BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029B13

Length=692
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783307.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    196   3e-59   Nicotiana sylvestris
ref|XP_009591907.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    194   2e-58   Nicotiana tomentosiformis
ref|XP_004229612.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    192   2e-57   
ref|XP_006345468.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    183   4e-54   Solanum tuberosum [potatoes]
ref|XP_008461273.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    175   4e-51   Cucumis melo [Oriental melon]
ref|XP_004135919.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    172   6e-50   Cucumis sativus [cucumbers]
ref|XP_003546877.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    169   4e-49   Glycine max [soybeans]
ref|XP_011087429.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    167   6e-48   Sesamum indicum [beniseed]
ref|XP_009773992.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    166   8e-48   Nicotiana sylvestris
emb|CDP07749.1|  unnamed protein product                                166   2e-47   Coffea canephora [robusta coffee]
ref|XP_009365004.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    165   4e-47   
ref|XP_008231311.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    164   4e-47   Prunus mume [ume]
ref|XP_010106958.1|  Zinc finger A20 and AN1 domain-containing st...    165   5e-47   Morus notabilis
ref|XP_009365003.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    164   5e-47   Pyrus x bretschneideri [bai li]
ref|XP_009365002.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    164   5e-47   Pyrus x bretschneideri [bai li]
gb|KHN29214.1|  Zinc finger A20 and AN1 domain-containing stress-...    162   1e-46   Glycine soja [wild soybean]
ref|NP_001240258.1|  zinc finger A20 and AN1 domain-containing st...    163   2e-46   Glycine max [soybeans]
ref|XP_007218519.1|  hypothetical protein PRUPE_ppa012532mg             163   2e-46   Prunus persica
ref|XP_011093526.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    163   2e-46   Sesamum indicum [beniseed]
gb|KDP43451.1|  hypothetical protein JCGZ_16738                         163   3e-46   Jatropha curcas
ref|XP_011025412.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    162   5e-46   Populus euphratica
ref|XP_007052561.1|  Zinc finger A20 and AN1 domain-containing st...    162   5e-46   Theobroma cacao [chocolate]
ref|XP_009354712.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    161   6e-46   Pyrus x bretschneideri [bai li]
ref|XP_008375146.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    161   8e-46   Malus domestica [apple tree]
ref|XP_009631181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    161   8e-46   Nicotiana tomentosiformis
ref|XP_004306522.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    161   9e-46   Fragaria vesca subsp. vesca
ref|XP_003633555.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    161   9e-46   Vitis vinifera
ref|XP_006482901.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    161   1e-45   Citrus sinensis [apfelsine]
ref|XP_006438985.1|  hypothetical protein CICLE_v10032882mg             161   1e-45   Citrus clementina [clementine]
ref|XP_008461789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    160   3e-45   Cucumis melo [Oriental melon]
ref|XP_002314027.1|  zinc finger family protein                         160   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002298442.1|  zinc finger family protein                         158   2e-44   Populus trichocarpa [western balsam poplar]
gb|KJB25036.1|  hypothetical protein B456_004G173900                    158   2e-44   Gossypium raimondii
ref|XP_007149048.1|  hypothetical protein PHAVU_005G036400g             160   5e-44   Phaseolus vulgaris [French bean]
ref|XP_010547246.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    157   7e-44   Tarenaya hassleriana [spider flower]
ref|XP_008349960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    156   9e-44   
ref|XP_004149600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    156   1e-43   Cucumis sativus [cucumbers]
gb|KJB22229.1|  hypothetical protein B456_004G036200                    156   1e-43   Gossypium raimondii
ref|XP_010557789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    156   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_010279007.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    155   1e-43   Nelumbo nucifera [Indian lotus]
gb|AIJ00004.1|  zinc finger A20 and AN1 domain-containing stress-...    156   2e-43   Gossypium hirsutum [American cotton]
ref|XP_010257261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    155   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_004499868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    154   3e-43   Cicer arietinum [garbanzo]
ref|XP_010067883.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    154   1e-42   Eucalyptus grandis [rose gum]
gb|EYU31355.1|  hypothetical protein MIMGU_mgv1a014767mg                153   2e-42   Erythranthe guttata [common monkey flower]
gb|EYU27075.1|  hypothetical protein MIMGU_mgv1a014771mg                152   4e-42   Erythranthe guttata [common monkey flower]
ref|XP_006407313.1|  hypothetical protein EUTSA_v10021683mg             144   2e-39   Eutrema salsugineum [saltwater cress]
emb|CDY52666.1|  BnaC01g38560D                                          144   4e-39   Brassica napus [oilseed rape]
ref|XP_009120462.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    143   6e-39   Brassica rapa
gb|KFK38611.1|  hypothetical protein AALP_AA3G136800                    142   1e-38   Arabis alpina [alpine rockcress]
emb|CDY67538.1|  BnaUnng02260D                                          142   2e-38   Brassica napus [oilseed rape]
ref|XP_006298707.1|  hypothetical protein CARUB_v10014801mg             142   3e-38   Capsella rubella
ref|XP_009146604.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    141   3e-38   Brassica rapa
gb|ACR56825.1|  At3g12630-like protein                                  141   3e-38   Solanum quitoense [lulo]
gb|ACR56827.1|  At3g12630-like protein                                  140   5e-38   Solanum hirtum
gb|ACR56824.1|  At3g12630-like protein                                  140   6e-38   Solanum hirtum
ref|XP_003599112.1|  Zinc finger A20 and AN1 domain-containing st...    140   9e-38   Medicago truncatula
emb|CDY08419.1|  BnaA05g26550D                                          139   2e-37   Brassica napus [oilseed rape]
ref|XP_010499267.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    139   3e-37   Camelina sativa [gold-of-pleasure]
emb|CDX73811.1|  BnaA03g32360D                                          138   8e-37   
ref|XP_009135242.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    138   9e-37   Brassica rapa
ref|XP_010913137.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    136   2e-36   Elaeis guineensis
emb|CDY00788.1|  BnaC03g37720D                                          136   4e-36   
ref|XP_010928494.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    136   4e-36   
ref|XP_008795709.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    135   9e-36   Phoenix dactylifera
ref|XP_008776561.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    133   4e-35   Phoenix dactylifera
ref|XP_002882783.1|  hypothetical protein ARALYDRAFT_478622             133   6e-35   
ref|XP_010497315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    132   1e-34   Camelina sativa [gold-of-pleasure]
ref|NP_566429.1|  E3 ligase SAP5                                        131   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ45178.1|  hypothetical protein OsJ_29820                          130   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063521.1|  Os09g0486500                                       129   3e-33   
ref|XP_010465038.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    129   6e-33   
gb|EAZ09556.1|  hypothetical protein OsI_31833                          127   9e-33   Oryza sativa Indica Group [Indian rice]
gb|EMT33843.1|  Zinc finger A20 and AN1 domain-containing stress-...    125   8e-32   
gb|AGQ04314.1|  SAP1                                                    123   3e-31   Oryza sativa f. spontanea
gb|AGQ04316.1|  SAP1                                                    122   7e-31   Oryza glumipatula
ref|XP_009391817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADF80942.1|  zinc finger protein                                     121   2e-30   Phyllostachys praecox [zaozhu]
ref|XP_002460447.1|  hypothetical protein SORBIDRAFT_02g028240          120   9e-30   Sorghum bicolor [broomcorn]
gb|AAR83854.1|  induced stolon tip protein                              117   9e-30   Capsicum annuum
gb|ACM68451.1|  stress-associated protein 1                             116   2e-29   Solanum pennellii
ref|XP_002445913.1|  hypothetical protein SORBIDRAFT_07g027940          118   5e-29   Sorghum bicolor [broomcorn]
gb|AGQ04317.1|  SAP1                                                    116   1e-28   Oryza longistaminata [long-staminate rice]
gb|AGQ04315.1|  SAP1                                                    116   2e-28   Oryza rufipogon [common wild rice]
ref|XP_010928202.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   3e-28   Elaeis guineensis
gb|AGQ04319.1|  SAP1                                                    115   4e-28   Oryza meridionalis [Australian wild rice]
ref|XP_003557532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   4e-28   Brachypodium distachyon [annual false brome]
ref|NP_001140650.1|  uncharacterized protein LOC100272725               114   2e-27   Zea mays [maize]
ref|XP_010228315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   2e-27   
ref|XP_004973853.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   2e-27   Setaria italica
ref|XP_002993103.1|  hypothetical protein SELMODRAFT_187216             113   3e-27   
gb|AGQ04323.1|  SAP1                                                    112   3e-27   Oryza punctata
ref|XP_009418201.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925078.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   6e-27   Elaeis guineensis
ref|XP_008794968.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   8e-27   Phoenix dactylifera
ref|NP_001058985.1|  Os07g0168800                                       112   9e-27   
ref|XP_004510979.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   1e-26   Cicer arietinum [garbanzo]
ref|NP_001106263.1|  AN110                                              111   2e-26   
ref|XP_008808665.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-26   Phoenix dactylifera
gb|AGQ04324.1|  SAP1                                                    109   4e-26   Oryza officinalis
gb|EMT06701.1|  Zinc finger A20 and AN1 domain-containing stress-...    109   8e-26   
ref|NP_001266661.1|  multiple stress-responsive zinc-finger prote...    109   9e-26   
ref|XP_009770817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   1e-25   Nicotiana sylvestris
gb|ABK90631.1|  zinc finger protein                                     108   2e-25   Aeluropus littoralis
dbj|BAK03526.1|  predicted protein                                      108   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011025067.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   3e-25   Populus euphratica
ref|XP_003542858.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   4e-25   Glycine max [soybeans]
ref|XP_002513177.1|  zinc finger protein, putative                      106   4e-25   Ricinus communis
ref|XP_010257702.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   5e-25   Nelumbo nucifera [Indian lotus]
gb|AFK36400.1|  unknown                                                 106   6e-25   Medicago truncatula
ref|XP_003627722.1|  Zinc finger A20 and AN1 domain-containing st...    106   6e-25   Medicago truncatula
ref|NP_001275387.1|  zinc finger A20 and AN1 domain-containing st...    105   2e-24   Solanum tuberosum [potatoes]
gb|ACJ84133.1|  unknown                                                 105   2e-24   Medicago truncatula
ref|XP_006657485.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   3e-24   Oryza brachyantha
dbj|BAJ88745.1|  predicted protein                                      105   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007133828.1|  hypothetical protein PHAVU_011G212300g             104   3e-24   Phaseolus vulgaris [French bean]
ref|XP_010534277.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_010268591.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   3e-24   Nelumbo nucifera [Indian lotus]
dbj|BAK01503.1|  predicted protein                                      104   4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011094369.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   4e-24   Sesamum indicum [beniseed]
dbj|BAJ94586.1|  predicted protein                                      104   4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006361216.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   4e-24   Solanum tuberosum [potatoes]
ref|XP_004228358.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   5e-24   
gb|ACL01101.1|  zinc finger protein                                     103   8e-24   Phyllostachys edulis [kikko-chiku]
gb|EMT32776.1|  Zinc finger A20 and AN1 domain-containing stress-...    107   8e-24   
gb|EMS48100.1|  Zinc finger A20 and AN1 domain-containing stress-...    107   9e-24   Triticum urartu
gb|EMT17725.1|  Zinc finger A20 and AN1 domain-containing stress-...    103   1e-23   
gb|ACM68446.1|  stress-associated protein 9                             102   2e-23   Solanum lycopersicum
gb|ADF80943.1|  zinc finger protein                                     103   2e-23   Phyllostachys vivax
ref|XP_008384536.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   2e-23   
ref|XP_004249448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   2e-23   
gb|EMS47592.1|  Zinc finger A20 and AN1 domain-containing stress-...    105   3e-23   Triticum urartu
gb|ACM68453.1|  stress-associated protein 3                             102   4e-23   Solanum pennellii
ref|XP_009589288.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   4e-23   Nicotiana tomentosiformis
gb|EYU46282.1|  hypothetical protein MIMGU_mgv1a014897mg                102   5e-23   Erythranthe guttata [common monkey flower]
gb|ACM68440.1|  stress-associated protein 3                             102   6e-23   Solanum lycopersicum
ref|XP_010555326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   6e-23   Tarenaya hassleriana [spider flower]
ref|XP_010261028.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   6e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006660763.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   7e-23   Oryza brachyantha
ref|NP_001288688.1|  zinc finger A20 and AN1 domain-containing st...    101   8e-23   Zea mays [maize]
ref|XP_003540534.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   9e-23   Glycine max [soybeans]
ref|XP_009376154.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_006345467.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   1e-22   Solanum tuberosum [potatoes]
ref|NP_001051527.1|  Os03g0792900                                       100   1e-22   
gb|KDP35279.1|  hypothetical protein JCGZ_09438                         100   1e-22   Jatropha curcas
gb|ACM68454.1|  stress-associated protein 4                             100   1e-22   Solanum pennellii
gb|KEH16280.1|  zinc finger A20 and AN1 domain stress-associated ...    101   1e-22   Medicago truncatula
gb|KEH16279.1|  zinc finger A20 and AN1 domain stress-associated ...    100   2e-22   Medicago truncatula
ref|XP_004951572.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   2e-22   Setaria italica
gb|ABK21092.1|  unknown                                                 100   2e-22   Picea sitchensis
ref|XP_004229614.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   3e-22   
gb|ACM68441.1|  stress-associated protein 4                           99.8    3e-22   Solanum lycopersicum
ref|XP_011080265.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   3e-22   Sesamum indicum [beniseed]
ref|XP_008461274.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   3e-22   Cucumis melo [Oriental melon]
dbj|BAO74165.1|  zinc finger protein                                    100   3e-22   Cucurbita pepo subsp. ovifera
ref|XP_010031824.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.8    4e-22   Eucalyptus grandis [rose gum]
ref|XP_010531421.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.8    4e-22   Tarenaya hassleriana [spider flower]
gb|EYU18025.1|  hypothetical protein MIMGU_mgv1a014524mg                100   4e-22   Erythranthe guttata [common monkey flower]
ref|XP_006339126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.4    4e-22   Solanum tuberosum [potatoes]
ref|XP_009589284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.8    5e-22   Nicotiana tomentosiformis
dbj|BAO74167.1|  zinc finger protein                                  99.8    5e-22   Cucurbita pepo subsp. pepo [field pumpkin]
gb|EYU31356.1|  hypothetical protein MIMGU_mgv1a014938mg              99.4    5e-22   Erythranthe guttata [common monkey flower]
ref|XP_002975420.1|  hypothetical protein SELMODRAFT_150464           99.4    6e-22   
ref|XP_010031823.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   6e-22   Eucalyptus grandis [rose gum]
ref|XP_004135920.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.0    7e-22   
ref|XP_004158200.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.0    8e-22   
ref|XP_011078867.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    1e-21   Sesamum indicum [beniseed]
ref|XP_006487967.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.2    1e-21   Citrus sinensis [apfelsine]
emb|CDP09861.1|  unnamed protein product                              98.6    1e-21   Coffea canephora [robusta coffee]
ref|XP_009770813.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    1e-21   Nicotiana sylvestris
ref|XP_008795703.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.2    1e-21   Phoenix dactylifera
ref|XP_011075194.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    1e-21   Sesamum indicum [beniseed]
ref|XP_006660259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.7    2e-21   
gb|ABK21003.1|  unknown                                               98.2    2e-21   Picea sitchensis
ref|XP_004513638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.8    2e-21   Cicer arietinum [garbanzo]
ref|XP_004513637.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.8    2e-21   
ref|XP_006365818.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.8    2e-21   Solanum tuberosum [potatoes]
gb|ACG26325.1|  zinc finger A20 and AN1 domains-containing protein    97.8    2e-21   Zea mays [maize]
dbj|BAJ90521.1|  predicted protein                                    97.4    2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007206025.1|  hypothetical protein PRUPE_ppa012468mg           97.8    2e-21   Prunus persica
ref|XP_009609312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.8    2e-21   Nicotiana tomentosiformis
ref|XP_002285530.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.8    2e-21   Vitis vinifera
ref|NP_001130325.1|  LOC100191419                                     97.4    3e-21   Zea mays [maize]
gb|EPS60935.1|  induced stolon tip protein                            97.1    3e-21   Genlisea aurea
ref|XP_004252868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.1    3e-21   
gb|ACJ83925.1|  unknown                                               97.4    3e-21   Medicago truncatula
gb|ACJ86086.1|  unknown                                               97.1    3e-21   Medicago truncatula
gb|ACM68460.1|  stress-associated protein 10                          97.1    3e-21   Solanum pennellii
dbj|BAO74166.1|  zinc finger protein                                  97.4    3e-21   Cucurbita pepo subsp. pepo [field pumpkin]
gb|ABK26062.1|  unknown                                               97.4    3e-21   Picea sitchensis
gb|EYU46288.1|  hypothetical protein MIMGU_mgv1a015852mg              96.3    4e-21   Erythranthe guttata [common monkey flower]
ref|XP_009376157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.1    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_009765432.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.2    4e-21   Nicotiana sylvestris
ref|XP_009374543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.7    5e-21   Pyrus x bretschneideri [bai li]
ref|XP_009596933.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.9    5e-21   Nicotiana tomentosiformis
gb|ABI31653.1|  zinc finger protein                                   96.7    5e-21   Camellia sinensis [black tea]
ref|XP_010911243.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.3    5e-21   Elaeis guineensis
emb|CDP20562.1|  unnamed protein product                              96.3    6e-21   Coffea canephora [robusta coffee]
ref|XP_002323304.1|  hypothetical protein POPTR_0016s05220g           96.7    6e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010545575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.7    6e-21   Tarenaya hassleriana [spider flower]
ref|NP_001058066.1|  Os06g0612800                                     96.3    7e-21   
ref|XP_010228642.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.9    7e-21   
gb|ABS72032.1|  putative AN1-like zinc finger protein                 93.6    7e-21   Olea europaea
gb|ACM68459.1|  stress-associated protein 9                           95.9    7e-21   Solanum pennellii
ref|XP_006842203.1|  hypothetical protein AMTR_s00078p00168800        96.3    7e-21   
ref|XP_009419155.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.3    9e-21   
ref|XP_010928496.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.9    9e-21   Elaeis guineensis
ref|XP_010228638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.9    9e-21   
ref|XP_004288126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.9    1e-20   Fragaria vesca subsp. vesca
ref|XP_010279014.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.9    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_003557802.2|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.1    1e-20   
emb|CBI16408.3|  unnamed protein product                              94.7    1e-20   Vitis vinifera
ref|XP_002285543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.7    1e-20   Vitis vinifera
ref|XP_010540147.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    1e-20   Tarenaya hassleriana [spider flower]
emb|CBI16411.3|  unnamed protein product                              94.7    1e-20   Vitis vinifera
ref|XP_009365001.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    1e-20   Pyrus x bretschneideri [bai li]
gb|EPS60974.1|  hypothetical protein M569_13826                       95.1    1e-20   Genlisea aurea
ref|XP_010105325.1|  Zinc finger A20 and AN1 domain-containing st...  95.5    1e-20   Morus notabilis
ref|XP_011080262.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.7    1e-20   Sesamum indicum [beniseed]
ref|XP_008786424.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    2e-20   Phoenix dactylifera
ref|XP_010544226.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_009618607.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.3    2e-20   Nicotiana tomentosiformis
ref|XP_009349757.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    2e-20   Pyrus x bretschneideri [bai li]
dbj|BAG50058.1|  transcription factor C2H2                            95.1    2e-20   Lotus japonicus
ref|XP_010907320.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.1    2e-20   Elaeis guineensis
gb|ABI23728.1|  stress-tolerance zinc finger protein                  95.5    2e-20   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACF80251.1|  unknown                                               95.5    2e-20   Zea mays [maize]
gb|EPS66139.1|  hypothetical protein M569_08638                       92.8    2e-20   Genlisea aurea
ref|XP_002304765.2|  zinc finger family protein                       95.5    2e-20   
gb|EYU18023.1|  hypothetical protein MIMGU_mgv1a015860mg              94.4    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_011090386.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    2e-20   Sesamum indicum [beniseed]
gb|AAX14637.1|  zinc finger protein                                   95.1    2e-20   Zea mays [maize]
ref|XP_009799138.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    2e-20   Nicotiana sylvestris
ref|XP_007145644.1|  hypothetical protein PHAVU_007G256400g           95.1    2e-20   Phaseolus vulgaris [French bean]
ref|XP_002279037.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.0    2e-20   Vitis vinifera
gb|AAQ84334.1|  stress-associated protein 8                           94.7    3e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_009593342.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.7    3e-20   Nicotiana tomentosiformis
ref|NP_001062181.1|  Os08g0504700                                     94.7    3e-20   
gb|ACM68447.1|  stress-associated protein 10                          94.4    3e-20   Solanum lycopersicum
ref|XP_006354259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    3e-20   Solanum tuberosum [potatoes]
ref|XP_008354997.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    3e-20   
ref|XP_011090378.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    3e-20   
ref|XP_006381027.1|  hypothetical protein POPTR_0006s05520g           94.4    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_008384532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    4e-20   
gb|AFW87479.1|  zinc finger protein1                                  94.7    4e-20   
ref|XP_011037831.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    4e-20   Populus euphratica
ref|XP_009354716.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    4e-20   Pyrus x bretschneideri [bai li]
ref|XP_010544224.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    4e-20   Tarenaya hassleriana [spider flower]
ref|XP_002310618.2|  hypothetical protein POPTR_0007s06890g           94.0    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010271706.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009783306.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.0    5e-20   Nicotiana sylvestris
ref|XP_009785364.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.0    5e-20   Nicotiana sylvestris
ref|XP_004295198.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    5e-20   Fragaria vesca subsp. vesca
ref|XP_002297783.1|  zinc finger family protein                       94.0    6e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006656245.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.0    6e-20   Oryza brachyantha
ref|XP_003597446.1|  Zinc finger A20 and AN1 domain-containing st...  93.6    6e-20   
ref|XP_009591880.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    6e-20   Nicotiana tomentosiformis
ref|XP_006427949.1|  hypothetical protein CICLE_v10026622mg           94.0    6e-20   
ref|XP_010233975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    6e-20   
ref|XP_003633556.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    7e-20   Vitis vinifera
ref|XP_004951575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    7e-20   Setaria italica
ref|XP_009402699.1|  PREDICTED: zinc finger AN1 domain-containing...  92.8    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008349975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    8e-20   Malus domestica [apple tree]
gb|AFK43724.1|  unknown                                               95.1    8e-20   Medicago truncatula
ref|XP_007052555.1|  Zinc finger A20 and AN1 domain-containing st...  93.6    8e-20   Theobroma cacao [chocolate]
ref|XP_006424263.1|  hypothetical protein CICLE_v10029439mg           93.2    8e-20   Citrus clementina [clementine]
dbj|BAO74169.1|  zinc finger protein                                  93.6    8e-20   Cucurbita pepo subsp. pepo [field pumpkin]
dbj|BAO74168.1|  zinc finger protein                                  93.6    8e-20   Cucurbita pepo subsp. ovifera
ref|XP_002283050.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    9e-20   Vitis vinifera
emb|CDP15398.1|  unnamed protein product                              93.2    9e-20   Coffea canephora [robusta coffee]
ref|XP_008373747.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    9e-20   
ref|XP_009776796.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.2    9e-20   Nicotiana sylvestris
gb|EMS48637.1|  Zinc finger A20 and AN1 domain-containing stress-...  95.5    9e-20   Triticum urartu
ref|XP_009802017.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  92.8    1e-19   Nicotiana sylvestris
gb|ACM68455.1|  stress-associated protein 5                           93.2    1e-19   Solanum pennellii
ref|XP_010673602.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.2    1e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|ACM68452.1|  stress-associated protein 2                           93.2    1e-19   Solanum pennellii
ref|XP_009601977.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    1e-19   Nicotiana tomentosiformis
ref|XP_004250869.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.2    1e-19   
ref|NP_001106260.1|  LOC100127534                                     92.8    1e-19   
ref|XP_002282913.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.8    1e-19   
gb|AFK43974.1|  unknown                                               92.8    1e-19   
gb|ABD65463.1|  DNA binding/zinc ion binding protein                  92.8    1e-19   
ref|XP_004957171.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.8    1e-19   
gb|KJB51967.1|  hypothetical protein B456_008G240900                  92.8    1e-19   
ref|XP_002513466.1|  zinc finger protein, putative                    92.8    1e-19   
gb|ACT53874.1|  zinc finger protein                                   92.8    2e-19   
ref|XP_001756532.1|  predicted protein                                92.8    2e-19   
ref|XP_010244455.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    2e-19   
ref|XP_008804805.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    2e-19   
ref|XP_004249192.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    2e-19   
ref|XP_010913141.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    2e-19   
ref|XP_005708852.1|  zinc finger (AN1-like) family protein            92.8    2e-19   
ref|XP_009411822.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    2e-19   
ref|XP_006850149.1|  hypothetical protein AMTR_s00022p00236720        91.7    2e-19   
gb|EEE56499.1|  hypothetical protein OsJ_05747                        92.4    2e-19   
ref|XP_007028890.1|  Zinc finger A20 and AN1 domain-containing st...  92.4    2e-19   
ref|XP_006851496.1|  hypothetical protein AMTR_s00040p00148670        92.4    2e-19   
ref|NP_001046186.1|  Os02g0195600                                     92.4    2e-19   
gb|KDO50474.1|  hypothetical protein CISIN_1g030772mg                 92.0    2e-19   
ref|XP_007028887.1|  Zinc finger A20 and AN1 domain-containing st...  92.0    2e-19   
gb|ABK92973.1|  unknown                                               92.0    2e-19   
emb|CBI29889.3|  unnamed protein product                              91.3    3e-19   
ref|XP_003574738.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.0    3e-19   
ref|XP_006850157.1|  hypothetical protein AMTR_s00022p00239310        92.0    3e-19   
dbj|BAJ86013.1|  predicted protein                                    92.0    3e-19   
ref|XP_009620573.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  91.7    4e-19   
ref|XP_009416648.1|  PREDICTED: zinc finger AN1 domain-containing...  91.3    4e-19   
gb|AFK93416.1|  stress-response protein                               91.7    4e-19   
ref|XP_007014974.1|  Zinc finger A20 and AN1 domain-containing st...  92.0    4e-19   
gb|ABN08135.1|  Zinc finger, AN1-type; Zinc finger, A20-type          91.7    4e-19   
gb|AIN39820.1|  hypothetical protein                                  91.7    4e-19   
ref|XP_007014975.1|  Zinc finger A20 and AN1 domain-containing st...  91.7    4e-19   
gb|ABK24386.1|  unknown                                               91.3    5e-19   
ref|XP_009415054.1|  PREDICTED: zinc finger AN1 domain-containing...  90.9    5e-19   
ref|XP_010025527.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.8    5e-19   
gb|EMT31119.1|  Zinc finger A20 and AN1 domain-containing stress-...  91.3    5e-19   
ref|XP_009391886.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  91.3    6e-19   
ref|XP_006593451.1|  PREDICTED: uncharacterized protein LOC100802...  91.3    6e-19   
ref|NP_180326.1|  zinc finger A20 and AN1 domain-containing stres...  90.9    7e-19   
gb|EPS61935.1|  hypothetical protein M569_12860                       90.5    7e-19   
ref|XP_010928861.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.9    7e-19   
ref|XP_006647019.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    8e-19   
ref|XP_009416009.1|  PREDICTED: zinc finger AN1 domain-containing...  90.1    8e-19   
ref|NP_001242495.1|  uncharacterized protein LOC100802969             90.9    8e-19   
ref|XP_006576194.1|  PREDICTED: uncharacterized protein LOC100527...  90.5    8e-19   
ref|NP_001105248.1|  uncharacterized protein LOC542155                92.0    9e-19   
emb|CBI24865.3|  unnamed protein product                              89.7    9e-19   
emb|CDP10083.1|  unnamed protein product                              91.7    9e-19   
ref|XP_011042076.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.5    9e-19   
ref|XP_001770822.1|  predicted protein                                90.9    1e-18   
ref|XP_008364799.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.5    1e-18   
ref|XP_009418488.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.1    1e-18   
ref|XP_009128643.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.5    1e-18   
gb|EMT02223.1|  Zinc finger A20 and AN1 domain-containing stress-...  89.7    1e-18   
ref|XP_008812241.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    1e-18   
ref|XP_001771457.1|  predicted protein                                90.5    1e-18   
emb|CDP20483.1|  unnamed protein product                              90.1    1e-18   
gb|KCW62226.1|  hypothetical protein EUGRSUZ_H04886                   92.4    1e-18   
gb|KJB20838.1|  hypothetical protein B456_003G167800                  90.1    1e-18   
ref|XP_009385134.1|  PREDICTED: zinc finger AN1 domain-containing...  89.7    1e-18   
ref|XP_006597247.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.1    1e-18   
ref|XP_011025579.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    2e-18   
ref|XP_009393780.1|  PREDICTED: zinc finger AN1 domain-containing...  89.4    2e-18   
gb|KHN07399.1|  Zinc finger A20 and AN1 domain-containing stress-...  89.7    2e-18   
ref|NP_001236393.1|  uncharacterized protein LOC100500070             89.7    2e-18   
ref|XP_008783998.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.4    2e-18   
ref|NP_001106259.1|  AN12                                             89.4    2e-18   
ref|XP_008231312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    2e-18   
ref|XP_007027699.1|  A20/AN1-like zinc finger family protein, put...  89.4    2e-18   
ref|XP_007218502.1|  hypothetical protein PRUPE_ppa012373mg           89.7    2e-18   
ref|XP_004798521.1|  PREDICTED: AN1-type zinc finger protein 6        89.4    2e-18   
ref|XP_004365991.2|  zinc finger protein                              89.7    2e-18   
ref|XP_007206046.1|  hypothetical protein PRUPE_ppa012588mg           89.4    2e-18   
ref|XP_003542595.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.4    2e-18   
ref|NP_001106266.1|  LOC100127541                                     89.0    3e-18   
ref|XP_010529513.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.4    3e-18   
gb|KDP22067.1|  hypothetical protein JCGZ_25898                       89.4    3e-18   
gb|KHN18756.1|  Zinc finger A20 and AN1 domain-containing stress-...  88.2    3e-18   
ref|XP_006288770.1|  hypothetical protein CARUB_v10002091mg           89.4    3e-18   
ref|XP_002466323.1|  hypothetical protein SORBIDRAFT_01g005640        89.4    3e-18   
gb|ABK25818.1|  unknown                                               89.0    3e-18   
ref|XP_002312908.1|  zinc finger family protein                       88.6    3e-18   
ref|XP_011044990.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    3e-18   
ref|XP_004969762.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    4e-18   
ref|XP_010538772.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    4e-18   
gb|KHG20851.1|  Zinc finger A20 and AN1 domain-containing stress-...  89.7    4e-18   
gb|ABK21043.1|  unknown                                               88.6    4e-18   
ref|XP_006870970.1|  PREDICTED: AN1-type zinc finger protein 6 is...  89.0    4e-18   
ref|XP_009143596.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    4e-18   
ref|XP_003547098.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    5e-18   
ref|XP_007202662.1|  hypothetical protein PRUPE_ppa012365mg           88.6    5e-18   
ref|XP_004309600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    5e-18   
ref|XP_006490054.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    5e-18   
ref|XP_008788284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    6e-18   
ref|XP_004324566.1|  PREDICTED: AN1-type zinc finger protein 6-li...  88.6    6e-18   
ref|XP_004594633.1|  PREDICTED: AN1-type zinc finger protein 6 is...  88.6    6e-18   
ref|XP_006603655.1|  PREDICTED: uncharacterized protein LOC100499...  88.2    6e-18   
gb|ACJ85990.1|  unknown                                               88.2    6e-18   
ref|XP_002160663.2|  PREDICTED: AN1-type zinc finger protein 6-like   87.8    7e-18   
ref|XP_004516195.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    7e-18   
ref|XP_006396803.1|  hypothetical protein EUTSA_v10029014mg           88.2    7e-18   
gb|EPS64266.1|  hypothetical protein M569_10515                       87.4    8e-18   
ref|XP_009416000.1|  PREDICTED: zinc finger AN1 domain-containing...  87.4    8e-18   
ref|XP_002281372.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    8e-18   
ref|XP_011020305.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    8e-18   
ref|NP_001229848.1|  AN1-type zinc finger protein 6 isoform d         87.8    1e-17   
ref|XP_001756533.1|  predicted protein                                87.4    1e-17   
ref|XP_007447131.1|  PREDICTED: AN1-type zinc finger protein 6 is...  87.8    1e-17   
ref|XP_009412395.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    1e-17   
ref|XP_009405572.1|  PREDICTED: zinc finger AN1 domain-containing...  87.0    1e-17   
ref|XP_009412393.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    1e-17   
ref|XP_003554427.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    1e-17   
gb|EYU35469.1|  hypothetical protein MIMGU_mgv1a022466mg              86.7    1e-17   
ref|XP_004406082.1|  PREDICTED: AN1-type zinc finger protein 6-li...  87.4    1e-17   
gb|KJB37574.1|  hypothetical protein B456_006G211300                  87.4    1e-17   
ref|XP_004278382.1|  PREDICTED: AN1-type zinc finger protein 6 is...  87.4    1e-17   
ref|XP_010558994.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    1e-17   
ref|XP_006304261.1|  hypothetical protein CARUB_v10010492mg           87.0    1e-17   
ref|XP_011046278.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    2e-17   
ref|NP_001237386.1|  uncharacterized protein LOC100306347             87.0    2e-17   
ref|XP_011020304.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    2e-17   
ref|XP_010913940.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    2e-17   
ref|XP_010473155.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    2e-17   
ref|XP_008334127.1|  PREDICTED: AN1-type zinc finger protein 5-like   87.8    2e-17   
ref|XP_010510759.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    2e-17   
gb|EPY73931.1|  AN1-type zinc finger protein 5                        86.3    2e-17   
ref|XP_010045231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    2e-17   
ref|XP_006189680.1|  PREDICTED: AN1-type zinc finger protein 6 is...  87.0    2e-17   
ref|XP_010542567.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.7    2e-17   
ref|XP_001779169.1|  predicted protein                                86.7    2e-17   
ref|XP_004421951.1|  PREDICTED: AN1-type zinc finger protein 6 is...  87.0    2e-17   
ref|XP_010913090.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    2e-17   
gb|KDP43452.1|  hypothetical protein JCGZ_16739                       86.7    3e-17   
ref|XP_005974070.1|  PREDICTED: AN1-type zinc finger protein 6 is...  87.0    3e-17   
ref|XP_002116218.1|  hypothetical protein TRIADDRAFT_50857            86.7    3e-17   
ref|XP_008159435.1|  PREDICTED: AN1-type zinc finger protein 6 is...  86.7    3e-17   
ref|XP_008462560.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    3e-17   
ref|XP_010458672.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    3e-17   
emb|CDX84135.1|  BnaC04g08970D                                        85.9    3e-17   
gb|ACT78956.1|  zinc finger protein                                   85.9    4e-17   
gb|EFA78520.1|  putative zinc finger protein                          85.5    4e-17   
ref|XP_007066909.1|  PREDICTED: AN1-type zinc finger protein 6 is...  86.3    4e-17   
ref|XP_008804197.1|  PREDICTED: zinc finger AN1 domain-containing...  85.5    4e-17   
ref|XP_009406414.1|  PREDICTED: zinc finger AN1 domain-containing...  85.9    4e-17   
ref|NP_001237029.1|  uncharacterized protein LOC100527251             85.9    4e-17   
ref|XP_004658309.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.9    5e-17   
ref|XP_002528717.1|  zinc finger protein, putative                    85.5    5e-17   
ref|XP_006888306.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.9    5e-17   
ref|XP_007950007.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.9    6e-17   
ref|XP_008791733.1|  PREDICTED: zinc finger AN1 domain-containing...  85.1    6e-17   
ref|XP_010557404.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  85.1    7e-17   
ref|XP_005077919.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.5    7e-17   
ref|XP_009411960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    7e-17   
ref|NP_001232980.1|  uncharacterized protein LOC100168509             85.5    7e-17   
ref|XP_009351048.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.5    8e-17   
gb|AHB08885.1|  zinc finger A20 and AN1 domain-containing stress-...  85.5    8e-17   
ref|XP_010912823.1|  PREDICTED: zinc finger AN1 domain-containing...  84.7    8e-17   
ref|XP_010515753.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.1    8e-17   
gb|EMS53549.1|  Zinc finger A20 and AN1 domain-containing stress-...  84.3    9e-17   
ref|XP_001761755.1|  predicted protein                                84.7    9e-17   
ref|XP_003434430.2|  PREDICTED: AN1-type zinc finger protein 6 is...  85.5    1e-16   
ref|XP_009876598.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.1    1e-16   
ref|XP_004387551.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.1    1e-16   
ref|XP_010553481.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.1    1e-16   
ref|XP_006477315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    1e-16   
ref|XP_003784626.1|  PREDICTED: AN1-type zinc finger protein 6-li...  85.1    1e-16   
ref|XP_009137282.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.1    1e-16   
ref|XP_002603180.1|  hypothetical protein BRAFLDRAFT_226485           85.1    1e-16   
ref|XP_010157333.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.7    1e-16   
ref|XP_004617671.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.1    1e-16   
ref|XP_006391804.1|  hypothetical protein EUTSA_v10023731mg           84.3    1e-16   
ref|XP_005521625.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.7    1e-16   
ref|XP_009364301.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    1e-16   
ref|XP_009407895.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    1e-16   
gb|EMS62344.1|  Zinc finger A20 and AN1 domain-containing stress-...  83.6    1e-16   
gb|ABL97956.1|  zinc finger A20 and AN1 domains-containing protein    84.3    2e-16   
ref|XP_008378255.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    2e-16   
ref|XP_009114641.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    2e-16   
ref|XP_010139451.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.3    2e-16   
ref|XP_004738186.1|  PREDICTED: AN1-type zinc finger protein 6-li...  84.7    2e-16   
ref|XP_008935048.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.3    2e-16   
ref|XP_004143315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    2e-16   
ref|XP_005889816.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.3    2e-16   
ref|NP_194013.1|  A20/AN1-like zinc finger family protein             84.3    2e-16   
ref|XP_010174709.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.3    2e-16   
ref|XP_006440443.1|  hypothetical protein CICLE_v10022558mg           84.0    2e-16   
emb|CDX86725.1|  BnaA09g21150D                                        83.6    2e-16   
ref|XP_010645797.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  82.8    2e-16   
ref|XP_005148802.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.0    2e-16   
ref|XP_007040022.1|  A20/AN1-like zinc finger family protein, put...  84.0    3e-16   
ref|XP_006644627.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.2    3e-16   
emb|CDP10084.1|  unnamed protein product                              85.1    3e-16   
ref|XP_009560016.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.0    3e-16   
ref|XP_004149261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.6    3e-16   
ref|XP_008490199.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.0    3e-16   
gb|KDO61115.1|  hypothetical protein CISIN_1g031015mg                 83.6    3e-16   
ref|XP_009082778.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.0    3e-16   
emb|CDS28068.1|  zinc finger A20 and AN1 domain containing protein    84.7    3e-16   
ref|XP_004017840.1|  PREDICTED: AN1-type zinc finger protein 6 is...  84.0    3e-16   
ref|XP_009459927.1|  PREDICTED: AN1-type zinc finger protein 6-li...  83.6    3e-16   
ref|XP_006481799.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.6    3e-16   
ref|XP_003384459.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.2    3e-16   
ref|XP_006430236.1|  hypothetical protein CICLE_v10012937mg           83.6    3e-16   
ref|XP_006219718.1|  PREDICTED: AN1-type zinc finger protein 5-li...  83.6    3e-16   
ref|XP_008923640.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    3e-16   
ref|XP_005419656.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    3e-16   
ref|XP_005171883.1|  PREDICTED: AN1-type zinc finger protein 5 is...  84.3    3e-16   
ref|XP_008638302.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    3e-16   
ref|XP_010286312.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    4e-16   
ref|XP_005436662.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    4e-16   
ref|XP_009701714.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    4e-16   
ref|XP_009584789.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    4e-16   
ref|XP_007155611.1|  hypothetical protein PHAVU_003G216400g           82.8    4e-16   
ref|XP_010189201.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.6    4e-16   
ref|XP_010195894.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.2    4e-16   
ref|XP_006108289.1|  PREDICTED: AN1-type zinc finger protein 6-li...  83.6    4e-16   
ref|XP_010302402.1|  PREDICTED: AN1-type zinc finger protein 6 is...  83.2    4e-16   
ref|XP_003431370.1|  PREDICTED: AN1-type zinc finger protein 6        83.6    4e-16   
emb|CDX98772.1|  BnaA03g45570D                                        84.7    4e-16   



>ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana sylvestris]
Length=180

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 126/174 (72%), Gaps = 12/174 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagl-------xs  531
            MAQ+T KEETEFK VPETITLCVNNCGVTGNPATNNMCQKCF+ATTAA           +
Sbjct  1    MAQRTEKEETEFKAVPETITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSA  60

Query  530  aAIHHKXGEKXPRXG-FRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKR  354
              I HK  EK  R     R S  R+SP+ K      + R  + +  +E++ +   PPAKR
Sbjct  61   VTIPHKFAEKLARSERSARFSSLRSSPERK----SDLERTSQHLTVKEDKLKESEPPAKR  116

Query  353  EVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            EVNRCSGCRRKVGLTGFRCRCGELFCGE RYSDR DCSYDYK+ GRDAIARENP
Sbjct  117  EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENP  170



>ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana tomentosiformis]
Length=180

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 125/174 (72%), Gaps = 12/174 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaagl-------xs  531
            MAQ+T KEETEFK VPETITLCVNNCGVTGNPATNNMCQKCF+ATTAA            
Sbjct  1    MAQRTEKEETEFKAVPETITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSV  60

Query  530  aAIHHKXGEKXPRXG-FRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKR  354
              I HK  EK  R     R S  R+SP+ K      + R  + +  +E++ +   PPAKR
Sbjct  61   VTIPHKFAEKLARSERSARFSLLRSSPERK----SDLERTSQHLTVKEDKMKESVPPAKR  116

Query  353  EVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            EVNRCSGCRRKVGLTGFRCRCG+LFCGE RYSDR DCSYDYK+ GRDAIARENP
Sbjct  117  EVNRCSGCRRKVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKSAGRDAIARENP  170



>ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Solanum lycopersicum]
 gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum]
Length=188

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 125/178 (70%), Gaps = 12/178 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxs-------  531
            MAQ+T KEETEFK VPETITLC+NNCGVTGNPATNNMCQKCF+ATTAA    S       
Sbjct  1    MAQRTEKEETEFKAVPETITLCINNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGTS  60

Query  530  aAIHHKXGEKXPRX-GFRRLSPERTSPDXK----RREDXTVARGEKTVeeeeeeeENRSP  366
              I H   EK  R     R S  R+SPD K    R        G+  + +EE++ +   P
Sbjct  61   VTIPHNFAEKLVRSEKSARFSSLRSSPDRKSDLDRMSQDLKKVGDTMMVKEEDQLKASLP  120

Query  365  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            PAKREVNRCSGCRRKVGLTGFRCRCGELFCGE RYSDR DCSYDYK  GR+AIARENP
Sbjct  121  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP  178



>ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=187

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 124/178 (70%), Gaps = 13/178 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxs-------  531
            MAQ+T KEETEFK VPETITLC+N CGVTGNPATNNMCQKCF+ATTAA    S       
Sbjct  1    MAQRTEKEETEFKAVPETITLCIN-CGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSA  59

Query  530  aAIHHKXGEKXPRX-GFRRLSPERTSPDXK----RREDXTVARGEKTVeeeeeeeENRSP  366
              I HK  EK  R     R S  R+ PD K    R        G+  + +EE++ +   P
Sbjct  60   VTIPHKFAEKLVRSEKSARFSSLRSLPDRKSDLDRMSQDLKKVGDWMMVKEEDQLKESLP  119

Query  365  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            PAKREVNRCSGCRRKVGLTGFRCRCGELFCGE RYSDR DC+YDYK  GR+AIARENP
Sbjct  120  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP  177



>ref|XP_008461273.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Cucumis melo]
Length=159

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 116/169 (69%), Gaps = 23/169 (14%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKV PETITLCVNNCG+TGNPATNNMCQKCF+ATT  A +         
Sbjct  1    MAQRTEKEETEFKV-PETITLCVNNCGLTGNPATNNMCQKCFNATTTTASMAMKF----S  55

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPP---AKREVNRC  339
            GEK PR    R SPE+     + R   T A              +R  P   AKREVNRC
Sbjct  56   GEKSPRSTISR-SPEKFRFVSESRRIITAA--------------DRPKPDESAKREVNRC  100

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCR++VGLTGFRCRCG+LFC E RYSDR DCS+DYKA GR+AIARENP
Sbjct  101  SGCRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSFDYKAAGREAIARENP  149



>ref|XP_004135919.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004158204.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN45146.1| hypothetical protein Csa_7G428830 [Cucumis sativus]
Length=159

 Score =   172 bits (435),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 116/169 (69%), Gaps = 23/169 (14%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKV PETITLCVNNCG+TGNP TNNMCQKCF+ATTA A +         
Sbjct  1    MAQRTEKEETEFKV-PETITLCVNNCGLTGNPTTNNMCQKCFNATTATASMAIKF----S  55

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPP---AKREVNRC  339
            GEK PR    R SPE+     + R   T A              +R  P   AKREVNRC
Sbjct  56   GEKSPRSTTSR-SPEKFRFVSESRRIITAA--------------DRPKPDESAKREVNRC  100

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCR++VGLTGFRCRCG+LFC E RYSDR DCS+DYKA GR+AIARENP
Sbjct  101  SGCRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSFDYKAAGREAIARENP  149



>ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Glycine max]
Length=161

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 108/166 (65%), Gaps = 15/166 (9%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT KEET+FKV PETITLCVNNCGVTGNPATNNMCQKCF+A+TA             
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTASTATTSGA--------  51

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                   G    SP   S    R +  +       V +    ++     AKR VNRCSGC
Sbjct  52   ------GGAGIASPATRSGVSARPQKRSFPEEPSPVADPPSSDQTTPSEAKRVVNRCSGC  105

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCGELFC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  106  RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  151



>ref|XP_011087429.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=170

 Score =   167 bits (423),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 113/166 (68%), Gaps = 6/166 (4%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT KEETEFKVVPETI+LCVN CGV GN A NN+CQKCF+ TTA+    +AA     
Sbjct  1    MAQKTEKEETEFKVVPETISLCVN-CGVAGNSAANNLCQKCFNTTTASTAASAAA-TSPG  58

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
            G K     F   S    +   +R+ D     G+  +E  E      +PP KR+VNRCSGC
Sbjct  59   GAKHVNNVFVEKSFRSITCSPERKFDSADTSGDLKIEAAEV----EAPPVKRQVNRCSGC  114

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCGELFC + RYSDR DCSYDYKA GR AIARENP
Sbjct  115  RRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKAAGRQAIARENP  160



>ref|XP_009773992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=158

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 111/167 (66%), Gaps = 20/167 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPE-TITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            MAQ+T KEETE+KVV E TITLCV NCGV GNPATNNMCQ C ++T+A++   +    HK
Sbjct  1    MAQRTEKEETEYKVVHEKTITLCVKNCGVIGNPATNNMCQNCSNSTSASSSKVAYP--HK  58

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
                     F  +    TS D K   D  V   +K         +    PAKREVNRCSG
Sbjct  59   ---------FANILTRSTSSDLKNYVDRAVKDDDKV--------KESVSPAKREVNRCSG  101

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CRRKVGLTGFRCRCGELFCGE RYSDR DCSYDY+  GR+AIAR+NP
Sbjct  102  CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYRTAGREAIARQNP  148



>emb|CDP07749.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 119/181 (66%), Gaps = 17/181 (9%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH--  516
            MAQKT KEETEFKVVPETIT CVNNCGVTGNPATNNMCQKCF+AT++A+   S++     
Sbjct  1    MAQKTEKEETEFKVVPETITPCVNNCGVTGNPATNNMCQKCFNATSSASTSSSSSSSSST  60

Query  515  ------------KXGEKXPRXGFRRLSP-ERTSPDXKRREDXTVARGEKTVeeeeeeeEN  375
                        K GEK PR    +    ERT+   + R D  +    K           
Sbjct  61   SSSVTSSVAGAIKFGEKSPRSSSSKRLSPERTTDLAEIRRD--LKEEVKEASSAHATAPA  118

