.1| gamma-glutamylcysteine synthetase [Chlamydomonas sp. ICE-L]
Length=483

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ + Q  L + +DWT EERE LR +VP TG++TPFR G  + + Q  + +++ GL+RR
Sbjct  378  YDDQAQQEALALISDWTAEEREFLRVEVPRTGMQTPFRGGKFQDICQQTVAISRGGLQRR  437

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E  FL  I E+  +G + AEK + LY  +W Q+VDP+++E  Y
Sbjct  438  GRDEVHFLKRIEEIAESGESLAEKFIGLYETEWNQSVDPLYKEFPY  483



>ref|WP_042640977.1| glutamate--cysteine ligase [Mesorhizobium sp. ORS3359]
 emb|CDX33414.1| Glutamate--cysteine ligase B, chloroplastic [Mesorhizobium sp. 
ORS3359]
Length=457

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +TA WT EE   +R  VP  G+  PFR+  L+ VA+DVL +++ GL+ R
Sbjct  346  YDEQALDAAEALTASWTYEEALAMRNAVPELGIAAPFRNATLRDVARDVLAISRMGLKNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV+ G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  AKKNRDGYDETSFLNTLDEVVSRGTTSAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_040973710.1| glutamate--cysteine ligase [Mesorhizobium sp. ORS3324]
 emb|CDX23560.1| Glutamate--cysteine ligase B, chloroplastic [Mesorhizobium sp. 
ORS3324]
Length=457

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +T+ WT EE   +R  VP  G+  PFR+  L+ VA+DVL +A+ GL+ R
Sbjct  346  YDEQALDAAETLTSSWTYEEALAMRNAVPEQGIAAPFRNATLRDVARDVLAIARMGLKNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV  G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  GKKNRDGYDETSFLNTLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_042597021.1| glutamate--cysteine ligase [Xanthomonas campestris]
 gb|KIQ26288.1| glutamate--cysteine ligase [Xanthomonas campestris]
Length=454

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   L  PFR+G+++ +A + + +A+EGL RR
Sbjct  343  YDQTALDAAWDLVKDFTLAERHALRDGVPKQALGLPFRNGMVRDLALEAVNIAREGLRRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  ETGFL+ I E+  TG+T AE+ L LYH  W  ++DPVF E  Y
Sbjct  403  ARLNRDGQDETGFLDVIAEIAETGVTAAERKLALYHGAWKGDIDPVFREFAY  454



>ref|WP_040990658.1| glutamate--cysteine ligase [Mesorhizobium plurifarium]
 emb|CDX45535.1| Glutamate--cysteine ligase B, chloroplastic [Mesorhizobium plurifarium]
Length=457

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +TA WT EE   +R  VP  G+  PFR+  L+ VA+DVL +++ GL  R
Sbjct  346  YDEQALDAAEALTASWTYEEALAMRNAVPELGIAAPFRNATLRDVARDVLAISRTGLRNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV  G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  AKKNRDGYDETSFLNTLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_041004352.1| glutamate--cysteine ligase [Mesorhizobium plurifarium]
 emb|CDX54393.1| Glutamate--cysteine ligase B, chloroplastic [Mesorhizobium plurifarium]
Length=457

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +TA WT EE   +R  VP  G+  PFR+  L+ VA+DVL +++ GL  R
Sbjct  346  YDEQALDAAEALTASWTYEEALAMRNAVPELGIAAPFRNATLRDVARDVLAISRTGLRNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV  G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  AKKNRDGYDETSFLNTLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_041010010.1| glutamate--cysteine ligase [Mesorhizobium plurifarium]
 emb|CDX19608.1| Glutamate--cysteine ligase B, chloroplastic [Mesorhizobium plurifarium]
Length=457

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +TA WT EE   +R  VP  G+  PFR+  L+ VA+DVL +++ GL+ R
Sbjct  346  YDEQALDAAEALTASWTYEEALAMRNAVPELGIAAPFRNATLRDVARDVLAISRMGLKNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV  G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  AKKNRDGYDETSFLNTLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_011038494.1| glutamate--cysteine ligase [Xanthomonas campestris]
 ref|NP_638742.1| glutamate--cysteine ligase [Xanthomonas campestris pv. campestris 
str. ATCC 33913]
 gb|AAM42666.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv. 
campestris str. ATCC 33913]
 gb|AAY47846.1| glutamate-cysteine ligase precursor [Xanthomonas campestris pv. 
campestris str. 8004]
Length=454

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   L  PFR+G+++ +A + + +A+EGL RR
Sbjct  343  YDQTALDAAWDLVKDFTLAERHALRDGVPKQALGLPFRNGVVRDLALEAVNIAREGLRRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  ETGFL+ I E+  TG+T AE+ L LYH  W  ++DPVF E  Y
Sbjct  403  ARLNRDGQDETGFLDVIAEIAETGVTAAERKLALYHGAWKGDIDPVFREFAY  454



>gb|AEL08593.1| glutamate--cysteine ligase [Xanthomonas campestris pv. raphani 
756C]
Length=456

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   L  PFR+G+++ +A + + +A+EGL RR
Sbjct  345  YDQTALDAAWDLVKDFTLAERHALRDGVPKQALGLPFRNGVVRDLALEAVNIAREGLRRR  404

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  ETGFL+ I E+  TG+T AE+ L LYH  W  ++DPVF E  Y
Sbjct  405  ARLNRDGQDETGFLDVIAEIAETGVTAAERKLALYHGAWKGDIDPVFREFAY  456



>ref|WP_018147083.1| glutamate--cysteine ligase [Henriciella marina]
Length=459

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 76/113 (67%), Gaps = 7/113 (6%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDG-LLKHVAQDVLKLAKEGLER  510
            YD+ +L A  ++  DWT  ERE +R+ V V GL+TP   G  ++ +A+D+L +++ GL+ 
Sbjct  347  YDQAALDAAWELVKDWTAAERESVRQSVRVLGLRTPIPGGRTMQDLAKDILMISRNGLKS  406

Query  509  R------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            R      G  ETGF++E+ E+  +G+TPA++LL+LYH +WG+ V+P FE L Y
Sbjct  407  RARLGSAGDDETGFISELDEIAESGLTPADRLLELYHGEWGRRVEPAFETLAY  459



>emb|CAP50142.1| glutamate-cysteine ligase [Xanthomonas campestris pv. campestris]
Length=545

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   L  PFR+G+++ +A + + +A+EGL RR
Sbjct  434  YDQTALDAAWDLVKDFTLAERHALRDGVPKQALGLPFRNGVVRDLALEAVNIAREGLRRR  493

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  ETGFL+ I E+  TG+T AE+ L LYH  W  ++DPVF E  Y
Sbjct  494  ARLNRDGQDETGFLDVIAEIAETGVTAAERKLALYHGAWKGDIDPVFREFAY  545



>ref|WP_014247076.1| glutamate--cysteine ligase [Azospirillum lipoferum]
 emb|CBS86032.1| gamma-glutamylcysteine synthetase [Azospirillum lipoferum 4B]
Length=454

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+++L A  D+  DWT EER  LR +VP +GL+T FR+G ++ VA +V+ +A++GL RR
Sbjct  343  YDQVALDAAWDLVKDWTTEERAHLRAEVPRSGLRTTFRNGTVRDVALEVVAIARDGLARR  402

Query  506  GFK------ETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G        ET FL+ +  +  +G +PA++LL+ ++  WG +VDPVF+E  Y
Sbjct  403  GRNDNWGDDETHFLDTLQMIAESGRSPADELLEKFNGPWGGSVDPVFKEYAY  454



>ref|WP_036515476.1| glutamate--cysteine ligase [Oceanicaulis sp. HL-87]
Length=457