Query  374  RSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIAREN  195
             +   KREVNRCSGCRRKVGLTGFRCRCGELFC E RYSDR DCSYDYKA GR+AIAREN
Sbjct  119  TAAAVKREVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIAREN  178

Query  194  P  192
            P
Sbjct  179  P  179



>ref|XP_009365004.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X3 [Pyrus x bretschneideri]
Length=167

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 115/170 (68%), Gaps = 18/170 (11%)
 Frame = -1

Query  692  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA---I  522
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA   S++   I
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSAAI  61

Query  521  HHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
                 EK PR      + E   P  ++     +AR ++T             P +R VNR
Sbjct  62   LKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVNR  107

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CSGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  108  CSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  157



>ref|XP_008231311.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Prunus mume]
Length=165

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 113/169 (67%), Gaps = 18/169 (11%)
 Frame = -1

Query  692  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsa--AIH  519
            +MAQ+T KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A++A     S+     
Sbjct  3    KMAQRTEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSSAVTL  61

Query  518  HKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
               GEK PR      S E  +   +R     +AR +++               +R VNRC
Sbjct  62   KFSGEKSPRSS--SFSFEAPAEITRRTTASEIARSDESAN-------------RRVVNRC  106

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  107  SGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>ref|XP_010106958.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
Length=172

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 110/166 (66%), Gaps = 4/166 (2%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKV PE ITLCVNNCGV GNPATNNMCQ CF+ATT  A   ++   +  
Sbjct  1    MAQRTEKEETEFKV-PEKITLCVNNCGVIGNPATNNMCQNCFNATTTTAAASTSTTANLK  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                        S  R +    RR         KT  +    EE+ + PAKR VNRCSGC
Sbjct  60   FSGEKSSSSAISSSSRPT---DRRSASPAENSRKTTADSARSEEDEAVPAKRVVNRCSGC  116

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCGELFC E RYSDR DCSYDYK+ GR+AIARENP
Sbjct  117  RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKSVGREAIARENP  162



>ref|XP_009365003.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X2 [Pyrus x bretschneideri]
Length=168

 Score =   164 bits (416),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 115/171 (67%), Gaps = 19/171 (11%)
 Frame = -1

Query  692  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA----  525
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA   S++    
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSSAA  61

Query  524  IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVN  345
            I     EK PR      + E   P  ++     +AR ++T             P +R VN
Sbjct  62   ILKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVN  107

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCSGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  108  RCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  158



>ref|XP_009365002.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X1 [Pyrus x bretschneideri]
Length=168

 Score =   164 bits (416),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 115/171 (67%), Gaps = 19/171 (11%)
 Frame = -1

Query  692  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA----  525
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA   +++    
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAAATSSSSAA  61

Query  524  IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVN  345
            I     EK PR      + E   P  ++     +AR ++T             P +R VN
Sbjct  62   ILKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVN  107

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCSGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  108  RCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  158



>gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Glycine soja]
Length=136

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 100/166 (60%), Gaps = 40/166 (24%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT KEET+FKV PETITLCVNNCGVTGNPATNNMCQKCF+A+TA             
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTASTAT------------  47

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                                       T   G   +             AKR VNRCSGC
Sbjct  48   ---------------------------TSGAGGAGIASPATRSGTTPSEAKRVVNRCSGC  80

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCGELFC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  81   RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  126



>ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
5-like [Glycine max]
 gb|ADK25058.1| AN1-like transcription factor [Glycine max]
Length=164

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 108/166 (65%), Gaps = 12/166 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT KEET+FKV PETITLCVNNCGVTGNPATNNMCQKCF+A T +    S A     
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTAFTTSTATTSGAGGAGI  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                 R G      +R+ P+         +  + T              AKR VNRCSGC
Sbjct  60   ASPATRSGISARPLKRSFPEEPSPPADPPSSDQTT-----------PSEAKRVVNRCSGC  108

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCGELFC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  109  RRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  154



>ref|XP_007218519.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
 gb|EMJ19718.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
Length=165

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 112/169 (66%), Gaps = 18/169 (11%)
 Frame = -1

Query  692  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsa--AIH  519
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A++A     S+     
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSSAVTL  61

Query  518  HKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
               GEK PR      S E  +   +R     +AR +++               +R VNRC
Sbjct  62   KFSGEKSPRSS--SFSFEAPAEITRRTTASEIARSDESAN-------------RRVVNRC  106

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  107  SGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>ref|XP_011093526.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Sesamum indicum]
Length=177

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 107/183 (58%), Gaps = 33/183 (18%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKVVPETITLCV  CGV GN ATNN+CQ C+S   AA+           
Sbjct  1    MAQRTEKEETEFKVVPETITLCVK-CGVAGNSATNNLCQTCYSTPAAASTSAVGTPAASA  59

Query  509  GEKXPRXGF-----------------RRLSPERTSPDXKRREDXTVARGEKTVeeeeeee  381
            G   P+                    R L+   TS D K+    T               
Sbjct  60   GGPKPKNHVFVGKSFRSSSSTRSSLERSLNMSETSGDLKKEASETA--------------  105

Query  380  ENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIAR  201
             + +PP KREVNRCSGCRRKVGLTGFRCRCGELFC + RYSDR DCSYDYK  GR+AIAR
Sbjct  106  -DVAPPVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIAR  164

Query  200  ENP  192
            ENP
Sbjct  165  ENP  167



>gb|KDP43451.1| hypothetical protein JCGZ_16738 [Jatropha curcas]
Length=185

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 114/176 (65%), Gaps = 11/176 (6%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT KEETEFKV PET+TLCVNNCG TGNPATNNMCQKCF+ATT+ +   +       
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATTSTSNSATVTAAVPA  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXT----------VARGEKTVeeeeeeeENRSPPA  360
                        +   +  +  R+   +          + +  + V+   + E++ +  A
Sbjct  60   NTTSTTTTTSSAAVVSSGSEILRKSPRSSLSRSPIRDPLRQTNQKVQTSTDREKSDAAVA  119

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +REVNRCSGCRRKVGLTGFRCRCGELFC E RYSDR DCSYDYKA GR+AI RENP
Sbjct  120  RREVNRCSGCRRKVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKAAGREAITRENP  175



>ref|XP_011025412.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
 ref|XP_011007335.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=179

 Score =   162 bits (410),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 110/186 (59%), Gaps = 37/186 (20%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF------------------  564
            MAQ+  KEETEFKV PET+T C+NNCGVTGNPATNNMCQKCF                  
Sbjct  1    MAQRAEKEETEFKV-PETLTSCINNCGVTGNPATNNMCQKCFNATTSTSNSSSSSTATSM  59

Query  563  sattaaaglxsaAIHHKXGEKXPRXGFRR--LSPERTSPDXKRREDXTVARGEKTVeeee  390
            +    A  + +  I    GEK  R    R  +   + SP+    ++ + A          
Sbjct  60   TFAATATSVSNNEILKFTGEKSARSSISRSLVKDPQKSPEKASDKERSCA----------  109

Query  389  eeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDA  210
                  S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+A
Sbjct  110  ------SHVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTAGREA  163

Query  209  IARENP  192
            IARENP
Sbjct  164  IARENP  169



>ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
 gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
Length=192

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 114/183 (62%), Gaps = 18/183 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKV PET+TLC+NNCGVTGNPATNNMCQKCF+ATTA     S++     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCINNCGVTGNPATNNMCQKCFNATTATPSSSSSSSSSAT  59

Query  509  GEKX-----------PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRS--  369
                           P+    + S    S   + R D +      TV        NRS  
Sbjct  60   SPSATGGAIAGGASIPKFSDDQSSRSTPSRSQQNRSDSSPPTTAATVTNSRTTAWNRSGN  119

Query  368  -PPA---KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIAR  201
             P A   K+ VNRCSGCR++VGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+AIAR
Sbjct  120  DPAAAAEKKVVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKTAGREAIAR  179

Query  200  ENP  192
            ENP
Sbjct  180  ENP  182



>ref|XP_009354712.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Pyrus x bretschneideri]
Length=165

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 114/170 (67%), Gaps = 19/170 (11%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA----I  522
            MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+A +AAA   S++    I
Sbjct  1    MAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAI  59

Query  521  HHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
                 EK PR      S E  +   ++     +AR +++             P +R VNR
Sbjct  60   LKFSAEKSPRST-SSFSFEAQAETFRKTTALEIARSDES-------------PNRRVVNR  105

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CSGCRRKVGLTGFRCRCG+LFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  106  CSGCRRKVGLTGFRCRCGDLFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>ref|XP_008375146.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=165

 Score =   161 bits (408),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 112/170 (66%), Gaps = 19/170 (11%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFs----attaaaglxsaAI  522
            MAQ+  KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKCF+    A T ++   SAAI
Sbjct  1    MAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAI  59

Query  521  HHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
                 EK PR      S E      ++     +AR +++             P +R VNR
Sbjct  60   LKFSAEKSPRST-SSFSFEAPVETFRKTTASEIARSDES-------------PNRRVVNR  105

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CSGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  106  CSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>ref|XP_009631181.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=156

 Score =   161 bits (407),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 109/168 (65%), Gaps = 24/168 (14%)
 Frame = -1

Query  689  MAQKTGKEETEF-KVVPE-TITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ+T KEETE+ KVV E T+TLCV +CGV GNPATNNMCQ CF+A+++          H
Sbjct  1    MAQRTEKEETEYNKVVREKTLTLCVKSCGVIGNPATNNMCQNCFNASSSKVAYP-----H  55

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
            K         F  +    TS D K+  D  V   +K         +    PAK EVNRCS
Sbjct  56   K---------FANILTRSTSSDLKKYVDRAVKDDDKA--------KESVSPAKSEVNRCS  98

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GCRRK+GLTGFRCRCGELFCGE RYSDR DCSYDY+  GR+AIAR+NP
Sbjct  99   GCRRKLGLTGFRCRCGELFCGEHRYSDRHDCSYDYRTAGREAIARQNP  146



>ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Fragaria vesca subsp. vesca]
Length=170

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 109/174 (63%), Gaps = 22/174 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA-----  525
            MAQ+T KEETEFKV P+T+T CVNNCGVTGNPATNNMCQKCF+ATT+     + A     
Sbjct  1    MAQRTEKEETEFKV-PDTLTHCVNNCGVTGNPATNNMCQKCFNATTSTPTTVATATTSST  59

Query  524  ---IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKR  354
               +    GEK PR    R     +    K        R E++               +R
Sbjct  60   TAAVFKFSGEKVPRSSSFRFDAPPSETIRKAAASAESTRSEES-------------SMRR  106

Query  353  EVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             VNRCSGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  107  VVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  160



>ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=172

 Score =   161 bits (408),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 106/170 (62%), Gaps = 12/170 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF----sattaaaglxsaAI  522
            MAQKT KEETEFKV PET+ LCVNNCG TGNPATNNMCQKCF    SA  AAA     + 
Sbjct  1    MAQKTEKEETEFKV-PETLALCVNNCGFTGNPATNNMCQKCFSASASAAAAAAAGALKSS  59

Query  521  HHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
            H   G           SPER     +   D       +T +             KREVNR
Sbjct  60   HKVSGGAADARSSSARSPERMDSLAETSLD-------RTKDAASAAAVEEVGKVKREVNR  112

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CSGCRRKVGLTGFRCRCG+LFC E RY+DR +CSYDYK  GR+AIARENP
Sbjct  113  CSGCRRKVGLTGFRCRCGDLFCAEHRYTDRHECSYDYKTAGREAIARENP  162



>ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Citrus sinensis]
 gb|KDO36542.1| hypothetical protein CISIN_1g030404mg [Citrus sinensis]
Length=178

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 109/169 (64%), Gaps = 4/169 (2%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT KEETEFKV PET+TLCVNNCG TGNPATNNMCQKCF+AT        A      
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGG  59

Query  509  GEKXPR-XGFRRLSPERT--SPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
            G          + S E++  S    R      A      +E  +  E  +   KR VNRC
Sbjct  60   GGGGGSGVAIIKFSSEKSLRSRPIIRSGSSDAAGTTGQNQELTDRREKEANVEKRVVNRC  119

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCRRKVGLTGFRCRCGELFCGE RYSDR DCSYDYK+ GRDAIARENP
Sbjct  120  SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENP  168



>ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
 gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
Length=179

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 111/173 (64%), Gaps = 11/173 (6%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT KEETEFKV PET+TLCVNNCG TGNPATNNMCQKCF+AT        A      
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTSG  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEK----TVeeeeeeeENRSPPA---KRE  351
            G          ++  + S +   R    +  G      T  + +E  + R   A   KR 
Sbjct  60   GGGGGG---SGVAIIKFSSEKSLRSRPIIRSGSSDAAGTTGQNQELTDRREKEANVEKRV  116

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRCSGCRRKVGLTGFRCRCGELFCGE RYSDR DCSYDYK+ GRDAIARENP
Sbjct  117  VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENP  169



>ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis melo]
Length=169

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 110/166 (66%), Gaps = 7/166 (4%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETE KV PETITLCVNNCG TGNP TNNMCQKCF+ATTA A   + +  +  
Sbjct  1    MAQRTEKEETELKV-PETITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTG  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                     R+LS E+ S   + R    +            +       AKR+VNRCSGC
Sbjct  60   ISSS-----RKLSGEK-SLRSRSRSPVLMDSVRDNSRNMSMDRFKSEESAKRQVNRCSGC  113

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCGELFC E RYSDR DCS+DYKA GRDAIARENP
Sbjct  114  RKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGRDAIARENP  159



>ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87982.1| zinc finger family protein [Populus trichocarpa]
Length=179

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 109/186 (59%), Gaps = 37/186 (20%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF------------------  564
            MAQ+  KEETEFKV PET+T C+NNCGVTGNPATNNMCQKCF                  
Sbjct  1    MAQRAEKEETEFKV-PETLTSCINNCGVTGNPATNNMCQKCFNASTSTSNSSSSSTATSM  59

Query  563  sattaaaglxsaAIHHKXGEKXPRXGFRR--LSPERTSPDXKRREDXTVARGEKTVeeee  390
            +    A  + +  I    GEK  R    R  +   + SP+    ++ + A          
Sbjct  60   TFAATATSVSNNEILKFTGEKSARSSISRSLVKDPQKSPETASDKERSCAYH--------  111

Query  389  eeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDA  210
                     AK+EVNRCSGCRR+VGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+A
Sbjct  112  --------VAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTAGREA  163

Query  209  IARENP  192
            IARENP
Sbjct  164  IARENP  169



>ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK94884.1| unknown [Populus trichocarpa]
 gb|EEE83247.1| zinc finger family protein [Populus trichocarpa]
Length=181

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 114/181 (63%), Gaps = 25/181 (14%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA-----  525
            MAQ+T KEETE KV PE +TLC+NNCGVTGNPATNNMCQKCF+A+T+ +   S+      
Sbjct  1    MAQRTEKEETECKV-PENLTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSSTTTTTT  59

Query  524  ----------IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeEN  375
                      +      K       R S  R+     +R+  T +  E++         +
Sbjct  60   TITFAATTNGVSTNEILKFTSEKSLRSSISRSPAKDHQRQPKTASDKERS---------D  110

Query  374  RSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIAREN  195
             S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+AIAREN
Sbjct  111  SSSVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIAREN  170

Query  194  P  192
            P
Sbjct  171  P  171



>gb|KJB25036.1| hypothetical protein B456_004G173900 [Gossypium raimondii]
Length=180

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 111/172 (65%), Gaps = 8/172 (5%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPATNNMCQKCFSATTAA    S++ ++  
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSTNNTA  59

Query  509  GEKXPRXGFRRLSPERTS---PDXKRREDXTVARGEKTVeeeeeeeENRS---PPAKREV  348
                      R +P R+     D                        NRS      K+ V
Sbjct  60   TSATDDKS-SRSTPTRSQDNRSDSAPPTTAATTATATATTNSPMTASNRSGYDTAEKKSV  118

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCSGCR++VGLTGFRCRCGELFC + RYSDR DCSYDYKA GR+AIARENP
Sbjct  119  NRCSGCRKRVGLTGFRCRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENP  170



>ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
Length=301

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 109/166 (66%), Gaps = 12/166 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT  EETEFKV PETITLCVNNCGVTGNPATNNMCQ CF+A TA+    S+A     
Sbjct  138  MAQKTENEETEFKV-PETITLCVNNCGVTGNPATNNMCQNCFTAFTASTATTSSAASAGI  196

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                 R        +R+ P+              +  +    ++N    AKR VNRCSGC
Sbjct  197  SSPSARSVASARPQKRSFPEEP-----------SSAADPPSSDQNAPSEAKRVVNRCSGC  245

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCG+LFC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  246  RRKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP  291



>ref|XP_010547246.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=179

 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 109/190 (57%), Gaps = 45/190 (24%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA-----  525
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPATNNMCQKCF+ATTA++   S +     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFNATTASSSSSSVSSIAGA  59

Query  524  ---------------IHHKXGEKXPRXGFRR----LSPERTSPDXKRREDXTVARGEKTV  402
                           I  K           +    LSP +      R  D T        
Sbjct  60   NNVVKEGGVGVGGGPISKKTARSSALRSLSKDRSDLSPVKVIIGRNRESDVT--------  111

Query  401  eeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAX  222
                          ++ VNRCSGCRRKVGLTGFRCRCGELFC E RYSDR DCSYDYKA 
Sbjct  112  ------------EVEKIVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAV  159

Query  221  GRDAIARENP  192
            GR+ IARENP
Sbjct  160  GRETIARENP  169



>ref|XP_008349960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
 ref|XP_008349986.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=169

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 115/172 (67%), Gaps = 20/172 (12%)
 Frame = -1

Query  692  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA----  525
            +MAQ+T KEETEFKV PET+T CVNNCGVTGNP+TNNMCQKC +A +AAA   +++    
Sbjct  3    KMAQRTEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCXNAASAAAAAATSSSSSA  61

Query  524  -IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV  348
             I     EK PR      S E  +   ++     +AR ++T             P +R V
Sbjct  62   AILKFSAEKSPRSS-SSFSFEAAAETCRKTTASEIARSDET-------------PNRRVV  107

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCSGCRRKVGLTGFRCRCGELFC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  108  NRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  159



>ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004173024.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus]
Length=169

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 112/166 (67%), Gaps = 7/166 (4%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETE KV PETITLCVNNCG TGNP TNNMCQKCF+ATTA A   + +  +  
Sbjct  1    MAQRTEKEETELKV-PETITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTG  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                     R+LS E++S   + R    +     +      +       AKR+VNRCSGC
Sbjct  60   ISSS-----RKLSGEKSSR-SRSRSPVLMDSVRDSSRNISMDRFKSEESAKRQVNRCSGC  113

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCGELFC E RYSDR DCS+DYKA GRDAIARENP
Sbjct  114  RKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGRDAIARENP  159



>gb|KJB22229.1| hypothetical protein B456_004G036200 [Gossypium raimondii]
Length=173

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 105/166 (63%), Gaps = 3/166 (2%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKV PET+TLCVN+CGV GNPATNNMCQ CF+ATT  +     +     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNDCGVIGNPATNNMCQNCFNATTPKSTAAVVSSSTGG  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                      + S   TS    +R D +  +    V       +      K+ VNRCSGC
Sbjct  60   ASSGGVSILNQRST--TSRSINKRSDLSPPKTTTFVRSSGSRYDPEPGTEKKVVNRCSGC  117

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCGELFC + RYSDR DCSYDYK  GR+AIARENP
Sbjct  118  RKRVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIARENP  163



>ref|XP_010557789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=175

 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 109/172 (63%), Gaps = 13/172 (8%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETE KV P+T+TLCVNNCGVTGNPATNNMCQKCF+ATTA+A     +     
Sbjct  1    MAQRTEKEETEVKV-PDTLTLCVNNCGVTGNPATNNMCQKCFNATTASAVSSPPSAAAAN  59

Query  509  GEKXPRX--GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPA----KREV  348
                     G     P R S   +   D +     K +        NR   A    K+ V
Sbjct  60   NNNNSVKDGGLIAKKPARCSA-LRSSSDRSGLSAAKVIISR-----NRGNDAVEEEKKIV  113

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCSGCRRKVGLTGFRCRCGELFC E RYS R DCSYDYKA GR+AIARENP
Sbjct  114  NRCSGCRRKVGLTGFRCRCGELFCAEHRYSARHDCSYDYKAAGREAIARENP  165



>ref|XP_010279007.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=164

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 108/166 (65%), Gaps = 12/166 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEETEFKV PET+TLC+NNCG  GNP TNNMCQ CF A+         +     
Sbjct  1    MAQRE-KEETEFKV-PETLTLCINNCGFPGNPTTNNMCQNCFKASAGVLTPLKFS-----  53

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
            G+  PR    R SPER+    + R    V + + T       E   +   KREVNRCSGC
Sbjct  54   GKDKPRSSSVR-SPERSDRPAETRIFKEVTKRDTT----AASEAASAAVVKREVNRCSGC  108

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCGELFC E RYSDR +CS+DYKA GR+AIARENP
Sbjct  109  RRKVGLTGFRCRCGELFCSEHRYSDRHECSFDYKAAGREAIARENP  154



>gb|AIJ00004.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Gossypium hirsutum]
Length=180

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 111/171 (65%), Gaps = 6/171 (4%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPATNNMCQKCFSATTAA    S++     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSSSTNN  59

Query  509  GEKXPRXG-FRRLSPERTSPD-XKRREDXTVARGEKTVeeeeeeeENRS---PPAKREVN  345
                       R +P R+  +        T A              NRS      K+ VN
Sbjct  60   TATSATDDKSSRSTPTRSQDNRSDSAPPTTAATTATATTNSPMTASNRSGYDTAEKKSVN  119

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCSGCR++VGLTGFRCRCGELFC + RYSDR DCSYDYKA GR+AIARENP
Sbjct  120  RCSGCRKRVGLTGFRCRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENP  170



>ref|XP_010257261.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=163

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 109/166 (66%), Gaps = 13/166 (8%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEETEFKV PET+TLC+NNCG  GNP TNNMCQ CF A+         +     
Sbjct  1    MAQRE-KEETEFKV-PETLTLCINNCGFPGNPTTNNMCQNCFKASAGVLTPLKFS-----  53

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
            G+  PR    R SPER+     R  +  + R E T  +     E  S   +REVNRCSGC
Sbjct  54   GKDKPRSSSVR-SPERSD----RPAEPEILR-EVTKRDTTAAAEVTSSVVRREVNRCSGC  107

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RRKVGLTGFRCRCG+LFC E RYSDR +CSYDYKA GR+AI+RENP
Sbjct  108  RRKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKAAGREAISRENP  153



>ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=165

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 109/172 (63%), Gaps = 23/172 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVT--GNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ+T  EETEFKV PETIT+C+NNCGVT  GN ATNNMCQ CF+A+TA           
Sbjct  1    MAQRTENEETEFKV-PETITVCINNCGVTVTGNAATNNMCQNCFTASTATTSSTVGI---  56

Query  515  KXGEKXPRXGFRRL----SPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV  348
                +  R G   +    SP+R+ P+         +  + T+             AKR V
Sbjct  57   --SSQSSRSGVISVNSVRSPKRSLPEESSEITDRNSSDQTTI-----------SEAKRVV  103

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +RCSGCRRKVGLTGFRCRCG+LFC E RYSDR DCS+DYKA GR+AIARENP
Sbjct  104  SRCSGCRRKVGLTGFRCRCGDLFCSEHRYSDRHDCSFDYKAAGREAIARENP  155



>ref|XP_010067883.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Eucalyptus grandis]
 gb|KCW66121.1| hypothetical protein EUGRSUZ_G03392 [Eucalyptus grandis]
Length=190

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 113/190 (59%), Gaps = 34/190 (18%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsa------  528
            MAQ+T KEETEFKV PE +TLCVNNCG  GNPATNNMCQKCF+A+++++   +       
Sbjct  1    MAQRTEKEETEFKV-PEALTLCVNNCGFAGNPATNNMCQKCFNASSSSSSSSTTTSTTAS  59

Query  527  ------------------AIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTV  402
                              ++     E+  R G    SP+R+          T A    + 
Sbjct  60   TASSAPTTSSSAGLTGGPSVLKFSAERIHRSGPFSRSPDRSGLAMGMIRRDTGASPPSST  119

Query  401  eeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAX  222
                      S  A+REVNRCSGCR++VGLTGFRCRCGELFC E RYSDR DCSYDYKA 
Sbjct  120  ---------ESNSARREVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAA  170

Query  221  GRDAIARENP  192
            GR+AIARENP
Sbjct  171  GREAIARENP  180



>gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata]
Length=179

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 109/178 (61%), Gaps = 21/178 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKTG EETEFKVVPE+I LCV  CGV GN A NN+CQKCFS+TTA A   + A     
Sbjct  1    MAQKTGNEETEFKVVPESIALCVK-CGVPGNSAANNLCQKCFSSTTAEASTSAVAAAPAS  59

Query  509  ------------GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSP  366
                        GEK  R      S      +       TV   EK          + +P
Sbjct  60   SSGGAKPKSLVFGEKSFRSRSSTRSSPERRLNLP----VTVLDLEKN----PSAVADAAP  111

Query  365  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            PAKREVNRC+GCRRKVGLTGFRCRCGELFC + RYSDR DCSYDYK  GR+AIARENP
Sbjct  112  PAKREVNRCTGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARENP  169



>gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata]
Length=178

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 112/183 (61%), Gaps = 32/183 (17%)
 Frame = -1

Query  689  MAQKTGKEETEF-KVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsa-----  528
            MAQKT KEETE+ KVVPETI+LCV  CGV GN ATNN+C  CF++T  AA   +A     
Sbjct  1    MAQKTEKEETEYSKVVPETISLCVK-CGVAGNCATNNLCHTCFNSTAPAAAAAAAAAAGG  59

Query  527  ----AIHHKXGEKXPRXGF-------RRLSPERTSPDXKRREDXTVARGEKTVeeeeeee  381
                A  H   EK  R          +R+ P  TS D ++ +D   A             
Sbjct  60   DKLPAASHVFVEKSFRSSSSVRLLPEKRIIPAETSRDLRKLDDSPAAEA-----------  108

Query  380  ENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIAR  201
               + P KREVNRCSGCRRKVGLTGFRCRCG+LFC + RYSDR DCSYDYK+ GR+AI R
Sbjct  109  ---ALPLKREVNRCSGCRRKVGLTGFRCRCGDLFCADHRYSDRHDCSYDYKSAGREAIER  165

Query  200  ENP  192
            ENP
Sbjct  166  ENP  168



>ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
 gb|ESQ48766.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
Length=158

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 108/172 (63%), Gaps = 30/172 (17%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETIT------LCVNNCGVTGNPATNNMCQKCFsattaaaglxsa  528
            MAQ+T KEETE KV+    T      LC NNCGVT NPATNNMCQKCF+A+ AAAG+ S 
Sbjct  1    MAQRTEKEETEVKVLESLATTTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVESG  60

Query  527  AIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV  348
            ++     ++  R    R +P +     + RE   V R ++T                  V
Sbjct  61   SML----KRSARSVNLRSTPAKVV--IRSREIDPVKRDQQT------------------V  96

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCSGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENP  148



>emb|CDY52666.1| BnaC01g38560D [Brassica napus]
Length=155

 Score =   144 bits (362),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 108/169 (64%), Gaps = 27/169 (16%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITL---CVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIH  519
            MAQ+T KEETEFKV+    T    C NNCGVT NPATNNMCQKCF+A+ AAAG+ S +I 
Sbjct  1    MAQRTEKEETEFKVLETLTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVDSTSIL  60

Query  518  HKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
                ++  R    R +P +     + RE   V R ++T                  +NRC
Sbjct  61   ----KRSARSVNLRSTPAKVV--IRPREIDPVKRDQQT------------------INRC  96

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  97   SGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENP  145



>ref|XP_009120462.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Brassica rapa]
 emb|CDY50536.1| BnaA01g30440D [Brassica napus]
Length=156

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 108/170 (64%), Gaps = 28/170 (16%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITL----CVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI  522
            MAQ+T KEETEFKV+    T     C NNCGVT NPATNNMCQKCF+A+ AAAG+ S +I
Sbjct  1    MAQRTEKEETEFKVLETLTTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVDSTSI  60

Query  521  HHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
                 ++  R    R +P +     + RE   V R ++T                  +NR
Sbjct  61   L----KRSARSVNLRSTPAKVV--IRPREIDPVKRDQQT------------------INR  96

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CSGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  97   CSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENP  146



>gb|KFK38611.1| hypothetical protein AALP_AA3G136800 [Arabis alpina]
Length=160

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 102/174 (59%), Gaps = 32/174 (18%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCV-------NNCGVTGNPATNNMCQKCFsattaaaglxs  531
            MAQ+T KEETEFKV+    +          NNCGVT NPATNNMCQKCF+A+ A A   S
Sbjct  1    MAQRTEKEETEFKVLETLSSSTATTTTLCSNNCGVTANPATNNMCQKCFNASIAVASADS  60

Query  530  aAIHHKXGEKXPRXGFRRLSPERTSPDXKRRE-DXTVARGEKTVeeeeeeeENRSPPAKR  354
             +I  +            L   +T    + RE D +V R ++                  
Sbjct  61   GSILKRSARSV------NLRSSQTKVVIRNREIDSSVKRDQQI-----------------  97

Query  353  EVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             VNRCSGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  98   -VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  150



>emb|CDY67538.1| BnaUnng02260D [Brassica napus]
Length=159

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 104/173 (60%), Gaps = 31/173 (18%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETIT-------LCVNNCGVTGNPATNNMCQKCFsattaaaglxs  531
            MAQ+T KEETEFKV+    T       LC NNCGVT NPATNNMCQKCF+A+ AAAG+ S
Sbjct  1    MAQRTEKEETEFKVLESLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  530  aAIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
             +   +            L P       + RE   V R ++T                  
Sbjct  61   GSTLKRASRSV------NLRPTPAKVVIRPREIDPVKRDQQT------------------  96

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRCSGCR+KVGLTGFRCRCG+LFC E RYSDR +CSYDYK  GR+AIARENP
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIARENP  149



>ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
 gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
Length=163

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 101/173 (58%), Gaps = 27/173 (16%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCV------NNCGVTGNPATNNMCQKCFsattaaaglxsa  528
            MAQ+T KEETEFKV+    T         NNCGVT NPATNNMCQKCF+A+  +A     
Sbjct  1    MAQRTEKEETEFKVLETLTTTTAATLLCTNNCGVTANPATNNMCQKCFNASLVSAATSGV  60

Query  527  AIHH-KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
             +      ++  R    R SP +     + RE   V R ++                   
Sbjct  61   VVDTGSILKRSARSVNLRSSPAKVV--IRPREMDAVKRDQQV------------------  100

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRCSGCR+KVGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  101  VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP  153



>ref|XP_009146604.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 107/173 (62%), Gaps = 31/173 (18%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITL-------CVNNCGVTGNPATNNMCQKCFsattaaaglxs  531
            MAQ+T KEETEFKV+    T        C NNCGVT NPATNNMCQKCF+A+ AAAG+ S
Sbjct  1    MAQRTEKEETEFKVLETLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  530  aAIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
             +      ++  R    R SP +     + RE   V R ++T                  
Sbjct  61   GST----SKRASRSVNLRPSPAKVV--IRPREIDPVKRDQQT------------------  96

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRCSGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  149



>gb|ACR56825.1| At3g12630-like protein, partial [Solanum quitoense]
 gb|ACR56826.1| At3g12630-like protein, partial [Solanum quitoense]
Length=150

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 99/153 (65%), Gaps = 17/153 (11%)
 Frame = -1

Query  623  VNNCGVTGNPATNNMCQKCFsattaaaglxs-------aAIHHKXGEKXPRX-GFRRLSP  468
             +NCG TGNPATNNMCQKCF+ATTAA    S         I  K  EK  R     R S 
Sbjct  2    AHNCGFTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSL  61

Query  467  ERTSP-DXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRC  291
             R+S  D K+  D TV   ++         +   PPAKREV+RCSGCRRKVGLTGFRCRC
Sbjct  62   LRSSSQDLKKVGDRTVKEEDQL--------KESLPPAKREVSRCSGCRRKVGLTGFRCRC  113

Query  290  GELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GELFCGE RYSDR DCSYDYK  GR+AIARENP
Sbjct  114  GELFCGEHRYSDRHDCSYDYKTAGREAIARENP  146



>gb|ACR56827.1| At3g12630-like protein, partial [Solanum hirtum]
Length=151

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 98/152 (64%), Gaps = 17/152 (11%)
 Frame = -1

Query  620  NNCGVTGNPATNNMCQKCFsattaaaglxs-------aAIHHKXGEKXPRX-GFRRLSPE  465
            +NCGVTGNPATNNMCQKCF+ATTAA    S         I  K  EK  R     R S  
Sbjct  4    HNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLL  63

Query  464  RTSP-DXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCG  288
            R+S  D K+  D T    ++         +   PPAKREVNRCSGCRRKVGLTGFRCRCG
Sbjct  64   RSSSQDLKKVGDRTXKEEDQL--------KESLPPAKREVNRCSGCRRKVGLTGFRCRCG  115

Query  287  ELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            ELFCGE RYSDR DC YDYK  GR+AIARENP
Sbjct  116  ELFCGEHRYSDRHDCXYDYKTAGREAIARENP  147



>gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum]
Length=147

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 97/151 (64%), Gaps = 17/151 (11%)
 Frame = -1

Query  617  NCGVTGNPATNNMCQKCFs-------attaaaglxsaAIHHKXGEKXPRX-GFRRLSPER  462
            NCGVTGNPATNNMCQKCF+        ++++    +  I  K  EK  R     R S  R
Sbjct  1    NCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLLR  60

Query  461  TSP-DXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
            +S  D K+  D  V   ++         +   PPAKREVNRCSGCRRKVGLTGFRCRCGE
Sbjct  61   SSSQDLKKVGDRKVKEEDQL--------KESLPPAKREVNRCSGCRRKVGLTGFRCRCGE  112

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LFCGE RYSDR DC+YDYK  GR+AIARENP
Sbjct  113  LFCGEHRYSDRHDCNYDYKTAGREAIARENP  143



>ref|XP_003599112.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES69363.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
 gb|AFK37674.1| unknown [Medicago truncatula]
Length=163

 Score =   140 bits (354),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 94/173 (54%), Gaps = 27/173 (16%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPET-------ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxs  531
            MAQ+T  EETEFKVV ET       I LC+ NCGV GNP+TNNMCQ CF+A+T      S
Sbjct  1    MAQRTENEETEFKVVSETLQQTTTIINLCIKNCGVVGNPSTNNMCQNCFTASTTILPPSS  60

Query  530  aAIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
            +                      T  D            EKTV              KR 
Sbjct  61   SRSVRSPKRSRQESSSSSEEEGSTDHD---------LVDEKTV-----------SEVKRV  100

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            V+RCSGCRRKVGL GFRCRCGELFC + RYSDR DC YDYK  GR+ IARENP
Sbjct  101  VSRCSGCRRKVGLAGFRCRCGELFCADHRYSDRHDCGYDYKKVGREEIARENP  153



>emb|CDY08419.1| BnaA05g26550D [Brassica napus]
Length=159

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 107/173 (62%), Gaps = 31/173 (18%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITL-------CVNNCGVTGNPATNNMCQKCFsattaaaglxs  531
            MAQ+T KEETEFKV+    T        C NNCGVT NPATNNMCQKCF+A+ AAAG+ S
Sbjct  1    MAQRTEKEETEFKVLETLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  530  aAIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
             +      ++  R    R SP +     + RE   V R ++T                  
Sbjct  61   GST----SKRASRSVNLRPSPAKVV--IRPREIDPVKRDQQT------------------  96

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRCSGCR+KVGLTGFRCRCG+LFC E RYSDR +CSYDYK  GR+AIARENP
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIARENP  149



>ref|XP_010499267.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Camelina sativa]
Length=166

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 101/176 (57%), Gaps = 30/176 (17%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPATNNMCQKCFsattaaag  540
            MAQ+T KEETEFKV+    T             NNCGVT NPATNNMCQKCF+A+  + G
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNMCQKCFNASLVSTG  60

Query  539  lxsaAIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPA  360
            +          ++  R    R SP +     + RE   V R ++                
Sbjct  61   VVVVDSGSSVLKRPARSVNLRSSPAKVV--IRPREIDAVKRDQQI---------------  103

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
               VNRCSGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  104  ---VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  156



>emb|CDX73811.1| BnaA03g32360D [Brassica napus]
Length=159

 Score =   138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 102/172 (59%), Gaps = 30/172 (17%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITL------CVNNCGVTGNPATNNMCQKCFsattaaaglxsa  528
            MAQ+T KEETEFKVV ET+        C NNCGVT +P+TNNMCQKCF+A+ +       
Sbjct  1    MAQRTEKEETEFKVVLETLPTTTTPTLCSNNCGVTASPSTNNMCQKCFNASVSGIDPTPI  60

Query  527  AIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV  348
                   ++  R    R +P R     + RE   V R                   ++ V
Sbjct  61   V------KRSARSVSLRSTPARAV--IRPRETDPVKRDHH----------------QQTV  96

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCSGCR+KVGLTGFRCRCG+LFC E RYSDR +CSYDYK  GR+AIARENP
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIARENP  148



>ref|XP_009135242.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   138 bits (347),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 102/172 (59%), Gaps = 30/172 (17%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITL------CVNNCGVTGNPATNNMCQKCFsattaaaglxsa  528
            MAQ+T KEETEFKVV ET+        C NNCGVT +P+TNNMCQKCF+A+ +       
Sbjct  1    MAQRTEKEETEFKVVLETLPTTTTPTLCSNNCGVTASPSTNNMCQKCFNASVSGIDPTPI  60

Query  527  AIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV  348
                   ++  R    R +P R     + RE   V R                   ++ +
Sbjct  61   V------KRSARSVSLRSTPARAV--IRPRETDPVKRDHH----------------QQTI  96

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCSGCR+KVGLTGFRCRCG+LFC E RYSDR +CSYDYK  GR+AIARENP
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHECSYDYKTAGREAIARENP  148



>ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Elaeis guineensis]
Length=158

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 96/166 (58%), Gaps = 18/166 (11%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+    E E +V PET TLCVNNCG  GNPATNNMCQ CF A   A+           
Sbjct  1    MAQR----EKELQV-PETRTLCVNNCGFYGNPATNNMCQACFQAAGFASSSSP---PSCS  52

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
            G + PR    RL          R E                    R  PA R+VNRC+GC
Sbjct  53   GHEKPRSAPFRLPDPAAEGGRGRVEGPAAKAVAAAT---------RLAPA-RQVNRCAGC  102

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCGELFC E RYSDR DCS+DYKA GR+AIARENP
Sbjct  103  RKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGREAIARENP  148



>emb|CDY00788.1| BnaC03g37720D [Brassica napus]
Length=155

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 99/171 (58%), Gaps = 32/171 (19%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITL-----CVNNCGVTGNPATNNMCQKCFsattaaaglxsaA  525
            MAQ+T KEETEFKV+    T      C NNCGVT +P+TNNMCQKCF+A           
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTLCSNNCGVTASPSTNNMCQKCFNAGIDPT------  54

Query  524  IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVN  345
                  ++  R    R +P + +   + RE   V R                   ++ VN
Sbjct  55   ---PIAKRSARSVSLRSTPAKAA--IRPRETDPVKRDHH----------------QQTVN  93

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCSGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  94   RCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENP  144



>ref|XP_010928494.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Elaeis guineensis]
Length=161

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 93/166 (56%), Gaps = 15/166 (9%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+    E E +V PET+TLCVNNCG  GNPATNNMCQ CF A    +    +   H+ 
Sbjct  1    MAQR----EKELQV-PETLTLCVNNCGFYGNPATNNMCQACFQAAGFTSPSPPSRSGHEK  55

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                P            SPD         A       +           + R VNRC+GC
Sbjct  56   PSSTPTR----------SPDPAVEAGRGGAESPAAKTDAATAAAAVGVASARRVNRCAGC  105

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG LFC E RYSDR DCS+DYKA GR+AIARENP
Sbjct  106  RKRVGLTGFRCRCGNLFCVEHRYSDRHDCSFDYKAAGREAIARENP  151



>ref|XP_008795709.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
 ref|XP_008778992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
Length=157

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 95/166 (57%), Gaps = 19/166 (11%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+    E E +V PET+TLCVNNCG  GNPATNNMCQ CF A   A+    +   H+ 
Sbjct  1    MAQR----EKELQV-PETLTLCVNNCGFYGNPATNNMCQACFQAAGFASPSPPSRSSHEK  55

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                P    R L P                R        + +         R V+RC+GC
Sbjct  56   ASSAPA---RSLDPA-----------AEAGREGAEGPAGKADAAAAVVSPARRVSRCAGC  101

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG+LFC + RYSDR DCS+DYKA GR+AIARENP
Sbjct  102  RKRVGLTGFRCRCGKLFCAQHRYSDRHDCSFDYKAAGREAIARENP  147



>ref|XP_008776561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Phoenix dactylifera]
Length=160

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 101/168 (60%), Gaps = 20/168 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsat--taaaglxsaAIHH  516
            MAQ+    E E +V PET TLCVNNCG  GNPATNNMCQ CF A    A +   S + H 
Sbjct  1    MAQR----EKELQV-PETRTLCVNNCGFYGNPATNNMCQACFQAAGFAAPSSPPSCSSHE  55

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
            K           R +P R SPD         ARG     +        +  AKR VNRC+
Sbjct  56   KP----------RSAPAR-SPDPAAEGGWGEARGPPAKPDAAAAAAGVT-LAKR-VNRCA  102

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GCR++VGLTGFRCRCGELFC E RYSDR DCS+DYKA GR+AI RENP
Sbjct  103  GCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGREAITRENP  150



>ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 97/171 (57%), Gaps = 26/171 (15%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNC-----GVTGNPATNNMCQKCFsattaaaglxsaA  525
            MAQ+T KEETEFKV+    T           GVT NPATNNMCQKCF+A+  +A      
Sbjct  1    MAQRTEKEETEFKVLDTLTTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVE  60

Query  524  IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVN  345
                  ++  R    R SP +     + RE   V R ++ V                  N
Sbjct  61   -SGSILKRSARSVNLRSSPAKVV--IRTREIDAVKRDQQIV------------------N  99

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCSGCR+KVGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  100  RCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP  150



>ref|XP_010497315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=170

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 100/180 (56%), Gaps = 34/180 (19%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAT-NNMCQKCFsattaaa  543
            MAQ+T KEETEFKV+    T             NNCGVT NPAT NNMCQKCF+A+  +A
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNNMCQKCFNASLVSA  60

Query  542  glxsaAIHHKXGEKXPRXGFRRLSPERTSPDX---KRREDXTVARGEKTVeeeeeeeENR  372
                  +         R    R    R+SP     + RE   V R ++            
Sbjct  61   TTGVVVVDSGSSSVLKRSA--RSVNLRSSPAKVVIRPREIDAVKRDQQI-----------  107

Query  371  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
                   VNRCSGCR+KVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  108  -------VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  160



>ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana]
 sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 5; Short=AtSAP5 [Arabidopsis thaliana]
 gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana]
 dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61324.1| unknown [Arabidopsis thaliana]
 gb|AAP88348.1| At3g12630 [Arabidopsis thaliana]
 dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75226.1| E3 ligase SAP5 [Arabidopsis thaliana]
Length=160

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 99/170 (58%), Gaps = 24/170 (14%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNC----GVTGNPATNNMCQKCFsattaaaglxsaAI  522
            MAQ+T KEETEFKV+    T     C    GVT NPATNNMCQKCF+A+  +A       
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVE-  59

Query  521  HHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
                 ++  R    R SP +     + RE   V + ++ +                 VNR
Sbjct  60   SGSILKRSARSVNLRSSPAKVV--IRPREIDAVKKRDQQI-----------------VNR  100

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CSGCR+KVGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  101  CSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP  150



>gb|EAZ45178.1| hypothetical protein OsJ_29820 [Oryza sativa Japonica Group]
Length=164

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 91/166 (55%), Gaps = 12/166 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K++   ++    ITLC N+CG  GNPAT N+CQ CF A TA     S+      
Sbjct  1    MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATAFTSSPSSLSSPVL  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG LFCGE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  109  RKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  154



>ref|NP_001063521.1| Os09g0486500 [Oryza sativa Japonica Group]
 sp|A2Z2J6.1|SAP1_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Indica Group]
 sp|A3C039.2|SAP1_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Japonica Group]
 gb|AAF74344.1|AF140722_1 multiple stress-responsive zinc-finger protein [Oryza sativa 
Indica Group]
 gb|AAN15744.1| multiple stress-associated zinc-finger protein [Oryza sativa 
Indica Group]
 dbj|BAF25435.1| Os09g0486500 [Oryza sativa Japonica Group]
 gb|EAZ09557.1| hypothetical protein OsI_31835 [Oryza sativa Indica Group]
 gb|ABQ12733.1| Zn-finger protein [Oryza sativa Indica Group]
 gb|ABR26098.1| multiple stress-responsive zinc-finger protein isap1 [Oryza sativa 
Indica Group]
 dbj|BAG87708.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99795.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 92/166 (55%), Gaps = 12/166 (7%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K++   ++    ITLC N+CG  GNPAT N+CQ CF A TA+    S+      
Sbjct  1    MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG LFCGE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  109  RKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  154



>ref|XP_010465038.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=213

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 99/180 (55%), Gaps = 34/180 (19%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAT-NNMCQKCFsattaaa  543
            MAQ+T KEETEFKV+    T             NNCGVT NPAT NNMCQKCF+A+  +A
Sbjct  44   MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNNMCQKCFNASLVSA  103

Query  542  glxsaAIHHKXGEKXPRXGFRRLSPERTSPDX---KRREDXTVARGEKTVeeeeeeeENR  372
                  +         R    R    R+SP     + RE   V R ++            
Sbjct  104  TTGVVVVDSGSSSVLKRSA--RSVNLRSSPAKVVIRPREIDPVKRDQQI-----------  150

Query  371  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
                   VNRCSGCR+KVGLTGFRCRCGELFC E RYS R DCSYDYK  GR+AIARENP
Sbjct  151  -------VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSGRHDCSYDYKTAGREAIARENP  203



>gb|EAZ09556.1| hypothetical protein OsI_31833 [Oryza sativa Indica Group]
Length=164

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 94/168 (56%), Gaps = 16/168 (10%)
 Frame = -1

Query  689  MAQ--KTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ  K  +E TE +  PE ITLC N+CG  GNPAT N+CQ CF A TA+    S+    
Sbjct  1    MAQGDKKDQEPTELRA-PE-ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSP  58

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
               ++ PR     + P+   P         +A     V +               VNRCS
Sbjct  59   VLDKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCS  106

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR++VGLTGFRCRCG LFCGE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  107  RCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  154



>gb|EMT33843.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
11 [Aegilops tauschii]
Length=172

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 94/168 (56%), Gaps = 8/168 (5%)
 Frame = -1

Query  689  MAQKTGK--EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ+  K  E TE  +    ITLC N+CG  GNPAT N+CQ CF A++++    +A+   
Sbjct  1    MAQRDKKVEEPTEVHLHAAEITLCANSCGFPGNPATKNLCQNCFLASSSSPSPSAASPPS  60

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
                      F +L P   +    +     +A         + +       +K  VNRC 
Sbjct  61   PSSSPAAFPLFDKLRPAAVASPLLQAAPVYMAVDRPAAGPADPKA------SKSSVNRCH  114

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR++VGLTGFRCRCGE+FCG  RYSDR DCSYDYK+  RDAIARENP
Sbjct  115  NCRKRVGLTGFRCRCGEMFCGAHRYSDRHDCSYDYKSAARDAIARENP  162



>gb|AGQ04314.1| SAP1, partial [Oryza nivara]
 gb|AGQ04318.1| SAP1, partial [Oryza barthii]
 gb|AGQ04320.1| SAP1, partial [Oryza glaberrima]
 gb|AGQ04321.1| SAP1, partial [Oryza sativa Indica Group]
 gb|AGQ04322.1| SAP1, partial [Oryza sativa Japonica Group]
Length=147