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A LD+  DWT EER  LR      GLKTPFR+  ++ +A++VL +A+ GL+ R
Sbjct  346  YDDKALAAALDLVKDWTAEERVALRLGAAHCGLKTPFRNTTMQDLAKEVLAIARSGLKAR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E  FL+++ E+ ++G+TPAE+LL+LY+  WG +V+P+F++  Y
Sbjct  406  ARLNHHGEHEAVFLDDLDEIASSGVTPAERLLELYNGPWGGSVEPIFKQAAY  457



>ref|XP_002507857.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69115.1| predicted protein [Micromonas sp. RCC299]
Length=489

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L     + ADWT EERE LR  V   GL+T FRDG ++ +A ++++++KEGL RR
Sbjct  384  YDETALANAEALVADWTPEEREYLRVAVTKDGLQTKFRDGTVQDIAVEMVRISKEGLTRR  443

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E  F++ + E+  +G T A+KLLD Y  KWG ++D V+ EL Y
Sbjct  444  GCNEENFVDGLMEMATSGQTQADKLLDAYVNKWGMDIDRVYNELSY  489



>ref|WP_023432400.1| Glutamate--cysteine ligase [Lutibaculum baratangense]
 gb|ESR24947.1| Glutamate--cysteine ligase [Lutibaculum baratangense AMV1]
Length=455

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SL+A  D+ ADWT+EE + LR +VP T L TPFR G L  +A++V+ LA+ GLERR
Sbjct  344  YDEQSLRAAADLVADWTVEEMQDLRDQVPRTALDTPFRGGTLADIAREVVALARAGLERR  403

Query  506  G------FKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                     E  FL+++ E+  +G T A+ LL+LY   W  +VD +F+E  Y
Sbjct  404  ARASGLETSEACFLDDVEEIATSGRTRAQTLLELYRTTWNGDVDRIFDEYAY  455



>ref|XP_003062187.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53899.1| predicted protein [Micromonas pusilla CCMP1545]
Length=488

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L     + ADWT EE+E LR  V    L+TPFRDG ++ VA +++K+AKEGL RR
Sbjct  383  YDETALSDAEKLVADWTPEEKEYLRHAVTKDALQTPFRDGTVQDVAIEMVKIAKEGLRRR  442

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G  E  F++ + E+  TG T ++ LL+ Y  +WG+++D VF++L Y
Sbjct  443  GANEENFVDGLMEIATTGKTSSDLLLEAYENEWGEDIDKVFKKLSY  488



>ref|WP_017463721.1| glutamate--cysteine ligase [Dyella ginsengisoli]
Length=455

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D++L ER  LR  VP   LK PFR+G ++ +A++ LK+A  GL+RR
Sbjct  344  YDDEALSAAWDLVKDFSLAERHALRDGVPRNALKLPFRNGTVRDLARETLKIAAHGLKRR  403

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E  FL  + E+V +G TPAE+ L+L+H  WG +VDPVF E  Y
Sbjct  404  ARLNAGGADERTFLEPLLEIVESGQTPAERKLELFHGAWGGSVDPVFREFAY  455



>ref|WP_027164308.1| glutamate--cysteine ligase [Mesorhizobium sp. WSM3224]
Length=457

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +TA WT  E   +R  VP  G+  PFR+  L+ VA+DVL +++ GL+ R
Sbjct  346  YDEQALDAAEALTASWTYAEALAMRNAVPEQGIAAPFRNATLRDVARDVLAISRMGLKNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV  G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  CKKNRDGYDETSFLNTLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_019959805.1| glutamate--cysteine ligase [Woodsholea maritima]
Length=458

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  DWT +ER+ LR     T LKTP R   L+ VA+ VL ++++GL+ R
Sbjct  347  YDQAALDAAWDLVKDWTQDERDSLRIAAAKTALKTPLRHTTLQEVAKQVLAISRQGLKAR  406