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 83/148 (56%), Gaps = 12/148 (8%)
 Frame = -1

Query  635  ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTS  456
            ITLC N+CG  GNPAT N+CQ CF A TA+    S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  455  PDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  276
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPVEEMASALATAPAPVAKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  275  GEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  110  GEHRYSDRHGCSYDYKSAARDAIARDNP  137



>gb|AGQ04316.1| SAP1, partial [Oryza glumipatula]
Length=147

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 83/148 (56%), Gaps = 12/148 (8%)
 Frame = -1

Query  635  ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTS  456
            ITLC N+CG  GNPAT N+CQ CF A TA+    S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  455  PDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  276
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPVEEMASALATAPAPVAKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  275  GEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GE RYSDR  CSYDY++  RDAIAR+NP
Sbjct  110  GEHRYSDRHGCSYDYQSAARDAIARDNP  137



>ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 95/166 (57%), Gaps = 21/166 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEE +    PET+TLCVNNCG  GNPATNNMCQ CF A+T AA     +     
Sbjct  1    MAQRE-KEEAKLHA-PETLTLCVNNCGFPGNPATNNMCQSCFQASTIAASPAPHSC----  54

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                PR      SPER + +   R     A                     R+V+RC  C
Sbjct  55   ---SPRSALPIRSPERAAEERDARTSEAPAAAVSAPA------------PARQVSRCFSC  99

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG+LFCGE RYSDR DCSYDYKA  R AIAR NP
Sbjct  100  RKRVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKAAARAAIARANP  145



>gb|ADF80942.1| zinc finger protein [Phyllostachys praecox]
Length=165

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 92/171 (54%), Gaps = 21/171 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEE      PE ITLC N CG  GNPAT N+CQ CFSA +A+     +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANGCGFPGNPATQNLCQNCFSAASASTSSPPSPSSSSS  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPA-----KREVN  345
                       LSP    P     E  + A              +R+P       K  VN
Sbjct  60   SSS--SSSLPGLSPVVDKPRPAPVELASPA-------------VDRAPAVEVKAGKTSVN  104

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCS CR++VGLTGFRCRCGELFCGE RYSDR  CSYDYKA  RDAIAR+NP
Sbjct  105  RCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAATRDAIARDNP  155



>ref|XP_002460447.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
 gb|EER96968.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
Length=172

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 89/169 (53%), Gaps = 10/169 (6%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEE      PE ITLC NNCG  GNPAT N+CQ CFSA TA+     ++     
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANNCGFPGNPATQNLCQSCFSAATASRSSSPSSPTSSS  59

Query  509  GEK---XPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
                   PR     L            +   V +  + V                 VNRC
Sbjct  60   SASAVSQPRPA--ALVDAAAVELLASADAAAVGQSMEVVAAAPAATAA----RSSAVNRC  113

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S CR++VGLTGFRCRCGELFCG  RYSDR  CSYDYK  GRDAIARENP
Sbjct  114  SSCRKRVGLTGFRCRCGELFCGAHRYSDRHGCSYDYKGAGRDAIARENP  162



>gb|AAR83854.1| induced stolon tip protein [Capsicum annuum]
Length=88

 Score =   117 bits (293),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  425  VARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXD  246
            +++  K V++E+++ ++  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE RYSDR D
Sbjct  1    MSQDLKKVKQEDDQLKDSLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD  60

Query  245  CSYDYKAXGRDAIARENP  192
            CSYDYK  GR+AIARENP
Sbjct  61   CSYDYKTAGREAIARENP  78



>gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii]
Length=87

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  368  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE RYSDR DCSYDYK  GR+AIARENP
Sbjct  19   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP  77



>ref|XP_002445913.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
 gb|EES15408.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
Length=176

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 95/171 (56%), Gaps = 10/171 (6%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA++   S +     
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFQAATASSASASVSPPSPS  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENR-----SPPAKREVN  345
                P     +   ++ +     R   T    ++  E+       R     S  +   VN
Sbjct  61   SSLSPSPAVFKFDEQQHA-----RPSATAVFADRPAEQPPAPASARPIRTTSTSSSSSVN  115

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RC  CR++VGLTGFRCRCGELFCG  RYSDR DC +DYKA GRDAIARENP
Sbjct  116  RCQSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCCFDYKAVGRDAIARENP  166



>gb|AGQ04317.1| SAP1, partial [Oryza longistaminata]
Length=147

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 82/148 (55%), Gaps = 12/148 (8%)
 Frame = -1

Query  635  ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTS  456
            ITLC N+CG  GNPAT N+CQ CF A TA+    S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  455  PDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  276
            P         +A       +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPVEEVSSALATAPAPAAKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  109

Query  275  GEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  110  GEHRYSDRHGCSYDYKSAARDAIARDNP  137



>gb|AGQ04315.1| SAP1, partial [Oryza rufipogon]
Length=149

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 81/148 (55%), Gaps = 10/148 (7%)
 Frame = -1

Query  635  ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTS  456
            ITLC N+CG  GNPAT N+CQ CF A TA+    S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  455  PDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  276
            P             E+                   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPV----------EEMASALATATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  111

Query  275  GEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  112  GEHRYSDRHGCSYDYKSAARDAIARDNP  139



>ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 88/166 (53%), Gaps = 17/166 (10%)
 Frame = -1

Query  686  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXG  507
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+     +             
Sbjct  5    SQKREAEETEFQT-PNIPTLCANNCGFFGSPATNNLCSKCYKDYFLSKS-----------  52

Query  506  EKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeE-NRSPPAKREVNRCSGC  330
                +     L     +   K  E      GE  VE   EE   +   PAK+  NRCS C
Sbjct  53   ----KASIETLVVPPPAEAKKVEEKAAGGDGEAKVESFAEEGAPSGESPAKKPTNRCSFC  108

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             +KVGL GF+CRCGE+FC   RYSD+ +C++DYK  G+DAIA+ NP
Sbjct  109  NKKVGLMGFKCRCGEVFCSLHRYSDKHNCAFDYKGAGQDAIAKANP  154



>gb|AGQ04319.1| SAP1, partial [Oryza meridionalis]
Length=146

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 83/148 (56%), Gaps = 13/148 (9%)
 Frame = -1

Query  635  ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTS  456
            ITLC N+CG  GNPAT N+CQ CF A TA+    S+       +K PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSL-SSPVLDKPPRPAAPLVEPQAPL  60

Query  455  PDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  276
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  61   PPPVEEMASALAPAPAPVVKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  108

Query  275  GEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  109  GEHRYSDRHGCSYDYKSAARDAIARDNP  136



>ref|XP_003557532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_003557533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_010228317.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
Length=160

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 86/166 (52%), Gaps = 16/166 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ++ KE  E    PE   LCVNNCG  GN  TNNMC KC+        +    +  K 
Sbjct  1    MAQESWKESEETVQTPEAPVLCVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAVPVVEKK-  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                    F   S     P    +ED   A     V + +  +E   PP+    NRC  C
Sbjct  60   -------AFAAASSSMV-PLEPAKEDEVPAAA---VVDSQAAQEPPKPPS----NRCLSC  104

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGF+CRCG  FC   RY+D  +CS+DYKA GR+ IA++NP
Sbjct  105  RKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKAAGREQIAKQNP  150



>ref|NP_001140650.1| uncharacterized protein LOC100272725 [Zea mays]
 gb|ACF84270.1| unknown [Zea mays]
 tpg|DAA47934.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=176

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 91/166 (55%), Gaps = 0/166 (0%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA++   ++      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASSSASASVSPPPP  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                      +   ++   + + R        E+            +P +   V RC  C
Sbjct  61   SSSSSSPAVLQFDEQQQQQNPRPRAPAASGPTEEPPRPARASAPAPAPASSSSVRRCQTC  120

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG+LFCG  RYSDR DC +DY+A GRDAIAR+NP
Sbjct  121  RKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNP  166



>ref|XP_010228315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
 ref|XP_010228316.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
Length=205

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 86/166 (52%), Gaps = 16/166 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ++ KE  E    PE   LCVNNCG  GN  TNNMC KC+        +    +  K 
Sbjct  46   MAQESWKESEETVQTPEAPVLCVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAVPVVEKK-  104

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                    F   S     P    +ED   A     V + +  +E   PP+    NRC  C
Sbjct  105  -------AFAAASSSMV-PLEPAKEDEVPAAA---VVDSQAAQEPPKPPS----NRCLSC  149

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGF+CRCG  FC   RY+D  +CS+DYKA GR+ IA++NP
Sbjct  150  RKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKAAGREQIAKQNP  195



>ref|XP_004973853.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Setaria italica]
Length=178

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 89/170 (52%), Gaps = 6/170 (4%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K E   ++    +TLC N+CG  GNPAT N+CQ CF A +A+A    +      
Sbjct  1    MAQRDKKVEEPTELHAPELTLCANSCGFPGNPATKNLCQNCFLAASASASASVSPPSPSP  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRS----PPAKREVNR  342
                    F +  P   S          VA     V+         S     P    VNR
Sbjct  61   STT--TAAFDKPWPAAASAFSAPTPLAVVAPFSPAVDRPAGGPVESSSSNKAPRTSSVNR  118

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            C  CR++VGLTGFRCRCGELFCG  RYSDR DC++DYK  GRDAIARENP
Sbjct  119  CHNCRKRVGLTGFRCRCGELFCGAHRYSDRHDCNFDYKGVGRDAIARENP  168



>ref|XP_002993103.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
 gb|EFJ05851.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
Length=176

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 91/168 (54%), Gaps = 4/168 (2%)
 Frame = -1

Query  689  MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ++ K E E     +PE   LC NNCG  G+ AT N+C KC+   +++    +     
Sbjct  1    MAQESWKREEEAAGCQLPEGPVLCANNCGFFGSVATMNLCSKCYREQSSSKAAETMITTT  60

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
                            E  +     R   T+A G  T+  E++   ++  P  R  NRC 
Sbjct  61   TTTAAACATATPAAKEEALAAIATSRTSTTIATGATTLVTEDDSSASQEKP--RLPNRCL  118

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+++GLTGF+CRCG++FC   RYSD+ +CS+DYKA GR+AIA+ NP
Sbjct  119  ACRKRLGLTGFKCRCGDVFCSMHRYSDKHNCSFDYKAAGREAIAKANP  166



>gb|AGQ04323.1| SAP1, partial [Oryza punctata]
Length=146

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 82/149 (55%), Gaps = 15/149 (10%)
 Frame = -1

Query  635  ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI-HHKXGEKXPRXGFRRLSPERT  459
            ITLC N+CG  GNPAT N+CQ CF A +A+    S+        +K PR     +  E  
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSLSSLPGLSPVLDKPPRPATPLV--ESQ  59

Query  458  SPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELF  279
            +P     E+   A       +               VNRCS CR++V LTGFRCRCG LF
Sbjct  60   APLPPPVEEMVSAPAPALAAKTS------------AVNRCSRCRKRVSLTGFRCRCGHLF  107

Query  278  CGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CGE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  108  CGEHRYSDRHGCSYDYKSAARDAIARDNP  136



>ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 91/167 (54%), Gaps = 23/167 (14%)
 Frame = -1

Query  689  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            MAQ+   EE E ++   E++ LC+NNCG  G+PATNNMCQ CF A+ A            
Sbjct  1    MAQR---EEKEMELHAHESLALCINNCGFPGDPATNNMCQTCFQASPA-----------A  46

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
                 PR   RR +P   SPD   R +   A                     R+VNRC  
Sbjct  47   ASSSLPRSCSRRSAPSIRSPDPADRAEEQGAPTAALASPAPA--------PARKVNRCLS  98

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR++VG TGFRCRCGELFCGE RYSDR DC YDYKA  R AIAR NP
Sbjct  99   CRKRVGFTGFRCRCGELFCGEHRYSDRHDCGYDYKAAARAAIARANP  145



>ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 87/165 (53%), Gaps = 15/165 (9%)
 Frame = -1

Query  686  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXG  507
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+     +    S        
Sbjct  5    SQKREAEETEFQT-PNIPTLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASIETLLVP-  62

Query  506  EKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCR  327
               P    +++  +    D + ++      G  +             P K+  NRCS C 
Sbjct  63   ---PPVEAKKVEKKSAGGDGEAKDGSFTEEGAPS----------GGAPVKKPPNRCSFCN  109

Query  326  RKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +KVGL GF+CRCGE+FC   RYSD+ DC++DY+  G+DAIA+ NP
Sbjct  110  KKVGLMGFKCRCGEVFCSVHRYSDKHDCAFDYRGAGQDAIAKANP  154



>ref|XP_008794968.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 90/167 (54%), Gaps = 19/167 (11%)
 Frame = -1

Query  686  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXG  507
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+     +    S        
Sbjct  5    SQKREAEETEFQT-PNMPTLCANNCGFFGSPATNNLCSKCYKDCFLSKSKASI-------  56

Query  506  EKXPRXGFRRLSPERTSPDXKRREDXTVA-RGEKTVeeeeeeeENRS-PPAKREVNRCSG  333
                       S    S + K+ E+  +   GE  V    EE  +    PAK   NRCS 
Sbjct  57   ---------ETSVVPPSAEAKKAEEKPLGGNGEAKVGSFAEEGASSGESPAKETPNRCSF  107

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            C ++VGL GF+CRCGELFC   RYSD+ +C++DY+  G+DAIA+ NP
Sbjct  108  CNKRVGLMGFKCRCGELFCSLHRYSDKHNCAFDYRGAGQDAIAKANP  154



>ref|NP_001058985.1| Os07g0168800 [Oryza sativa Japonica Group]
 sp|Q7Y1W9.1|SAP9_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 9; Short=OsSAP9 [Oryza sativa Japonica 
Group]
 gb|AAP37480.1| putative A20/AN1-type zinc finger protein ZFP177 [Oryza sativa 
Japonica Group]
 dbj|BAD31780.1| putative zinc finger protein 216 [Oryza sativa Japonica Group]
 dbj|BAF20899.1| Os07g0168800 [Oryza sativa Japonica Group]
 gb|EAZ02907.1| hypothetical protein OsI_25046 [Oryza sativa Indica Group]
 gb|EAZ38825.1| hypothetical protein OsJ_23237 [Oryza sativa Japonica Group]
 dbj|BAH00672.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 89/167 (53%), Gaps = 17/167 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            MAQ++ K E+E  V  PE   LCVNNCG  G+  TNNMC KC+        + +  +  K
Sbjct  1    MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAAPVVEKK  60

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
                     F   S  +T  +  + ++   A  E        ++  + PP K   NRC  
Sbjct  61   --------AFTPASSSKTPLEPAKPDEVPAAAVED-------KQAAQEPP-KPPSNRCLS  104

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR+KVGLTGF+CRCG  FC   RY++  DC++DYK  GRD IA++NP
Sbjct  105  CRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNP  151



>ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=160

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 92/169 (54%), Gaps = 22/169 (13%)
 Frame = -1

Query  689  MAQK-TGKEETEFKVVPETITL--CVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIH  519
            MA K T KEETEFKV PETIT   C+N         T        + TT +    S    
Sbjct  1    MAHKITKKEETEFKV-PETITPSPCINIQTAATTTVTAATTTVTAATTTTSISEPSRFFE  59

Query  518  HKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
             K      R      SP+R+ P     +D T  + + T           S  AKR VNRC
Sbjct  60   DKS---TARSATSSRSPKRSHPS----DDDTQVQPQTT-----------SSEAKRAVNRC  101

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCRR+VGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  102  SGCRRRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTVGREAIARENP  150



>ref|NP_001106263.1| AN110 [Zea mays]
 gb|ABS83249.1| AN110 [Zea mays]
Length=174

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 90/166 (54%), Gaps = 2/166 (1%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA+A    +      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASASASVSPPPPSS  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                    F     ++   + + R     A G              +P +   V RC  C
Sbjct  61   SSSPAVLQFDDQQQQQQQQNPRPR--APAASGPTEEPPRPARAPAPAPASSSSVRRCQTC  118

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG+LFCG  RYSDR DC +DY+A GRDAIAR+NP
Sbjct  119  RKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNP  164



>ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808673.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808683.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 88/172 (51%), Gaps = 29/172 (17%)
 Frame = -1

Query  686  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaA------  525
            +QK   EETEF+  P   TLC NNCG  G+PATNN+C KC+     +    S        
Sbjct  5    SQKREAEETEFQT-PNMPTLCANNCGFFGSPATNNLCSKCYKDYFLSKSKASVETLLVPP  63

Query  524  -IHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV  348
             +  K  E+ P  G                 D     G  T    +E   +   P K+  
Sbjct  64   PVEAKKVEEKPAGG-----------------DGEAKGGSFT----DEAAPSEGSPVKKPP  102

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCS C ++VGL GF+CRCGE+FC   RYSD+ DC++DY+  G+DAIA+ NP
Sbjct  103  NRCSFCNKRVGLMGFKCRCGEVFCSLHRYSDKHDCAFDYRGAGQDAIAKANP  154



>gb|AGQ04324.1| SAP1, partial [Oryza officinalis]
Length=145

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 83/149 (56%), Gaps = 16/149 (11%)
 Frame = -1

Query  635  ITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI-HHKXGEKXPRXGFRRLSPERT  459
            ITLC N+CG  GNPAT N+CQ CF A +A+    S+        +K PR     +  E  
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSPSSLAGLSPVLDKPPRPATPLV--EAK  59

Query  458  SPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELF  279
            +P     E+   A      +                VNRCS CR++VGLTGFRCRCG LF
Sbjct  60   APLPPPAEEMASAPAPAPAKTS-------------AVNRCSRCRKRVGLTGFRCRCGHLF  106

Query  278  CGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CGE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  107  CGEHRYSDRHGCSYDYKSAARDAIARDNP  135



>gb|EMT06701.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Aegilops tauschii]
Length=165

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 91/168 (54%), Gaps = 15/168 (9%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K+E   ++    ITLC N+CG  GNPAT N+CQ CF A  A+    S++     
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSSSS  60

Query  509  --GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
              G   P     R  P     +  R         E               PA+  VNRCS
Sbjct  61   LPGVSAPTPVIDRPRPAPLEAELARPAVDLAPATEAK-------------PARTSVNRCS  107

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR++VGLTGFRCRCG++FCGE RYSDR  CSYDYKA  RDAIAR+NP
Sbjct  108  SCRKRVGLTGFRCRCGDMFCGEHRYSDRHGCSYDYKAAARDAIARDNP  155



>ref|NP_001266661.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
 gb|ACG38807.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
Length=167

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 88/166 (53%), Gaps = 9/166 (5%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF A TA++    +      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASSSASVSPPPPSS  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                    F          D ++             EE        +P +   V RC  C
Sbjct  61   SSSPAVLQFD---------DQQQNPRPCAPAASGPTEEPPRPARASAPASSSSVRRCQTC  111

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGFRCRCG+LFCG  RYSDR DC +DY+A GRDAIAR+NP
Sbjct  112  RKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNP  157



>ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=151

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 92/168 (55%), Gaps = 29/168 (17%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQK  KEETE KV P++I L   N  V+  P  +N  QK  S +T++      +  +  
Sbjct  1    MAQKREKEETELKV-PQSIPL--PNLPVSSQPHADN--QKPASPSTSSVRAPEISDLNFS  55

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG-  333
            G    R      SPE++  +  RR    V R                    RE NRCSG 
Sbjct  56   GTDDSRSSSGARSPEKSDLEEIRR---LVKR-------------------PREANRCSGI  93

Query  332  -CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CRRKVGL GFRCRCGE+FC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  94   GCRRKVGLIGFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENP  141



>gb|ABK90631.1| zinc finger protein [Aeluropus littoralis]
Length=159

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 83/168 (49%), Gaps = 21/168 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK-  513
            MAQ++ K+E+     PE   LC+NNCG  G+  TNNMC KC+        + +  +  K 
Sbjct  1    MAQESWKQESH---APEAPILCINNCGFFGSSMTNNMCSKCYRDFVKLMEMDAPVVDKKL  57

Query  512  -XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
                      F     + T PD    +D   A+                 P K   NRCS
Sbjct  58   ITTASSSTVPFETAKQDDTVPDAAAMDDKQPAQE----------------PPKPPSNRCS  101

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+KVGLTGF+CRCG  FC   RY+D  +C++DYK   R+ IA++NP
Sbjct  102  TCRKKVGLTGFQCRCGGTFCSLHRYTDSHECTFDYKKVAREQIAKQNP  149



>dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 94/170 (55%), Gaps = 21/170 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K+E   ++    ITLC N+CG  GNPAT N+CQ CF A  A+    S++     
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSLPG  60

Query  509  GE-KXPRXGFRRLSP---ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
                 P     R +P   E   P    R   T A+                 PA+  VNR
Sbjct  61   ASVSTPVLDRPRPAPVDAELAHPAVDYRATATEAK-----------------PARTSVNR  103

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CS CR++VGLTGFRCRCG++FCGE RYSDR  CSYDYKA  RDAIAR+NP
Sbjct  104  CSSCRKRVGLTGFRCRCGDVFCGEHRYSDRHGCSYDYKAAARDAIARDNP  153



>ref|XP_011025067.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=249

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  371  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  180  SSVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIARENP  239


 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF  564
            MAQ+T KEETE KV PE +TLC+NNCGVTGNPATNNMCQKCF
Sbjct  65   MAQRTEKEETECKV-PENLTLCINNCGVTGNPATNNMCQKCF  105



>ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=137

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            KR VNRCSGCRR+VGLTGFRCRCG+LFC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  72   KRAVNRCSGCRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP  127



>ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF49168.1| zinc finger protein, putative [Ricinus communis]
Length=140

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -1

Query  362  AKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            AKR+VNRCSGCRRKVGLTGFRCRCG+LFC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  74   AKRDVNRCSGCRRKVGLTGFRCRCGDLFCWEHRYSDRHDCSYDYKTVGREAIARENP  130



>ref|XP_010257702.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=170

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 91/171 (53%), Gaps = 16/171 (9%)
 Frame = -1

Query  689  MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPATNNMCQKCF--sattaaaglxsaAI  522
            MAQ++ K+ET+      PE   LC NNCG  G+ ATNN+C KC+            ++ +
Sbjct  1    MAQESWKKETDETECQTPEGPILCANNCGFFGSAATNNLCSKCYRDMFMKQQQQFKASTV  60

Query  521  HHKXGEKXPRXGFRRLSPERTSPDXKRRED-XTVARGEKTVeeeeeeeENRSPPAKREVN  345
                 +        +L P     +    E+  T+  G  T E       N+ PP     N
Sbjct  61   TPVAEKVQATSTLVQLEPVVGRVNNNNIEEKLTLQEGSSTYET------NKQPP-----N  109

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RC  C+++VGLTGF+CRCG +FCG  RYS++  CSYDY++ GRDAIA+ NP
Sbjct  110  RCLACQKRVGLTGFKCRCGGIFCGVHRYSEKHGCSYDYRSAGRDAIAKANP  160



>gb|AFK36400.1| unknown [Medicago truncatula]
Length=151

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  371  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC E RYSDR DCSYDYKA GR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141



>ref|XP_003627722.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AET02198.1| AN1-like zinc finger protein [Medicago truncatula]
 gb|AFK41885.1| unknown [Medicago truncatula]
Length=151

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -1

Query  371  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC E RYSDR DCSYDYKA GR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141



>ref|NP_001275387.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
8-like [Solanum tuberosum]
 gb|AFW90615.1| stress-associated protein 3 [Solanum tuberosum]
 gb|AFX66985.1| stress-associated protein 3 [Solanum tuberosum]
Length=171

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 13/165 (8%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI----HHKXGEK  501
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+            A+    +   G  
Sbjct  4    DETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSS  63

Query  500  XPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV--NRCSGCR  327
                G   + P    PD       T+      +   +    +  P  K +V  NRC  C+
Sbjct  64   AGEKGMVIVDPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCK  116

Query  326  RKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +KVG+TGF+CRCG L+CG  RYSD+ DC +DY++ G+DAIA+ NP
Sbjct  117  KKVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>gb|ACJ84133.1| unknown [Medicago truncatula]
Length=151

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -1

Query  371  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S  AKR VNRCSGCR++VGLTGF CRCG+LFC E RYSDR DCSYDYKA GR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFHCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141