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E  FL+++ E+ ++G+TPAE+LL+ YH +WG  +DP+FE   Y
Sbjct  407  AKLNGHGENEAHFLDDLDEIASSGVTPAERLLERYHTEWGGQIDPIFEASAY  458



>ref|WP_018426605.1| glutamate--cysteine ligase [Hoeflea sp. 108]
Length=457

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGL---  516
            YD  +L A   +T DWT EE   +R  VP  G+  PFR+  L+ V ++VL L+++GL   
Sbjct  346  YDPATLDAAEALTRDWTYEEVLAMRNAVPEQGISAPFRNTTLREVGREVLALSRQGLVNR  405

Query  515  ---ERRGFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                R GF E+GFLN + EVV  G T AE++L+ YH +WG +++PVF E  Y
Sbjct  406  GNKNRDGFDESGFLNTLDEVVARGTTSAEEMLNAYHTRWGGSIEPVFLEYAY  457



>ref|XP_001701647.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
 gb|EDP06622.1| gamma-glutamylcysteine synthetase [Chlamydomonas reinhardtii]
Length=479

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 70/106 (66%), Gaps = 0/106 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD  + +  L +  DWT  ER+ LR +V   GL+TPFR G ++ VA+ V+ +A  GLERR
Sbjct  374  YDPEAQRQALALIEDWTPAERDYLRTEVTRFGLRTPFRAGTVQDVAKQVVSIAHGGLERR  433

Query  506  GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G+ ET FL  +  +  TG+T A+ LL+LY  KW ++VDP+++E +Y
Sbjct  434  GYDETSFLKRLEVIAETGLTQADHLLELYETKWQRSVDPLYKEFMY  479



>ref|WP_012973384.1| glutamate--cysteine ligase [Azospirillum lipoferum]
 dbj|BAI71398.1| glutamate--cysteine ligase [Azospirillum sp. B510]
Length=454

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+++L A  D+   WT+ ER  LR +VP +GL+T FRDG ++ VA ++L +A++GL RR
Sbjct  343  YDQVALDAAWDLVKGWTMAERAHLRAEVPRSGLRTTFRDGTVRDVALEMLAIARDGLARR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  ET FL+ +  V  TG +PA++LL+ ++  WG +VDPVF+E  Y
Sbjct  403  ARNDNWGDDETHFLDTLQLVAETGRSPADELLEKFNGPWGGSVDPVFKEYAY  454



>ref|WP_022701642.1| glutamate--cysteine ligase [Oceanicaulis alexandrii]
Length=457

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  DWT +ER+ +R     T LKTPFR+  L+ +A+  L +++ GL+ R
Sbjct  346  YDQSALDAAWDLVKDWTADERDAMRLGAAKTALKTPFRNTTLQEIAKQALAISRAGLKAR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E  FL+++ E+  TG++PAE+LL+ YH  WG++V+P+F+E  Y
Sbjct  406  QRLNAHGENEALFLDDLDEIAKTGVSPAERLLERYHTAWGESVEPIFDEAAY  457



>ref|WP_020591012.1| hypothetical protein [Kiloniella laminariae]
Length=454

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  DW+ +ER++LR +VP  GL    R   L+ +A++++++A+ GLE R
Sbjct  343  YDQSALDAAWDLVKDWSDDERQLLRSEVPAKGLSATIRGTKLQEIAREIVEIARGGLENR  402

Query  506  GF------KETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            G        ET FLN ++E+  +GITPAE+ L+ Y+ +WG+ VDP F E  Y
Sbjct  403  GRIDGQGQDETHFLNTLSEIAESGITPAEEKLEAYYSRWGEKVDPAFVEYAY  454



>ref|WP_015316493.1| glutamate--cysteine ligase [Mesorhizobium australicum]
 gb|AGB45054.1| glutamate--cysteine ligase, plant type [Mesorhizobium australicum 
WSM2073]
Length=457