>ref|XP_006657485.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X1 [Oryza brachyantha]
 ref|XP_006657486.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X2 [Oryza brachyantha]
Length=160

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 85/167 (51%), Gaps = 18/167 (11%)
 Frame = -1

Query  689  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            MAQ++ K E+E  V  PE   LCVNNCG  G+  TNNMC KC+        +        
Sbjct  1    MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKVTTMVPVV----  56

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
                  +  F   S  +T  +  + ++   A  E         ++    P K   NRC  
Sbjct  57   -----DKKVFTAASSSKTPLEPAKPDEVPAAAVED--------KQEAQEPPKPPSNRCLS  103

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR+KVGLTGF+CRCG  FC   RY++  +C++DYK  GRD IA++NP
Sbjct  104  CRKKVGLTGFQCRCGGTFCSTHRYTEAHNCTFDYKKAGRDQIAKQNP  150



>dbj|BAJ88745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 93/170 (55%), Gaps = 21/170 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  K+E   ++    ITLC N+CG  GNPAT N+CQ CF A  A+    S++     
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSLPG  60

Query  509  GE-KXPRXGFRRLSP---ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNR  342
                 P     R +P   E   P    R   T A+                 PA+  VNR
Sbjct  61   ASVSTPVLDRPRPAPVDAELAHPAVDYRATATEAK-----------------PARTSVNR  103

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CS CR++VGLTGFRCRCG++FCG  RYSDR  CSYDYKA  RDAIAR+NP
Sbjct  104  CSSCRKRVGLTGFRCRCGDVFCGGHRYSDRHGCSYDYKAAARDAIARDNP  153



>ref|XP_007133828.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
 gb|AAA33773.1| PVPR3 [Phaseolus vulgaris]
 gb|ESW05822.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
Length=137

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 84/169 (50%), Gaps = 45/169 (27%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQK  K +T+FKV PE IT C           +                          
Sbjct  1    MAQKAQKNDTDFKV-PEPITPCATATAAAATSISE-------------------------  34

Query  509  GEKXPRXGFRRLSPERTSPDXKRR---EDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
                P   F   +P  +S   KR    ED   A  ++TV          S P KR VNRC
Sbjct  35   ----PSRFFDAATPATSSRSPKRSLPLED--AANADRTVA---------SEP-KRAVNRC  78

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SGCRR+VGLTGFRCRCG+LFC E RY+DR DCSYDYK  GR+AIARENP
Sbjct  79   SGCRRRVGLTGFRCRCGDLFCAEHRYTDRHDCSYDYKTVGREAIARENP  127



>ref|XP_010534277.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=189

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -1

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            K+ VNRCSGCRRKVGLTGFRCRCGELFC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  124  KKIVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  179


 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF  564
            MAQ+T  EETEFKV PET+TLCVNNCGVTGNPA NNMCQKCF
Sbjct  1    MAQRTENEETEFKV-PETLTLCVNNCGVTGNPANNNMCQKCF  41



>ref|XP_010268591.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=163

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 75/151 (50%), Gaps = 15/151 (10%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P    LC NNCG  G PATNN+C KC+                    K  +     +  E
Sbjct  18   PNAPILCSNNCGFFGTPATNNLCSKCYRDFFL---------------KQSKVAAASVVAE  62

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
            R   +    +   V  G++      EE      P K   NRCS CR++VGLTGF+CRCG+
Sbjct  63   RKVEEPIVEKAGQVGVGQEAKATLSEEGTTSGDPGKLPANRCSFCRKRVGLTGFKCRCGQ  122

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             FC   RY+D+ +C +DYK  G+DAIA+ NP
Sbjct  123  TFCSLHRYTDKHNCLFDYKTAGQDAIAKANP  153



>dbj|BAK01503.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 85/167 (51%), Gaps = 17/167 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            MAQ++ KE  +  V  PE   LCVNNCG  GN  T NMC KC+  T  A  + +  + +K
Sbjct  1    MAQESWKEAEDTGVHAPEAPILCVNNCGFFGNRMTENMCSKCYRDTAKAKRMATL-VENK  59

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
                        ++  +       +E   VA  E              PP+    NRC  
Sbjct  60   TAAAVASSPTPLVAEMKDEASGSAKEGKQVAEEEAP-----------KPPS----NRCLS  104

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR+KVGLTGF+CRCG+ FC   RY+D  DC +DYK  GR+ IA++NP
Sbjct  105  CRKKVGLTGFKCRCGDTFCSMHRYADAHDCKFDYKQAGREQIAQQNP  151



>ref|XP_011094369.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X1 [Sesamum indicum]
 ref|XP_011094370.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X2 [Sesamum indicum]
Length=160

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 84/159 (53%), Gaps = 11/159 (7%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            EE  F+  PE   LCVNNCG  G+PAT NMC KC+   +       +          P  
Sbjct  3    EEHGFQA-PEGHRLCVNNCGFFGSPATQNMCSKCYRDLSIKKSADFST----PSTAPPPS  57

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLT  309
               +LS   +SPD       TVA     +  +++ +           NRCS CR+KVGLT
Sbjct  58   TAAQLS--LSSPDKAESSVATVAAQSPPMPVQQQAQPQPQ----PPTNRCSTCRKKVGLT  111

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GFRCRCG  FCG  RY ++  C++D+KA GR+AIA+ NP
Sbjct  112  GFRCRCGITFCGSHRYPEKHGCTFDFKAMGREAIAKANP  150



>dbj|BAJ94586.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99722.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 85/166 (51%), Gaps = 16/166 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            M Q + KE  E    PE   LCVNNCG  G+  TNNMC KC+     A  + +     K 
Sbjct  1    MTQDSWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATTIAAPVAEKKV  60

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                    F   S    + +  + ++     G   + + +  +E   PP+    NRC  C
Sbjct  61   --------FTVASSSNVTLEQAKADEV----GAVPLVDSQAAQEPPKPPS----NRCLSC  104

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGF+CRCG  FC   RY+D  +CS+DYK  GR+ IA++NP
Sbjct  105  RKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKKAGREQIAKQNP  150



>ref|XP_006361216.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Solanum tuberosum]
Length=171

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 83/165 (50%), Gaps = 13/165 (8%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI----HHKXGEK  501
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+            A+    +   G  
Sbjct  4    DETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSS  63

Query  500  XPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV--NRCSGCR  327
                G   + P    PD       T+      +   +    +  P  K +V  NRC  C+
Sbjct  64   AGEKGMVIVDPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCK  116

Query  326  RKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +KVG+TGF+CRCG ++CG  RYSD+ DC +DY++ G+DAIA+ NP
Sbjct  117  KKVGITGFKCRCGNIYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|XP_004228358.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
 ref|XP_004228359.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
Length=171

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 78/157 (50%), Gaps = 13/157 (8%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI----HHKXGEKXPRXGFRR  477
            PE   LC+NNCG  G+ A  NMC KC+            A+    +   G      G   
Sbjct  12   PEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSSASEKGMVI  71

Query  476  LSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV--NRCSGCRRKVGLTGF  303
              P    PD       T+      +   +    +  P  K +V  NRC  C++KVG+TGF
Sbjct  72   AGPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKKKVGITGF  124

Query  302  RCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +CRCG L+CG  RYSD+ DC +DY++ G+DAIA+ NP
Sbjct  125  KCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>gb|ACL01101.1| zinc finger protein [Phyllostachys edulis]
Length=164

 Score =   103 bits (258),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 91/173 (53%), Gaps = 26/173 (15%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEE      PE ITLC N+CG  GNPAT N+CQ CF A +A+     +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSS  59

Query  509  GEKXPRXGFR------RLSP-ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
                   G        R +P E  SP   R     V  G                  K  
Sbjct  60   SSSSSLPGLSPVVDKPRPAPMELASPAVDRAPAVEVKAG------------------KTS  101

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRCS CR++VGLTGFRCRCGELFCGE RYSDR  CSYDYKA  RDAIAR+NP
Sbjct  102  VNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAAARDAIARDNP  154



>gb|EMT32776.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
9 [Aegilops tauschii]
Length=394

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 83/166 (50%), Gaps = 16/166 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ++ KE  E    PE   LCVNNCG  G+  TNNMC KC+     A  + +  +  K 
Sbjct  235  MAQESWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATTMAAPVVEKKV  294

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                        S   T    K  E   VA  +    +E         P K   NRC  C
Sbjct  295  FSV-------ASSSSVTLEQAKADEVPAVAVADSQAAQE---------PPKPPSNRCLSC  338

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGF+CRCG  FC   RY+D  +C++DYK  GR+ IA++NP
Sbjct  339  RKKVGLTGFQCRCGGTFCSMHRYADSHECTFDYKKAGREQIAKQNP  384



>gb|EMS48100.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
9 [Triticum urartu]
Length=327

 Score =   107 bits (266),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 83/166 (50%), Gaps = 17/166 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ++ KE  E    PE   LCVNNCG  G+  TNNMC KC+     A  + +  +    
Sbjct  169  MAQESWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATTMAAPVVE---  225

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                 +      S   T    K  E   VA  +    +E         P K   NRC  C
Sbjct  226  -----KVFSVASSSSVTLEQAKADEVPAVAVADSQAAQE---------PPKPPSNRCLSC  271

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGF+CRCG  FC   RY+D  +C++DYK  GR+ IA++NP
Sbjct  272  RKKVGLTGFQCRCGGTFCSMHRYADSHECTFDYKKAGREQIAKQNP  317



>gb|EMT17725.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Aegilops tauschii]
Length=161

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 84/167 (50%), Gaps = 17/167 (10%)
 Frame = -1

Query  689  MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            MAQ++ KE  +  V  PE   +C+NNCG  GN  T NMC KC+  T  A  +    + +K
Sbjct  1    MAQESWKEAEDTGVHAPEAPIMCINNCGFFGNRMTENMCSKCYRDTVKAKSMALL-VENK  59

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
                        ++  +       +E   VA  E              PP+    NRC  
Sbjct  60   TAAAVASSPTPMVAEIKDEASASAKEGKRVAEEEAP-----------KPPS----NRCLS  104

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR+KVGLTGF+CRCG+ FC   RY+D  DC +DYK  GR+ IA++NP
Sbjct  105  CRKKVGLTGFKCRCGDTFCSMHRYADAHDCKFDYKQAGREQIAQQNP  151



>gb|ACM68446.1| stress-associated protein 9 [Solanum lycopersicum]
Length=149

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 85/168 (51%), Gaps = 21/168 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MA++ G E       PE   LC NNCG  G+P T N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  509  GEKXPRXGFRRLS--PERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
            G++ P       S  P  ++      ++ T A  E  V         +  P   + NRCS
Sbjct  44   GQQKPIDSLFPPSQLPIPSTSSILVLQESTAAEEEPEVVTAAVTVAVQ--PISAQPNRCS  101

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+KVGLTGF+CRCG  FCG  RY +   CS+D+K+ GR+AIA+ NP
Sbjct  102  ACRKKVGLTGFKCRCGTTFCGTHRYPEIHGCSFDFKSIGREAIAKANP  149



>gb|ADF80943.1| zinc finger protein [Phyllostachys vivax]
Length=163

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 90/172 (52%), Gaps = 25/172 (15%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEE      PE ITLC N+CG  GNPAT N+CQ CF A +A+     +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSS  59

Query  509  GEKXPRXGFR-----RLSP-ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV  348
                           R +P E  SP   R     V  G                  K  V
Sbjct  60   SSSSLPGLSPVVDKPRPAPVELASPAVDRVPAVEVKAG------------------KTSV  101

Query  347  NRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            NRCS CR+++GLTGFRCRCGELFCGE RYSDR  CSYDYKA  RDAIAR+NP
Sbjct  102  NRCSSCRKRLGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAAARDAIARDNP  153



>ref|XP_008384536.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008349466.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=172

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 70/159 (44%), Gaps = 0/159 (0%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            EET  +  PE   LCVNNCG  G+ AT NMC KC             A            
Sbjct  4    EETGCQAAPEGPILCVNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLT  309
                  P   +P    +      +   +         +   P      RCS C ++VGLT
Sbjct  64   SINANEPVIAAPPVDIQSQPVAPQTISSQPSFSFGSGSSGEPKPEGPKRCSSCNKRVGLT  123

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GF CRCG LFC   RYSD+ DC YDY+  GRDAIA+ NP
Sbjct  124  GFNCRCGHLFCAVHRYSDKHDCPYDYRTAGRDAIAKANP  162



>ref|XP_004249448.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum lycopersicum]
Length=159

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 85/168 (51%), Gaps = 21/168 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MA++ G E       PE   LC NNCG  G+P T N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  509  GEKXPRXGFRRLS--PERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
            G++ P       S  P  ++      ++ T A  E  V         +  P   + NRCS
Sbjct  44   GQQKPIDSLFPPSQLPIPSTSSILVLQESTAAEEEPEVVTAAVTVAVQ--PISAQPNRCS  101

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+KVGLTGF+CRCG  FCG  RY +   CS+D+K+ GR+AIA+ NP
Sbjct  102  ACRKKVGLTGFKCRCGTTFCGTHRYPEIHGCSFDFKSIGREAIAKANP  149



>gb|EMS47592.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Triticum urartu]
Length=267

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 85/168 (51%), Gaps = 17/168 (10%)
 Frame = -1

Query  692  RMAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            +MAQ++ KE  +  V  PE   +C+NNCG  GN  T NMC KC+  T  A  +    + +
Sbjct  106  KMAQESWKEAEDTGVHAPEAPIMCINNCGFFGNRMTENMCSKCYRDTVKAKKMALL-VEN  164

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
            K            ++  +       +E   VA  E              PP+    NRC 
Sbjct  165  KTAAAVASSPTPMVAEIKDEASASAKEGKQVAEEEAP-----------KPPS----NRCL  209

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+KVGLTGF+CRCG+ FC   RY+D  DC +DYK  GR+ IA++NP
Sbjct  210  SCRKKVGLTGFKCRCGDTFCSMHRYADAHDCKFDYKQAGREQIAQQNP  257



>gb|ACM68453.1| stress-associated protein 3 [Solanum pennellii]
Length=171

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 80/164 (49%), Gaps = 13/164 (8%)
 Frame = -1

Query  665  ETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI----HHKXGEKX  498
            ET  + + E   LC+NNCG  G+ A  NMC KC+             +    +   G   
Sbjct  5    ETGCQPLREGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLDVSSIENLVNGSSA  64

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV--NRCSGCRR  324
               G     P    PD       T+      +   +    +  P  K +V  NRC  C++
Sbjct  65   SEKGMVIAGPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKK  117

Query  323  KVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            KVG+TGF+CRCG L+CG  RYSD+ DC +DY++ G+DAIA+ NP
Sbjct  118  KVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|XP_009589288.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=151

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 92/168 (55%), Gaps = 29/168 (17%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQK  KEETE K VP++I L   N  V+  P  +N  QK  S +T++      +     
Sbjct  1    MAQKREKEETELK-VPQSIPL--PNLPVSSQPHADN--QKPTSPSTSSVRTPEISDLKLS  55

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS--  336
            G    R     +SPE++  +  RR   +V R                    RE NRCS  
Sbjct  56   GSDDSRSSSGAISPEKSDLEEIRR---SVKR-------------------PREANRCSGI  93

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GCRRKVGL GFRCRCG++FC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  94   GCRRKVGLIGFRCRCGDVFCSEHRYSDRHGCSYDYKAVGREAIARENP  141



>gb|EYU46282.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
 gb|EYU46283.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
Length=174

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 83/171 (49%), Gaps = 22/171 (13%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+             I  +   K    
Sbjct  4    DETGCQASPEGPLLCVNNCGFFGSAANMNMCSKCYKDL----------ILKQEQAKFAAS  53

Query  488  GFRRLSPERTSPDXKRREDXTVARGE---------KTVeeeeeeeENRS--PP-AKREVN  345
                +    +S     ++   VA            K++        + S  PP AK   +
Sbjct  54   SIENIVNGSSSGTPTEQDSVIVAESANIPTPSVEAKSISLPSVINASTSDEPPRAKEGPS  113

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +CS C+++VGLTGF+CRCG  FCG  RYSD+ DC +DY+  GRDAIA+ NP
Sbjct  114  KCSSCKKRVGLTGFKCRCGSTFCGSHRYSDKHDCPFDYRTAGRDAIAKANP  164



>gb|ACM68440.1| stress-associated protein 3 [Solanum lycopersicum]
Length=171

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 76/153 (50%), Gaps = 13/153 (8%)
 Frame = -1

Query  632  TLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAI----HHKXGEKXPRXGFRRLSPE  465
             LC+NNCG  G+ A  NMC KC+            A+    +   G      G     P 
Sbjct  16   ILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSSASEKGMVIAGPV  75

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV--NRCSGCRRKVGLTGFRCRC  291
               PD       T+      +   +    +  P  K +V  NRC  C++KVG+TGF+CRC
Sbjct  76   DVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKKKVGITGFKCRC  128

Query  290  GELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            G L+CG  RYSD+ DC +DY++ G+DAIA+ NP
Sbjct  129  GNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|XP_010555326.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
 ref|XP_010555327.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=162

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 85/167 (51%), Gaps = 21/167 (13%)
 Frame = -1

Query  686  AQKTGKEET--EFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            +QK   EET  E +  P   T+C NNCG  G P T+N+C KC+           A     
Sbjct  5    SQKRKLEETSHEPQAAP---TICANNCGFFGCPNTSNLCSKCYRDFLLKQSKTIAKNTVA  61

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
             G++      + +      P+    +   +  GE +V           PP   + NRCS 
Sbjct  62   VGKE------KGIEQTTEKPENNESQPGKIWDGENSVR----------PPPPLKSNRCSS  105

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR++VGLTGF+CRCG  FC + RYSD+ +C +DYK  G+DAIA+ NP
Sbjct  106  CRKRVGLTGFKCRCGHTFCSQHRYSDKHNCVFDYKTVGQDAIAKANP  152



>ref|XP_010261028.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=164

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 74/151 (49%), Gaps = 14/151 (9%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P    LC NNCG  G+PATNN+C KC+           AA+     +K            
Sbjct  18   PNVPILCANNCGFFGSPATNNLCSKCYRDFFLKQSKAVAALTVVAEKKVGESIVETKGQS  77

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
               P+ K      V  G  +             P K   NRCS C+++VGLTGF+CRCG+
Sbjct  78   GVGPEAKA---TLVEEGTTS-----------GDPGKLPANRCSFCKKRVGLTGFKCRCGQ  123

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             FC   RYSD+ +C +DYK  G+DAIA+ NP
Sbjct  124  TFCSLHRYSDKHNCLFDYKTAGQDAIAKANP  154



>ref|XP_006660763.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Oryza brachyantha]
Length=166

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 86/171 (50%), Gaps = 20/171 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEE      PE ITLC N+CG  GNPAT N+CQ CF                  
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFL--------------AAS  45

Query  509  GEKXPRXGFRRLSP-----ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVN  345
                       LSP      R +      +    A   + +       E ++P     VN
Sbjct  46   ASTSSPASLPGLSPVLDKAARPATSLVEAQAAPAAAPVEELASPAPALEVKAPAKTSAVN  105

Query  344  RCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCS CR++VGLTGFRCRCG LFCGE RYSDR  C YDYKA  RDAIAR+NP
Sbjct  106  RCSRCRKRVGLTGFRCRCGYLFCGEHRYSDRHGCGYDYKAAARDAIARDNP  156



>ref|NP_001288688.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1-like [Zea mays]
 gb|ACG49173.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
 tpg|DAA40383.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=161

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 82/166 (49%), Gaps = 15/166 (9%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+  KEE      PE ITLC NNCG  GNPAT N+CQ CFSA+ + +   S++     
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANNCGFPGNPATQNLCQSCFSASRSPSSPTSSSSSLAS  59

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                PR           +           A G+ T           S   KR        
Sbjct  60   AASQPR---PAALVVDAAAVEALAAPAAAAVGQATEAAARASASRCSSCRKR--------  108

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
               VGLTGFRCRCGELFCG  RYSDR  CSYDY+   RDAIARENP
Sbjct  109  ---VGLTGFRCRCGELFCGAHRYSDRHGCSYDYRGAARDAIARENP  151



>ref|XP_003540534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=135

 Score =   100 bits (249),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -1

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            KR V+RCS CRR+VGLTGFRCRCG+LFC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  70   KRVVSRCSCCRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP  125



>ref|XP_009376154.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376155.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379441.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379442.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 71/159 (45%), Gaps = 0/159 (0%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            EET  +  PE   LC+NNCG  G+ AT NMC KC             A            
Sbjct  4    EETGCQAAPEGPILCLNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLT  309
                  P   +     +    V +   +         +   P      RCS C ++VGLT
Sbjct  64   STNANEPVVAASPVDIQSQTVVPKTISSQPSFSFGSGSSGEPKPEGPKRCSSCNKRVGLT  123

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GF CRCG LFC   RYSD+ DC+YDY+  GRDAIA+ NP
Sbjct  124  GFNCRCGHLFCAVHRYSDKHDCAYDYRTAGRDAIAKANP  162



>ref|XP_006345467.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=167

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 75/162 (46%), Gaps = 26/162 (16%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P+   LCVNNCG  G  AT NMC KC+                    K  +  F   S E
Sbjct  11   PQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSIE  55

Query  464  R----TSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV-------NRCSGCRRKV  318
                 +S    +  D  V   E   E      +  +P    +V       NRCS CRR+V
Sbjct  56   SFVNGSSSASVKAVDVAVTVQEGPAESLVIPTQVAAPVESVQVEKAKEGPNRCSTCRRRV  115

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ +C YDY   G+DAIA+ NP
Sbjct  116  GLTGFNCRCGNLFCSAHRYSDKHECPYDYHKAGQDAIAKANP  157



>ref|NP_001051527.1| Os03g0792900 [Oryza sativa Japonica Group]
 sp|Q852K5.1|SAP6_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 6; Short=OsSAP6 [Oryza sativa Japonica 
Group]
 gb|AAO37974.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAQ83587.1| putative zinc finger transcription factor ZFP38 [Oryza sativa 
Japonica Group]
 gb|ABF99304.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF99305.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF99306.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13441.1| Os03g0792900 [Oryza sativa Japonica Group]
 gb|AEP20529.1| zinc finger protein [Oryza sativa Japonica Group]
Length=160

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 90/168 (54%), Gaps = 20/168 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ++ K+E E   V  PE   LCVNNCG  G+  T NMC KC+  T  A  + +     
Sbjct  1    MAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTVATVV---  57

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
               EK P      LS      +       +VA G++ +EE+        PP+    NRC 
Sbjct  58   ---EKKP---LASLSSTPLVTEVTDGGSGSVADGKQVMEED-----TPKPPS----NRCL  102

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+KVGLTGF+CRCG  FC   RY+D   C++DYK  GR+ IA++NP
Sbjct  103  SCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQVGREQIAKQNP  150



>gb|KDP35279.1| hypothetical protein JCGZ_09438 [Jatropha curcas]
Length=133

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 75/146 (51%), Gaps = 33/146 (23%)
 Frame = -1

Query  629  LCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTSPD  450
             CVNNCG  GN  TNN+C KC+                          F    P++T  +
Sbjct  11   YCVNNCGFFGNAKTNNLCSKCYKK------------------------FLLKQPQQTQIE  46

Query  449  XKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  270
                    VA GE+T        ENR P A    NRCS CR++VGLTGF CRCG+ FC  
Sbjct  47   S---TIAPVAGGEQT---GANSSENRPPAA---ANRCSFCRKRVGLTGFNCRCGQTFCSL  97

Query  269  XRYSDRXDCSYDYKAXGRDAIARENP  192
             RYSD+ +C +DYK+ G+DAIA+ NP
Sbjct  98   HRYSDKHNCVFDYKSAGQDAIAKANP  123



>gb|ACM68454.1| stress-associated protein 4 [Solanum pennellii]
Length=161

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 76/162 (47%), Gaps = 26/162 (16%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P+   LCVNNCG  G  AT NMC KC+                    K  +  F   S E
Sbjct  5    PQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSIE  49

Query  464  R----TSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV-------NRCSGCRRKV  318
                 +S    +  D  V   E   E      +  +P    +V       NRCS CRR+V
Sbjct  50   SFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAAPVESEQVEKAKEGPNRCSTCRRRV  109