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 70/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE++L A   +T+ WT +E   +R  VP  G+  PFR+  L+ VA+DV+ +++ GL+ R
Sbjct  346  YDEVALDAAEALTSSWTYKEVLAMRNAVPELGIAAPFRNTTLREVARDVMAISRTGLKNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV  G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  GKKNRDGYDETSFLNTLDEVVARGTTTAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_029011247.1| glutamate--cysteine ligase [Azospirillum halopraeferens]
Length=454

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD  +L A  D+  DWT EER  LR  VP  GL+TPFRD  L+ V+ +VL++A+ GL RR
Sbjct  343  YDTAALDAAWDLVKDWTGEERARLRADVPRHGLRTPFRDRTLREVSLEVLEIARGGLVRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E  FL+ +  +  +G TPA++LL  YH  WG +VDPVF E  Y
Sbjct  403  RRNDNWGDDEAHFLDTLQGIAESGQTPADELLARYHGVWGGSVDPVFREYAY  454



>ref|WP_012116172.1| glutamate--cysteine ligase [Xanthobacter autotrophicus]
 gb|ABS69425.1| glutamate--cysteine ligase [Xanthobacter autotrophicus Py2]
Length=456

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SL A  D+  DWT E+R+ LR  VP  GLK       L+ +A+DVLKL++ GL+RR
Sbjct  345  YDQQSLDAAWDLAKDWTAEQRQQLRDDVPRLGLKAEIAGRQLRDIARDVLKLSEAGLKRR  404

Query  506  GFK------ETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GF       ET FL  + E+V TG +PA+KLL LY+ +W  +V+P F+ L Y
Sbjct  405  GFHDRLGRDETRFLEPLEEIVLTGRSPADKLLALYNGEWDHSVEPAFQALAY  456



>ref|WP_008838626.1| glutamate--cysteine ligase [Mesorhizobium alhagi]
 gb|EHK54445.1| glutamate--cysteine ligase [Mesorhizobium alhagi CCNWXJ12-2]
Length=457

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +TADWT EE   +R  VP  G+ T FRD  L+ +A++ LK+++ GL  R
Sbjct  346  YDEEALDAAEQLTADWTFEEVRDMRAAVPKHGIGTEFRDTDLRSIAREALKISRLGLTNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ETGFL+ + EVV  G T AE++L+ YH +WG +++PVF E  Y
Sbjct  406  DRKNRDGYDETGFLSTLDEVVARGTTSAEEMLNAYHTRWGGSIEPVFLEYAY  457



>ref|WP_029558402.1| glutamate--cysteine ligase [Xanthobacter sp. 91]
Length=456

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ SL A  D+  DWT EER+ LR  VP   LK   R   L+ VA+DVLKL++ GL+RR
Sbjct  345  YDQQSLDAAWDLVKDWTAEERQTLRDDVPRLALKAEIRGRALRDVAKDVLKLSQAGLKRR  404

Query  506  GFK------ETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
            GF       ET FL  + + + +G  PAE+LL+LYH  W  +V+P F+ L Y
Sbjct  405  GFHDRLGRDETRFLEPLEQTLLSGRVPAEELLELYHGPWNGSVEPAFDALAY  456



>ref|WP_041003537.1| glutamate--cysteine ligase [Mesorhizobium sp. SOD10]
 emb|CDX43601.1| Glutamate--cysteine ligase B, chloroplastic [Mesorhizobium sp. 
SOD10]
Length=457

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A   +T+ WT  E   +R  VP  G+  PFR+  L+ VA+DVL +++ GL+ R
Sbjct  346  YDEQALDAAEALTSSWTYAEALAMRNAVPELGIAAPFRNATLRDVARDVLAISRMGLKNR  405