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ +C YDY+  G+DAIA+ NP
Sbjct  110  GLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANP  151



>gb|KEH16280.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=177

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 78/158 (49%), Gaps = 17/158 (11%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRL---  474
            PE   LCVNNCG  G  AT NMC KC+  T             +  EK        L   
Sbjct  20   PELPILCVNNCGFFGRAATMNMCSKCYKDTQLM----------QEQEKLAAASVENLVSG  69

Query  473  -SPERTSPDXK---RREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTG  306
             S ++   D     + E+  V      +  +    EN     K   +RC+ CR++VGLTG
Sbjct  70   GSMKQVVTDGAVNVQIENVEVKTVSAEISGDSSSSENLETKVKTGPSRCATCRKRVGLTG  129

Query  305  FRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            F C+CG LFC   RYSD+ DC +DY++ GRDAIA+ NP
Sbjct  130  FTCKCGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKSNP  167



>gb|KEH16279.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=169

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 78/158 (49%), Gaps = 17/158 (11%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRL---  474
            PE   LCVNNCG  G  AT NMC KC+  T             +  EK        L   
Sbjct  12   PELPILCVNNCGFFGRAATMNMCSKCYKDTQLM----------QEQEKLAAASVENLVSG  61

Query  473  -SPERTSPDXK---RREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTG  306
             S ++   D     + E+  V      +  +    EN     K   +RC+ CR++VGLTG
Sbjct  62   GSMKQVVTDGAVNVQIENVEVKTVSAEISGDSSSSENLETKVKTGPSRCATCRKRVGLTG  121

Query  305  FRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            F C+CG LFC   RYSD+ DC +DY++ GRDAIA+ NP
Sbjct  122  FTCKCGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKSNP  159



>ref|XP_004951572.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Setaria italica]
 ref|XP_004951573.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Setaria italica]
Length=171

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 73/151 (48%), Gaps = 0/151 (0%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC             A            G +  +  
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAQLAASSIDSIVNGGDGVKGPAIA  70

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
             T+     + +      +  V  E  E     P AK   NRC+ CR++VGLTGF CRCG 
Sbjct  71   ATAEVVFAQVEEKAIFVQPPVVAETSEAAAVIPKAKEGPNRCATCRKRVGLTGFNCRCGN  130

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            ++C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  131  MYCAVHRYSDKHDCHFDYRTAARDAIAKANP  161



>gb|ABK21092.1| unknown [Picea sitchensis]
 gb|ABR17716.1| unknown [Picea sitchensis]
Length=181

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 82/156 (53%), Gaps = 5/156 (3%)
 Frame = -1

Query  647  VPETITLCVNNCGVTGNPATNNMCQKCF---sattaaaglxsaAIHHKXGEKXPRXGFRR  477
             PE  TLC NNCG  G+ AT N+C KC+       A A    AA+        P      
Sbjct  17   APEGHTLCANNCGFFGSSATRNLCSKCYRDLIMKEAQATSAMAAVEKSFAAGSPMDEVPL  76

Query  476  LSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSP-PAKREVNRCSGCRRKVGLTGFR  300
             SP+      + +    VA G  +V+  +    + SP P     NRC  CR++VGLTGF+
Sbjct  77   SSPDAIVQQNRVQISAAVA-GVSSVQLADSGSSSSSPQPPAETPNRCFSCRKRVGLTGFK  135

Query  299  CRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CRC   FCG  RY+++  CS+D+KA GR+AIA+ NP
Sbjct  136  CRCENTFCGLHRYAEKHSCSFDFKAAGREAIAKANP  171



>ref|XP_004229614.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Solanum lycopersicum]
Length=167

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 75/162 (46%), Gaps = 26/162 (16%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P+   LCVNNCG  G  AT NMC KC+                    K  +  F   S E
Sbjct  11   PQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSIE  55

Query  464  R----TSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV-------NRCSGCRRKV  318
                 +S    +  D  V   E   E      +   P    +V       NRCS CRR+V
Sbjct  56   SFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRRV  115

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ +C YDY+  G+DAIA+ NP
Sbjct  116  GLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANP  157



>gb|ACM68441.1| stress-associated protein 4 [Solanum lycopersicum]
Length=161

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 75/162 (46%), Gaps = 26/162 (16%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P+   LCVNNCG  G  AT NMC KC+                    K  +  F   S E
Sbjct  5    PQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSIE  49

Query  464  R----TSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV-------NRCSGCRRKV  318
                 +S    +  D  V   E   E      +   P    +V       NRCS CRR+V
Sbjct  50   SFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRRV  109

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ +C YDY+  G+DAIA+ NP
Sbjct  110  GLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANP  151



>ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011080266.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 75/161 (47%), Gaps = 4/161 (2%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+             +     E     
Sbjct  4    DETGCQPPPEGPILCVNNCGFFGSAANMNMCSKCYKDLILKQEQAK--LAASSIENIVNG  61

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRS--PPAKREVNRCSGCRRKVG  315
                   E    D    +   V     ++          +  P  K   NRCS C+++VG
Sbjct  62   SSSGNEQESVVADAAIMQTDLVEAKAISLPSINTSSFAEAAEPKTKEGPNRCSTCKKRVG  121

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF+CRCG LFCG  RYSD+ DC +DY+   RDAIA+ NP
Sbjct  122  LTGFKCRCGYLFCGSHRYSDKHDCPFDYRTAARDAIAKANP  162



>ref|XP_008461274.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Cucumis melo]
Length=172

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 81/162 (50%), Gaps = 6/162 (4%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC NNCG  G+ AT NMC KC   F      A L +++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKV  318
               G + +    T  + +  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNASSTVEK---VKESPNRCSSCRKRV  120

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ +CS+DY+A GR+AIA+ NP
Sbjct  121  GLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANP  162



>dbj|BAO74165.1| zinc finger protein [Cucurbita pepo subsp. ovifera]
Length=176

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 82/164 (50%), Gaps = 7/164 (4%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC NNCG  G+ AT N+C KC   F        L +++I        
Sbjct  5    KETGCQAPPEAPKLCANNCGFFGSAATMNLCSKCHKDFIMKQEQVKLAASSIGSIVNGGP  64

Query  497  PRXGFRRLSPERTSPDXKRRED--XTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRR  324
               G  + +   TSP     E    ++   + +               K   NRCS CR+
Sbjct  65   NDHG--KKAAVVTSPTKLEIEPAVSSIIPTQPSWTSPNASSSTNIEKVKASPNRCSSCRK  122

Query  323  KVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +VGLTGF CRCG LFC   RYSD+ DC++DY+A GR+AIA+ NP
Sbjct  123  RVGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANP  166



>ref|XP_010031824.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 ref|XP_010031825.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 gb|KCW51205.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51206.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51207.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51208.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51209.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
Length=171

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 77/173 (45%), Gaps = 29/173 (17%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            +ET  +  PE   LC+NNCG  G+PAT NMC KC             A       +    
Sbjct  4    DETGCQAPPEGPILCINNCGFFGSPATMNMCSKCHKDMLLKQEQAKLAASSIAAAENGSS  63

Query  488  GFRRLSP--------------ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
                  P               +T P     +  TVA  EK                K  
Sbjct  64   STTASEPVFAASVDTQLNTVEPKTIPKQPACDSVTVATVEK---------------PKEG  108

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
              RCS C ++VGLTGF CRCG +FCG  RYSD+ DC +DY++ GR+AIA+ NP
Sbjct  109  PTRCSSCNKRVGLTGFSCRCGNIFCGTHRYSDKHDCPFDYRSAGRNAIAKANP  161



>ref|XP_010531421.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=161

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 80/165 (48%), Gaps = 18/165 (11%)
 Frame = -1

Query  686  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXG  507
            +QK   EET  +     I LC NNCG  G P TNN+C KC+                  G
Sbjct  5    SQKRKLEETSHESQTAPI-LCANNCGFFGGPNTNNLCSKCYREFLLNQSKAIDDNTVVVG  63

Query  506  EKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCR  327
            ++          PE   P    RE   +  GE           N   P     NRCS CR
Sbjct  64   KEKGIDQTTGKKPENNEP-LGYRETGRIWEGE-----------NSEKP-----NRCSLCR  106

Query  326  RKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            ++VGLTGF+CRCG  FC + RYSD+ +C +DYK+ G+DAIA+ NP
Sbjct  107  KRVGLTGFKCRCGHTFCSQHRYSDKHNCVFDYKSAGQDAIAKANP  151



>gb|EYU18025.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
 gb|EYU18026.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
Length=186

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 76/173 (44%), Gaps = 14/173 (8%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH---------  516
            EET  +  PE   LC NNCG  G+ A  NMC KC+            A            
Sbjct  4    EETGCQTAPEGPILCANNCGFFGSAANMNMCSKCYKDQVLKQEQAKVAASSIENIVNGSS  63

Query  515  --KXGEKXPRXGFRRLSP---ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
                       G  + S    E  +      E  T+      V           P AK  
Sbjct  64   SSSSSSSSTSTGVEKESAVIAESGNVKIDLVEVKTITAPSLNVSSTPAVVAAVEPKAKEG  123

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
              RCS C+++VGLTGF+CRCG ++CG  RYSD+ DC +DY+  GRDAIA+ NP
Sbjct  124  PARCSSCKKRVGLTGFKCRCGNMYCGSHRYSDKHDCPFDYRTAGRDAIAKANP  176



>ref|XP_006339126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum tuberosum]
Length=159

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 82/169 (49%), Gaps = 23/169 (14%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MA++ G E       PE   LC NNCG  G+P T N C KC+             ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCY-----------NEVYIKG  43

Query  509  GEKXPRXGF---RRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
            G++ P       +   P ++S      E   V   E+  E           P   + NRC
Sbjct  44   GQQKPIDSLFPPQLPIPSQSSSVLVLPEPAAV---EEKPEVVIAAVTAAVQPMPAQSNRC  100

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S CR+KVGL GF+CRCG  FCG  RY +   CS+D+K+ GR+AIA+ NP
Sbjct  101  SACRKKVGLIGFKCRCGTTFCGTHRYPEIHGCSFDFKSMGREAIAKANP  149



>ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009589285.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=172

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 78/159 (49%), Gaps = 0/159 (0%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+  T         A            
Sbjct  4    DETGCQSHPEGPILCINNCGFFGSAANMNMCSKCYKDTILKQEQAKLAATSIENLVNGSI  63

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLT  309
               +      S D +     T +    +        E     AK   +RCS C++KVGLT
Sbjct  64   ASEKGPVVVGSVDVQPAMLETKSVVVLSSPPSSSAGEAAELKAKVGPSRCSSCKKKVGLT  123

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GF+CRCG L+CG  RYSD+ DC +DY++ GRDAIA+ NP
Sbjct  124  GFKCRCGNLYCGSHRYSDKHDCQFDYRSAGRDAIAKANP  162



>dbj|BAO74167.1| zinc finger protein [Cucurbita pepo subsp. pepo]
Length=176

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 82/164 (50%), Gaps = 7/164 (4%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC NNCG  G+ AT N+C KC   F        L +++I        
Sbjct  5    KETGCQAPPEAPKLCANNCGFFGSAATMNLCSKCHKDFIMKQEQVKLAASSIGSIVNGGP  64

Query  497  PRXGFRRLSPERTSPDXKRRED--XTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRR  324
               G  + +   TSP     E    ++   + +               K   NRCS CR+
Sbjct  65   NDHG--KKAAVVTSPTKLEIEPAVSSIIPTQPSWTSPNASSSTNIEKVKASPNRCSSCRK  122

Query  323  KVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            ++GLTGF CRCG LFC   RYSD+ DC++DY+A GR+AIA+ NP
Sbjct  123  RIGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANP  166



>gb|EYU31356.1| hypothetical protein MIMGU_mgv1a014938mg [Erythranthe guttata]
Length=173

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 76/163 (47%), Gaps = 22/163 (13%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P+   LCVNNCG  G PAT NMC KC+             +  +   +     F+ +   
Sbjct  11   PQATILCVNNCGFFGTPATLNMCSKCYKDV----------VLKQERAEFAASSFQSIING  60

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENR-----SPPA-------KREVNRCSGCRRK  321
             +    K  +  T    E      +  E +R     SP         K+   RC  C ++
Sbjct  61   SSKNGAKVSDAATAVIAEANAISSDSMEASRRTSSESPAIGGSDEANKQGPKRCGACNKR  120

Query  320  VGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VGLTGF CRCG +FCG  RYSD+ DC +DY A G+ AIA+ NP
Sbjct  121  VGLTGFNCRCGSMFCGVHRYSDKHDCPFDYHAAGQQAIAKANP  163



>ref|XP_002975420.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
 gb|EFJ23621.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
Length=175

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 83/168 (49%), Gaps = 5/168 (3%)
 Frame = -1

Query  689  MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ++ K E E     +PE   LC NNCG  G+ AT N+C KC+   +++       I  
Sbjct  1    MAQESWKREEEAAGCQLPEGPVLCANNCGFFGSVATMNLCSKCYREQSSSKAAAETMITT  60

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCS  336
                               +    R            V E++       P   R  NRC 
Sbjct  61   TTTAAAAAATPAAKEEALAAIATSRTSTTIATAATTLVTEDDSSASQEKP---RLSNRCL  117

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+++GLTGF+CRCG++FC   RYSD+ +CS+DYKA GR+AIA+ NP
Sbjct  118  ACRKRLGLTGFKCRCGDVFCSMHRYSDKHNCSFDYKAAGREAIAKANP  165



>ref|XP_010031823.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X1 [Eucalyptus grandis]
Length=196

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 79/178 (44%), Gaps = 29/178 (16%)
 Frame = -1

Query  683  QKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGE  504
            +K   +ET  +  PE   LC+NNCG  G+PAT NMC KC             A       
Sbjct  24   EKMEHDETGCQAPPEGPILCINNCGFFGSPATMNMCSKCHKDMLLKQEQAKLAASSIAAA  83

Query  503  KXPRXGFRRLSP--------------ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSP  366
            +          P               +T P     +  TVA  EK              
Sbjct  84   ENGSSSTTASEPVFAASVDTQLNTVEPKTIPKQPACDSVTVATVEK--------------  129

Query  365  PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
              K    RCS C ++VGLTGF CRCG +FCG  RYSD+ DC +DY++ GR+AIA+ NP
Sbjct  130  -PKEGPTRCSSCNKRVGLTGFSCRCGNIFCGTHRYSDKHDCPFDYRSAGRNAIAKANP  186



>ref|XP_004135920.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 1 [Cucumis sativus]
 ref|XP_004135921.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 2 [Cucumis sativus]
 gb|KGN45145.1| hypothetical protein Csa_7G428820 [Cucumis sativus]
Length=172

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 81/162 (50%), Gaps = 6/162 (4%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC NNCG  G+ AT NMC KC   F      A L +++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKV  318
               G + +    T  + +  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNARSIVEK---VKESPNRCSSCRKRV  120

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ +CS+DY+A GR+AIA+ NP
Sbjct  121  GLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANP  162



>ref|XP_004158200.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 1 [Cucumis sativus]
 ref|XP_004158201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 2 [Cucumis sativus]
 ref|XP_004158202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 3 [Cucumis sativus]
 ref|XP_004158203.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 4 [Cucumis sativus]
Length=172

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 81/162 (50%), Gaps = 6/162 (4%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC NNCG  G+ AT NMC KC   F      A L +++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKV  318
               G + +    T  + +  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNVRSIVEK---VKESPNRCSSCRKRV  120

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ +CS+DY+A GR+AIA+ NP
Sbjct  121  GLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANP  162



>ref|XP_011078867.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 81/162 (50%), Gaps = 20/162 (12%)
 Frame = -1

Query  647  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSP  468
             PE   LCVNNCG  G+ AT NMC KC              I  +   K        +  
Sbjct  11   APEGPILCVNNCGFFGSAATMNMCSKCHKDM----------ILKQQQAKLAATSIENIVN  60

Query  467  ERTSPDXKR---REDXTVARGEKTVeeeeeeeEN------RSPPAKREV-NRCSGCRRKV  318
              +S + K     E   V  G   ++ +  ++ +       S P  +EV NRC+ CR++V
Sbjct  61   GSSSSNQKEPVLAEAVKVEAGSVELKTDALQQSSDLLSVPSSEPKPKEVPNRCTTCRKRV  120

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF C+CG LFC   RYSD+ +C +DY+  GRDAIA+ NP
Sbjct  121  GLTGFNCKCGNLFCSVHRYSDKHECPFDYRTAGRDAIAKANP  162



>ref|XP_006487967.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Citrus sinensis]
Length=156

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 73/146 (50%), Gaps = 11/146 (8%)
 Frame = -1

Query  629  LCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTSPD  450
            LCVNNCG  G+P T N+C KCF      A   S+A H                 ER + D
Sbjct  12   LCVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSAKHALNQTLISSSSVDLSLRERPATD  71

Query  449  XKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  270
             +       A  EK   E        +P      NRC  CRR+VGLTGF+CRCG +FCG 
Sbjct  72   VE-----VAAEAEKPPAEVA------APVQSTAANRCMTCRRRVGLTGFKCRCGSVFCGT  120

Query  269  XRYSDRXDCSYDYKAXGRDAIARENP  192
             RY ++  CS+D+K  G++ IAR NP
Sbjct  121  HRYPEQHACSFDFKEMGKEQIARANP  146



>emb|CDP09861.1| unnamed protein product [Coffea canephora]
Length=166

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 76/151 (50%), Gaps = 10/151 (7%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P   TLC N CG  G+PAT N+C KC++               +  +   +    +L   
Sbjct  16   PSEPTLCANGCGFFGSPATMNLCSKCYNDFQM----------EEQQKAAAKVALEKLVTS  65

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
            +   D         + G   V+ E +EE   +P A  + NRC  C +KVG+ GF CRCG 
Sbjct  66   QKKADDAFHVGSPESYGTAAVQVERQEEAASAPAAVVKSNRCFCCNKKVGVMGFTCRCGS  125

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             FCG  RY ++ DC++D+K  GRDAIA+ NP
Sbjct  126  TFCGLHRYPEKHDCTFDFKGQGRDAIAKANP  156



>ref|XP_009770813.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana sylvestris]
Length=172

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 85/169 (50%), Gaps = 20/169 (12%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+  T          I  +   K    
Sbjct  4    DETGCQSHPEGPILCINNCGFFGSAANMNMCSKCYKDT----------ILKQEQAKLAAT  53

Query  488  GFRRL----SPERTSPDXKRREDXTVARGE-KTVeeeeeeeENRSPPA---KREV--NRC  339
                L    +     P      D   A  E K+V        + +  A   K +V  +RC
Sbjct  54   SIENLVNGSNASEKGPVVVDSVDMQPAVLETKSVVALSSPPSSSAGEAAELKTKVGPSRC  113

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S C++KVGLTGF+CRCG L+CG  RYSD+ DC +DY++ GRDAIA+ NP
Sbjct  114  SSCKKKVGLTGFKCRCGNLYCGSHRYSDKHDCQFDYRSAGRDAIAKANP  162



>ref|XP_008795703.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795704.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
Length=171

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 76/158 (48%), Gaps = 14/158 (9%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC             A            G    S  
Sbjct  11   PEAPILCINNCGFFGSAATMNMCSKCHKDLILKQEQAKLA-------SSSINGIVNGSGS  63

Query  464  RTSPDXKRREDXTVARGE---KTVeeeeeeeENRSPPAKREV----NRCSGCRRKVGLTG  306
             +  +    E+  VA G    KT+     +    S   + +V    NRCS CR++VGLTG
Sbjct  64   SSGKEPIVSENANVAVGPVEPKTISAHLSDSTVISEGGETKVKVGPNRCSTCRKRVGLTG  123

Query  305  FRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            F CRCG LFC   RYS+  +C +DY+  GRDAIA+ NP
Sbjct  124  FNCRCGNLFCATHRYSEEHNCPFDYRTAGRDAIAKANP  161



>ref|XP_011075194.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011075195.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011075196.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 67/152 (44%), Gaps = 0/152 (0%)
 Frame = -1

Query  647  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSP  468
             PE   LC+NNCG  G+ AT NMC KC             A                  P
Sbjct  11   APEGPILCINNCGFFGSAATMNMCSKCHKDMILKQQQAKLAASSIENIVNGSSNSNEKEP  70

Query  467  ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCG  288
               +P         +         +     N     K   NRC+ C ++VGLTGF CRCG
Sbjct  71   LLANPVDVEAGPLELKAASPQPSPDLASLPNSEMKVKEGPNRCTTCHKRVGLTGFSCRCG  130

Query  287  ELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             LFC   RYSD+ DC +DY+A GRDAI++ NP
Sbjct  131  NLFCSTHRYSDKHDCPFDYQAAGRDAISKANP  162



>ref|XP_006660259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Oryza brachyantha]
Length=118

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -1

Query  371  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S  ++  VNRC  CR++VGLTGFRCRCGELFCG  RYSDR DCS+DYK+  RDAIARENP
Sbjct  49   SKASRSSVNRCHSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCSFDYKSAARDAIARENP  108


 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF  564
            MAQ+  K E   ++    +TLC N+CG  GNPAT N+CQ CF
Sbjct  1    MAQRDKKVEEPTELRAPEMTLCANSCGFPGNPATKNLCQNCF  42



>gb|ABK21003.1| unknown [Picea sitchensis]
 gb|ACN40831.1| unknown [Picea sitchensis]
Length=180

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 97/176 (55%), Gaps = 16/176 (9%)
 Frame = -1

Query  689  MAQKTG---KEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF-------sattaaag  540
            MAQ++    KEET  +V PE +  C NNCG  G+PAT ++C KC+       S  ++   
Sbjct  1    MAQESWNREKEETGCQV-PEGLIRCANNCGFFGSPATMSLCSKCYREFVLLNSPKSSFDK  59

Query  539  lxsaAIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPA  360
                 I  +     P  G   +  +  + D       T A      + E ++++N  PP 
Sbjct  60   PQQQQIQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAH-----QLEPQQQQNPPPPP  114

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             R+ NRC  CR++VGLTGFRCRCG++FC   RYSD+ +C+YDYK  GR+AIA+ NP
Sbjct  115  PRQTNRCFSCRKRVGLTGFRCRCGDMFCALHRYSDKHNCTYDYKTAGREAIAKANP  170



>ref|XP_004513638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Cicer arietinum]
Length=160

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = -1

Query  629  LCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRL-SPERTSP  453
            LCVNNCG  G  AT NMC KC+  T          +  +  +K        + S   T  
Sbjct  12   LCVNNCGFFGRAATMNMCSKCYKDT----------MLKQEQDKLATASVENIVSGSSTYN  61

Query  452  DXKRREDXTV--ARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELF  279
            + +   D  V    G   +  +    EN     K   +RC+ CR++VGLTGF C+CG LF
Sbjct  62   EKQVVTDNAVDGKVGNVEISGDSSSGENLETKVKTGPSRCAACRKRVGLTGFTCKCGNLF  121

Query  278  CGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            C   RYSD+ DC +DY++ GRDAIA+ NP
Sbjct  122  CAMHRYSDKHDCPFDYQSVGRDAIAKSNP  150



>ref|XP_004513637.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Cicer arietinum]
Length=166

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 13/149 (9%)
 Frame = -1

Query  629  LCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRL-SPERTSP  453
            LCVNNCG  G  AT NMC KC+  T          +  +  +K        + S   T  
Sbjct  18   LCVNNCGFFGRAATMNMCSKCYKDT----------MLKQEQDKLATASVENIVSGSSTYN  67

Query  452  DXKRREDXTV--ARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELF  279
            + +   D  V    G   +  +    EN     K   +RC+ CR++VGLTGF C+CG LF
Sbjct  68   EKQVVTDNAVDGKVGNVEISGDSSSGENLETKVKTGPSRCAACRKRVGLTGFTCKCGNLF  127

Query  278  CGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            C   RYSD+ DC +DY++ GRDAIA+ NP
Sbjct  128  CAMHRYSDKHDCPFDYQSVGRDAIAKSNP  156



>ref|XP_006365818.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=159

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 84/167 (50%), Gaps = 22/167 (13%)
 Frame = -1

Query  686  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXG  507
            AQK  KEETE KV PE+I LC     V                +                
Sbjct  3    AQKREKEETELKV-PESIPLCSPTLPVPSPSPPPTTHLSVALISDL--------------  47