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G+ ET FLN + EVV  G T AE++L  YH +WG +++PVF E  Y
Sbjct  406  AKKNRDGYDETSFLNTLDEVVARGTTSAEEMLSAYHTRWGGSIEPVFMEYAY  457



>ref|WP_027840761.1| glutamate--cysteine ligase [Mastigocoleus testarum]
Length=465

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ + +A  D+  DWT EERE L + VP   L TPFR+G L  +A+D L +A++GL+ R
Sbjct  354  YDDAAQKAAWDLVKDWTAEEREALHQAVPAQALNTPFRNGTLLDIARDALAIAQDGLKAR  413

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E GFL  I   +  G TPAE+LLD Y+ KW  N+D +FE+  Y
Sbjct  414  ARTDSIGADERGFLAAIEATLAEGRTPAEELLDNYNGKWAGNLDRLFEDYSY  465



>ref|WP_037014257.1| glutamate--cysteine ligase [Rhizobiales bacterium YIM 77505]
Length=456

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE SL A  D+  +WT EERE LR  VP  GLK       ++ +A+D L  ++ GL RR
Sbjct  345  YDEASLDAAWDLVKEWTAEEREQLRADVPRLGLKAEIAGRTVRDIARDALAFSRSGLSRR  404

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+LL+ +H  WG +V P FEE ++
Sbjct  405  ALLNGGGRDESHFLDPLDEIVASGLTPAERLLERFHGPWGGSVGPAFEECVF  456



>ref|WP_034834449.1| glutamate--cysteine ligase [Inquilinus limosus]
 gb|KGM34668.1| glutamate--cysteine ligase [Inquilinus limosus MP06]
Length=454

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  DWT EER  LR+ VP  GL TPFR G ++ VA  VL +A++GL  R
Sbjct  343  YDDTALDAAWDLVKDWTTEERAALRRDVPRLGLATPFRGGTVRDVALRVLAIARQGLAAR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E GFLN++  + ++G T A ++L  Y  +WG +VDPVF    Y
Sbjct  403  ARTDAIGGTEEGFLNDLQRIADSGETQASEMLRRYETEWGGSVDPVFTAYAY  454



>ref|WP_005411018.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|EJP79118.1| glutamate-cysteine ligase [Stenotrophomonas maltophilia Ab55555]
Length=454

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMSLPFRNGTVRDLAREAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>ref|WP_024956060.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|AIL06484.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
Length=454

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMSLPFRNGTVRDLAREAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>ref|WP_019336459.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
Length=454

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKYAMNLPFRNGTVRDLAREAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>ref|WP_043948471.1| glutamate--cysteine ligase [Candidatus Phaeomarinobacter ectocarpi]
 emb|CDO60419.1| Glutamate--cysteine ligase [Candidatus Phaeomarinobacter ectocarpi]
Length=465

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ S +A  D+  DWT EERE L + VPV  L T FRD  +  +A+D L +AK+GL+ R
Sbjct  354  YDKASQEAAFDLVKDWTEEEREQLHRDVPVHALNTRFRDHTVLDIARDALAIAKQGLKAR  413

Query  506  ----GF--KETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                GF   E GFL  +   V++G TPAE++LDLY+ KW  N+D +F E  Y
Sbjct  414  ARSDGFDGDERGFLAAVETTVDSGRTPAEEMLDLYNGKWQGNLDNLFAEYSY  465



>ref|WP_010480897.1| glutamate--cysteine ligase [[Pseudomonas] geniculata]
Length=454

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHDDVDPVFREFAY  454



>ref|NP_001031701.1| glutamate-cysteine ligase [Arabidopsis thaliana]
 gb|AEE84707.1| glutamate-cysteine ligase [Arabidopsis thaliana]
Length=477

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAK  525
            YD+ SLQA+LD+TADWT  EREMLR KVPVTGLKTPFRDGLLKHVA+DVLKLAK
Sbjct  417  YDDDSLQAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAK  470



>ref|WP_014129677.1| glutamate--cysteine ligase [Pelagibacterium halotolerans]
 gb|AEQ50528.1| glutamate--cysteine ligase [Pelagibacterium halotolerans B2]
Length=459

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 6/109 (6%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A  D+  DWT EER+ LR  VP   LKTPFR+G L  +A+  L +A+ GL+ R
Sbjct  343  YDETALDAAWDLVKDWTEEERQALRNDVPRLALKTPFRNGTLFDIAKQALAIARSGLKAR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEE  378
                  G  ET FL  +   + TG TPAE+LLDLYH +W  +++ VF +
Sbjct  403  NKLNWEGADETVFLKPLDYTIETGKTPAERLLDLYHGEWSGDLNRVFSD  451



>ref|WP_032972191.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
Length=454

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>ref|WP_014648396.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 emb|CCH14101.1| Glutamate--cysteine ligase [Stenotrophomonas maltophilia D457]
 gb|KDE89209.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia M30]
Length=454

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGTVRDLAREAVKISVEGLRRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>ref|WP_014038468.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|AEM52750.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia JV3]
Length=454

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>ref|WP_012512090.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|ACF53097.1| glutamate/cysteine ligase [Stenotrophomonas maltophilia R551-3]
Length=454

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>dbj|GAN00159.1| glutamate--cysteine ligase [alpha proteobacterium U9-1i]
Length=454

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            Y + +L+A   +   WT E+RE LR+ VPV GLK P R    + +AQ  L +A++GL+ R
Sbjct  343  YCDAALEAAWSLVKSWTAEDREALRRAVPVLGLKAPIRGVTAQDIAQASLAIARQGLKSR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  ET FL E+ ++  +G+TPAE+LL+ YH +W ++V PVFE   Y
Sbjct  403  AQLDSGGQDETHFLAELDDIAASGVTPAERLLERYHTEWKRDVRPVFEACAY  454



>emb|CCP17893.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia RA8]
Length=473

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A++ +K++ EGL+RR
Sbjct  362  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGSVRDLAREAVKISVEGLKRR  421

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  422  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  473



>ref|WP_022727621.1| glutamate--cysteine ligase [Fodinicurvata sediminis]
Length=455

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YDE +L A  D+  DWTLE+ E LR +VP   L TPFR G +  +A   L++A EGL+ R
Sbjct  344  YDETALSAAEDLVRDWTLEDHEYLRAEVPRQALATPFRQGTVGDLATRALEIASEGLQAR  403

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E  FL+ + E+V TG TPA++LL LYH +W  +V  +FEE  Y
Sbjct  404  SRQNDEGMDERIFLDVLREIVITGQTPADELLSLYHGRWQGDVSHIFEEFQY  455



>ref|WP_021203943.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
 gb|EQM78188.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia MF89]
Length=454

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A + +K++ EGL+RR
Sbjct  343  YDDTALNAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGTVRDLAGEAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



>ref|WP_019662096.1| glutamate--cysteine ligase [Stenotrophomonas maltophilia]
Length=454

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = -2

Query  686  YDEISLQAVLDMTADWTLEEREMLRKKVPVTGLKTPFRDGLLKHVAQDVLKLAKEGLERR  507
            YD+ +L A  D+  D+TL ER  LR  VP   +  PFR+G ++ +A + +K++ EGL+RR
Sbjct  343  YDDTALDAAWDLVRDFTLAERHALRDGVPKHAMNLPFRNGTVRDLAGEAVKISVEGLKRR  402

Query  506  ------GFKETGFLNEITEVVNTGITPAEKLLDLYHRKWGQNVDPVFEELLY  369
                  G  E+ FL+ + E+V +G+TPAE+ L L+H +W  +VDPVF E  Y
Sbjct  403  AARNADGQDESKFLDVLQEIVESGLTPAERKLALFHGRWHGDVDPVFREFAY  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700