Query  506  EKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG--  333
            ++  R    R+  + +S D + R   + A  E T     +    R    +RE NRCSG  
Sbjct  48   KRSDRSSTERVDLKVSSMDDQSR-STSAASPESTDLVGRKTGVKR----QREANRCSGIG  102

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CRRKVGL  FRCRCGE+FC E RYSDR DCSYDYKA GR+AIA+ENP
Sbjct  103  CRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  149



>gb|ACG26325.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG28071.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
Length=171

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 79/158 (50%), Gaps = 14/158 (9%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFs-------attaaaglxsaAIHHKXGEKXPRXG  486
            PE   LC+NNCG  G+ AT NMC KC             AA    + ++   G K P   
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEMITKQEQAQLAASSIDSIVNGGDGGKGP---  67

Query  485  FRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTG  306
               +     +    + E  T+   +  +  E  E     P AK   +RC+ CR++VGLTG
Sbjct  68   ---VIAASVNAAVPQVEQKTIVV-QPMLVAETSEAAAVIPKAKEGPDRCAACRKRVGLTG  123

Query  305  FRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            F CRCG ++C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  124  FSCRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANP  161



>dbj|BAJ90521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -1

Query  362  AKREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +K  VNRC  CR++VGLTGFRCRCGE+FCG  RYSDR DCSYDYK+  RDAIARENP
Sbjct  95   SKSSVNRCHNCRKRVGLTGFRCRCGEMFCGAHRYSDRHDCSYDYKSAARDAIARENP  151


 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 28/44 (64%), Gaps = 2/44 (5%)
 Frame = -1

Query  689  MAQKTGK--EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF  564
            MAQ+  K  E TE  +    ITLC N+CG  GNPAT N+CQ CF
Sbjct  1    MAQRDKKVEEPTEVHLHAAEITLCANSCGFPGNPATKNLCQNCF  44



>ref|XP_007206025.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
 gb|EMJ07224.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
Length=168

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 81/147 (55%), Gaps = 11/147 (7%)
 Frame = -1

Query  632  TLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTSP  453
             +CVNNCG  G+  TNN+C KC+          +A      G+K        +S      
Sbjct  22   IMCVNNCGFFGSEKTNNLCSKCYKDFLLKQSKTAADDTAVVGKK--------VSAGDQDL  73

Query  452  DXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  273
            + KR     +   +++  EE    EN   P KR  NRC+ CR++VGLTGF+CRCG+ FC 
Sbjct  74   ENKRHVQQVLEEVKQSQVEEGTTSEN---PEKRPANRCNFCRKRVGLTGFKCRCGQTFCS  130

Query  272  EXRYSDRXDCSYDYKAXGRDAIARENP  192
              RYS++ +C +DYK+ G++AIA+ NP
Sbjct  131  LHRYSNKHNCVFDYKSAGQEAIAKANP  157



>ref|XP_009609312.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009609313.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=170

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 77/155 (50%), Gaps = 18/155 (12%)
 Frame = -1

Query  632  TLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTSP  453
             LCVNNCG  G+ AT NMC KC              I  +   K     F  +    +S 
Sbjct  16   ILCVNNCGFFGSAATMNMCSKCHKDM----------ILKQEQAKLAAASFDNIVNGSSSS  65

Query  452  DXKR-----REDXTVARGE-KTVeeeeeeeENRSPPAKRE--VNRCSGCRRKVGLTGFRC  297
            + K        D     GE K V  E   E   S   K +  ++RC+ CR++VGLTGF C
Sbjct  66   NDKEPVVAAVIDVQTGSGELKAVPIEASAELASSSEMKPKEGLSRCNTCRKRVGLTGFNC  125

Query  296  RCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +CG LFC   RYSD+ DC +DYK  GRDAIA+ NP
Sbjct  126  KCGNLFCAVHRYSDKHDCPFDYKNAGRDAIAKANP  160



>ref|XP_002285530.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
 ref|XP_002285528.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
Length=172

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 78/162 (48%), Gaps = 6/162 (4%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC+NNCG  G+PAT NMC KC          A L +++I        
Sbjct  4    DETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMMLKQEQAKLAASSIDSIVNGSS  63

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKV  318
               G               +E   ++         E   E +    K   NRCS C+++V
Sbjct  64   SNNGKEPAIASTVDVQVDAKEPKIISVQSSFSFGSEGSGEAKP---KEGPNRCSTCKKRV  120

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF CRCG LFC   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  121  GLTGFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANP  162



>ref|NP_001130325.1| LOC100191419 [Zea mays]
 ref|XP_008680964.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 ref|XP_008680965.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 gb|ACF78509.1| unknown [Zea mays]
 gb|ACF81174.1| unknown [Zea mays]
 gb|ACN33638.1| unknown [Zea mays]
 gb|AFW70762.1| zinc finger A20 and AN1 domain-containing protein isoform 1 [Zea 
mays]
 gb|AFW70763.1| zinc finger A20 and AN1 domain-containing protein isoform 2 [Zea 
mays]
 gb|AFW70764.1| zinc finger A20 and AN1 domain-containing protein isoform 3 [Zea 
mays]
 gb|AFW70765.1| zinc finger A20 and AN1 domain-containing protein isoform 4 [Zea 
mays]
Length=171

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 79/158 (50%), Gaps = 14/158 (9%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFs-------attaaaglxsaAIHHKXGEKXPRXG  486
            PE   LC+NNCG  G+ AT NMC KC             AA    + ++   G K P   
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEMITKQEQAQLAASSIDSIVNGGDGGKGP---  67

Query  485  FRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTG  306
               +     +    + E  T+   +  +  E  E     P AK   +RC+ CR++VGLTG
Sbjct  68   ---VIAASVNVAVPQVEQKTIVV-QPMLVAETSEAAAVIPKAKEGPDRCAACRKRVGLTG  123

Query  305  FRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            F CRCG ++C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  124  FSCRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANP  161



>gb|EPS60935.1| induced stolon tip protein [Genlisea aurea]
Length=156

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 94/166 (57%), Gaps = 20/166 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQKT  +E EFKV PETI+LCV+          + +C KC  +           ++H  
Sbjct  1    MAQKTKNDEPEFKVTPETISLCVDC-------VDSCLCHKCIISAATP-------VNHLF  46

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
             ++  R      +P    P+  R +D      + +   E E E   + P +R VNRCSGC
Sbjct  47   TDEESRSISSPPAPSSIIPET-RGDDL-----KHSGAGETEAEAAAARPLERSVNRCSGC  100

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGFRCRCGELFC E RYSDR DC YDY+A  R AIARENP
Sbjct  101  RKKVGLTGFRCRCGELFCAEHRYSDRHDCRYDYRAAARAAIARENP  146



>ref|XP_004252868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum lycopersicum]
Length=160

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = -1

Query  359  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +RE NRCSG  CRRKVGL  FRCRCGE+FC E RYSDR DCSYDYKA GR+AIA+ENP
Sbjct  93   QREANRCSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  150



>gb|ACJ83925.1| unknown [Medicago truncatula]
 gb|AFK35119.1| unknown [Medicago truncatula]
 gb|AFK43343.1| unknown [Medicago truncatula]
 gb|AES67697.2| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=172

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 77/161 (48%), Gaps = 4/161 (2%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            ++T  +  PE   LC+NNCG  G+ AT NMC KC           + A            
Sbjct  4    DQTGCEAAPEGPMLCINNCGFFGSAATMNMCSKCHKDMMLKQEQATLAASSIGNIMNGSS  63

Query  488  GFRRLSPERTSPDXKRRE--DXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVG  315
                + P  T+      +  +  +   E  V    EE   + P  K    RCS C ++VG
Sbjct  64   SSSGIEPAITANVEISVDPVEPKIISAEPLVASGSEESLEKKP--KDGPKRCSNCNKRVG  121

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF CRCG L+C   RYSD+ DC +DY+  GRDAIA+ NP
Sbjct  122  LTGFNCRCGNLYCAVHRYSDKHDCPFDYRTAGRDAIAKANP  162



>gb|ACJ86086.1| unknown [Medicago truncatula]
Length=164

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 77/161 (48%), Gaps = 4/161 (2%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            ++T  +  PE   LC+NNCG  G+ AT NMC KC           + A            
Sbjct  4    DQTGCEAAPEGPMLCINNCGFFGSAATMNMCSKCHKDMMLKQEQATLAASSIGNIMNGSS  63

Query  488  GFRRLSPERTSPDXKRRE--DXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVG  315
                + P  T+      +  +  +   E  V    EE   + P  K    RCS C ++VG
Sbjct  64   SSSGIEPAITANVEISVDPVEPKIISAEPLVASGSEESLEKKP--KDGPKRCSNCNKRVG  121

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF CRCG L+C   RYSD+ DC +DY+  GRDAIA+ NP
Sbjct  122  LTGFNCRCGNLYCAVHRYSDKHDCPFDYRTAGRDAIAKANP  162



>gb|ACM68460.1| stress-associated protein 10 [Solanum pennellii]
Length=160

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = -1

Query  359  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +RE NRCSG  CRRKVGL  FRCRCGE+FC E RYSDR DCSYDYKA GR+AIA+ENP
Sbjct  93   QREANRCSGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  150



>dbj|BAO74166.1| zinc finger protein [Cucurbita pepo subsp. pepo]
Length=176

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 78/163 (48%), Gaps = 5/163 (3%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH--KXGEKXP  495
            +ET  +  PE   LC NNCG  G+ AT N+C KC             A           P
Sbjct  5    KETGCQAPPEAPKLCANNCGFFGSAATMNLCSKCHKDVIMKQEQVKLAASSIGSIVNGGP  64

Query  494  RXGFRRLSPERTSPDXKRRED--XTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRK  321
                ++ +   TSP     E    ++   + +               K   NRCS CR++
Sbjct  65   NDHGKKAA-VVTSPTKLEIEPAVSSIIPTQPSWTSPNASSSTNIEKVKASPNRCSSCRKR  123

Query  320  VGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +GLTGF CRCG LFC   RYSD+ DC++DY+A GR+AIA+ NP
Sbjct  124  IGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANP  166



>gb|ABK26062.1| unknown [Picea sitchensis]
Length=180

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 96/176 (55%), Gaps = 16/176 (9%)
 Frame = -1

Query  689  MAQKTG---KEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF-------sattaaag  540
            MAQ++    KEET  +V PE +  C NNCG  G+PAT ++C KC+       S  ++   
Sbjct  1    MAQESWNREKEETGCQV-PEGLIRCANNCGFFGSPATMSLCSKCYREFVLLNSPKSSFDK  59

Query  539  lxsaAIHHKXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPA  360
                 I  +     P  G   +  +  + D       T A      + E ++++N  PP 
Sbjct  60   PQQQQIQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAH-----QLEPQQQQNPPPPP  114

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             R+ NRC  CR++VGLTGFRCRCG++FC   RYSD+  C+YDYK  GR+AIA+ NP
Sbjct  115  PRQTNRCFSCRKRVGLTGFRCRCGDMFCALHRYSDKHKCTYDYKTAGREAIAKANP  170



>gb|EYU46288.1| hypothetical protein MIMGU_mgv1a015852mg [Erythranthe guttata]
Length=143

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 80/173 (46%), Gaps = 47/173 (27%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQK  KEETE KV PE I +C     ++  P                            
Sbjct  1    MAQKRDKEETELKV-PENIPICTPPQTISPPPQI--------------------------  33

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENR-----SPPAKREVN  345
                         P   SP+    +    A  ++T      +  NR     S    RE  
Sbjct  34   -------------PSTRSPEISDPKISAAACSQRTSCAISPDLVNRAENRGSLKRPREAT  80

Query  344  RCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCSG  CR+++GL GFRCRCG++FC E RYSDR DCSYDYKA GRDAIA+ENP
Sbjct  81   RCSGSGCRKRIGLVGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGRDAIAKENP  133



>ref|XP_009376157.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376158.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376159.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376160.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379443.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379444.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379445.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379446.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=169

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 75/161 (47%), Gaps = 7/161 (4%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            EET  +  PE   LCVNNCG  G+ AT NMC KC             A     G    R 
Sbjct  4    EETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDMVLKQEQAKLAAS-SFGSIVNRT  62

Query  488  GFRRLSPERTSPDXKRR--EDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVG  315
                 +    S D +    E  T++              +   P   +  RC+ C ++VG
Sbjct  63   SSINANEHVASVDVQPHPMEPKTLSSQPSF----SFGSGSSGEPKPEDPKRCNTCNKRVG  118

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF CRCG LFC   RYSD+ DCSYDY   G+DAIA+ NP
Sbjct  119  LTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANP  159



>ref|XP_009765432.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nicotiana sylvestris]
Length=226

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 47/57 (82%), Gaps = 2/57 (4%)
 Frame = -1

Query  356  REVNRC--SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RE NRC   GCRRKVGL  FRCRCGE+FC E RYSDR DCSYDYKA GRDAIARENP
Sbjct  160  REANRCCGIGCRRKVGLLPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGRDAIARENP  216



>ref|XP_009374543.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009374550.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009374557.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009374561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 69/159 (43%), Gaps = 0/159 (0%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            EET  +  PE   LCVNNCG  G+ AT NMC KC             A            
Sbjct  4    EETGCQAAPEGPILCVNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLT  309
                  P   +     +      +   +         +   P      RC+ C ++VGLT
Sbjct  64   SISANEPVVAAATVDVQPHPVEPKTLSSQPSFSFGSGSSGEPKPEGPKRCNTCNKRVGLT  123

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GF CRCG LFC   RYSD+ DC YDY+  GRDAIA+ NP
Sbjct  124  GFNCRCGHLFCAVHRYSDKHDCPYDYRTAGRDAIAKANP  162



>ref|XP_009596933.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=142

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 80/171 (47%), Gaps = 44/171 (26%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQK  KEETE KV PETI L       T +P                         H  
Sbjct  1    MAQKREKEETELKV-PETIPLRTPTITGTDDPT------------------------HAS  35

Query  509  GEKXPRXGFRRLSPERTS---PDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
              K P     R   +  S   P+ K   +    R  K +              + E NRC
Sbjct  36   DPKLPNFNGSRPRSDLVSQPQPEKKPAGEDNNRRSMKRL--------------REEANRC  81

Query  338  SG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            SG  CRRKVGL GFRCRCGE+FC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  82   SGIGCRRKVGLIGFRCRCGEVFCYEHRYSDRHSCSYDYKAAGREAIARENP  132



>gb|ABI31653.1| zinc finger protein [Camellia sinensis]
Length=173

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 78/169 (46%), Gaps = 17/169 (10%)
 Frame = -1

Query  671  KEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGE----  504
            + ET  +V P+   LCVNNCG  G+ AT N C KC             A           
Sbjct  3    QNETGCQVPPDAPMLCVNNCGFFGSAATMNPCSKCHKDLMLKQQQTELAASSIGSIANGG  62

Query  503  -----KXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRC  339
                 K P      +  +  S D       ++    +++  E        PP     NRC
Sbjct  63   SGSPGKEPDSAITTVHVDAGSSDSMI---VSMQASHESLLNENNVIVKEVPP-----NRC  114

Query  338  SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S CR++VGLTGF CRCG LFC   RYSD+ DC +DY++  +DAIA+ NP
Sbjct  115  SACRKRVGLTGFNCRCGNLFCAVHRYSDKHDCPFDYRSAAQDAIAKANP  163



>ref|XP_010911243.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Elaeis guineensis]
 ref|XP_010911244.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Elaeis guineensis]
Length=161

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 74/146 (51%), Gaps = 8/146 (5%)
 Frame = -1

Query  629  LCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTSPD  450
            LC NNCG  G+PAT N+C KC+          ++A                 +   TSP 
Sbjct  13   LCANNCGFFGSPATLNLCSKCYRDYRLKEEQAASAKIAVEKSFASSSSSSPSAVAVTSPA  72

Query  449  XKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE  270
               R    +   E  V        + + P   + +RC+ CR++VGLTGF+CRCG  +CG 
Sbjct  73   GDARSPVALTLPEAAV--------SETSPVASQTSRCTACRKRVGLTGFKCRCGSTYCGG  124

Query  269  XRYSDRXDCSYDYKAXGRDAIARENP  192
             RY ++  C++D+KA GR+AIAR NP
Sbjct  125  HRYPEQHGCTFDFKAAGREAIARANP  150



>emb|CDP20562.1| unnamed protein product [Coffea canephora]
Length=159

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 88/171 (51%), Gaps = 32/171 (19%)
 Frame = -1

Query  683  QKTGKEETEFKVVPETITLCVNNCGV----TGNPATNNMCQKCFsattaaaglxsaAIHH  516
            QK  KEETE KV PE++TLC     V      +P +N+                      
Sbjct  4    QKREKEETELKV-PESLTLCTPTIPVPPPQLDDPRSNSA--------------------R  42

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE-VNRC  339
                  P+         R+SP    R D  ++ G     + +  E NRS    R+ VNRC
Sbjct  43   SPESSDPKLLVNGDDNLRSSPLSPERSD-LISVG---AVDGKGVELNRSLKRPRDAVNRC  98

Query  338  S--GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            S  GCRRK+GL GFRCRCG++FC E RYSDR DCSYDYK  GR+AIARENP
Sbjct  99   SCTGCRRKLGLMGFRCRCGDMFCSEHRYSDRHDCSYDYKTAGREAIARENP  149



>ref|XP_002323304.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 ref|XP_006373771.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 ref|XP_011033292.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033293.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033294.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033295.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 gb|ABK94854.1| unknown [Populus trichocarpa]
 gb|ABK96387.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05065.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 gb|ERP51568.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
Length=170

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 75/159 (47%), Gaps = 18/159 (11%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC              I ++   +        +   
Sbjct  12   PEGPILCINNCGFFGSAATMNMCSKCHKDI----------ILNQQQAQLAASSIESIVNG  61

Query  464  RTS-----PDXKRREDXTVARGEKTVeeeeeeeENRSPP---AKREVNRCSGCRRKVGLT  309
             +S     P      D   A  E  +   E    +  P    AK   +RC+ CR++VGLT
Sbjct  62   NSSGNGKEPVVAGAVDVQAAPVEVKIISTEPSIASSKPSEMKAKEGPSRCTACRKRVGLT  121

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GF CRCG LFC   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  122  GFGCRCGNLFCAIHRYSDKHDCPFDYRTAARDAIAKANP  160



>ref|XP_010545575.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=170

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 73/151 (48%), Gaps = 2/151 (1%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+PAT NMC KC  A        +       G        +  S  
Sbjct  12   PECPKLCINNCGFFGSPATMNMCSKCHKAMLFQQEQGAKLASVVSGSSSSINASKETSVA  71

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
                  K  E         +   +        P  K   +RCS C ++VGLTGF+CRCG 
Sbjct  72   SADVQAKPVEPNAGFLQSSSSATDTGVAVEAKP--KEGPSRCSTCNKRVGLTGFKCRCGI  129

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LFCG  RY+D+ DCS++Y A  ++AIA++NP
Sbjct  130  LFCGSHRYADKHDCSFNYHAAAQEAIAKDNP  160



>ref|NP_001058066.1| Os06g0612800 [Oryza sativa Japonica Group]
 sp|A2YEZ6.2|SAP8_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Indica Group]
 sp|A3BDI8.1|SAP8_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Japonica Group]
 dbj|BAD35521.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD35553.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAF19980.1| Os06g0612800 [Oryza sativa Japonica Group]
 gb|EAZ37627.1| hypothetical protein OsJ_21962 [Oryza sativa Japonica Group]
 dbj|BAG96476.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91568.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87267.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 77/161 (48%), Gaps = 20/161 (12%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC              I  +   K        +   
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEM----------IMKQEQAKLAASSIDSIVNG  60

Query  464  RTS---PDXKRREDXTVARGE-KTVeeeeeeeENRS------PPAKREVNRCSGCRRKVG  315
              S   P      +  VA+ E KT+  +  E    S      P  +   NRCS CR++VG
Sbjct  61   GDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVG  120

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF CRCG L+C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  121  LTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANP  161



>ref|XP_010228642.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X3 [Brachypodium distachyon]
Length=155

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 85/166 (51%), Gaps = 21/166 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+   EET     PE   LC+NNCG  G+  T NMC KC+  T     + + A     
Sbjct  1    MAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVA  57

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                       +  E + P         V  G++ VEEE  +     PP+    NRC  C
Sbjct  58   VASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAPK-----PPS----NRCLSC  99

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGFRCRCG+ FC   RY+D   C++DYK  GR+ IA++NP
Sbjct  100  RKKVGLTGFRCRCGDTFCSMHRYADAHKCTFDYKQAGREQIAKQNP  145



>gb|ABS72032.1| putative AN1-like zinc finger protein, partial [Olea europaea]
Length=76

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 2/57 (4%)
 Frame = -1

Query  356  REVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            REV RCSG  CR+K+GL GFRCRCGE+FC E RYSDR DC+YDYKA GR+AIARENP
Sbjct  10   REVTRCSGSGCRKKIGLIGFRCRCGEMFCSEHRYSDRHDCNYDYKAAGREAIARENP  66



>gb|ACM68459.1| stress-associated protein 9 [Solanum pennellii]
Length=156

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 79/167 (47%), Gaps = 20/167 (12%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MA++ G E       PE   LC NNCG  G+P T N C KC+             ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCY-----------NEVYIKG  43

Query  509  GEKXPRXGFRRLSPERTSPDXKR-REDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
            G + P        P+   P           A  E+  E           P   + NRCS 
Sbjct  44   GLQKPIDSL--FPPQLPIPSTSSILVLQESAAAEEEPEVVTAAVAVAVQPIPAQPNRCSA  101

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR+KVGLTGF+CRCG  FCG  RY +   CS+D+K+ GR+AIA+ NP
Sbjct  102  CRKKVGLTGFKCRCGTTFCGTHRYPEIHGCSFDFKSIGREAIAKANP  148



>ref|XP_006842203.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
 gb|ERN03878.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
Length=168

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 84/173 (49%), Gaps = 22/173 (13%)
 Frame = -1

Query  689  MAQKTGKEETE--FKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ++ K + E      P+    C N CG  G+ +TNN+C KC+             I  
Sbjct  1    MAQESKKRDAEDMGHEPPKGPIFCANKCGFFGSASTNNLCSKCYKDFYLKQLKEDENITD  60

Query  515  K-----XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE  351
            K       E   +     L   + S D K+ +   V            +  +   P K+ 
Sbjct  61   KVIPCLNNEPNAKVDAANL---QNSEDGKKNKGVVV------------DGTSSEEPQKQA  105

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             NRC  CR++VGL GFRCRCG LFC   RYSD+ +CS+DY+A G+DAIA+ NP
Sbjct  106  PNRCRLCRKRVGLAGFRCRCGGLFCSTHRYSDKHNCSFDYRASGQDAIAKANP  158



>ref|XP_009419155.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419156.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419157.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
Length=175

 Score = 96.3 bits (238),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 75/157 (48%), Gaps = 6/157 (4%)
 Frame = -1

Query  647  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSP  468
             PE   LC+NNCG  G+ AT NMC KC             A            G    S 
Sbjct  10   APEGPILCINNCGFFGSAATMNMCSKCHREMILKQEQAKLAAS-SIDNLVNGSGGDICSS  68

Query  467  ERTSPDXKRREDXTVARGE-KTVeeeeeeeENRS----PPAKREVNRCSGCRRKVGLTGF  303
                P      D T+  GE K +  +  E    S      AK   NRCS CR++VGLTGF
Sbjct  69   NGKEPVISAVTDVTIVSGELKAIPSQSPEVLCSSGSGEAKAKNGPNRCSTCRKRVGLTGF  128

Query  302  RCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +CRCG+LFC   RYSD+  C +DY+   RDAIA+ NP
Sbjct  129  QCRCGDLFCTTHRYSDKHGCPFDYQRAARDAIAKANP  165



>ref|XP_010928496.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Elaeis guineensis]
 ref|XP_010928497.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Elaeis guineensis]
Length=171

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 75/161 (47%), Gaps = 20/161 (12%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRL---  474
            PE   LC+NNCG  G+ AT NMC KC              I  +   K        +   
Sbjct  11   PEAPILCINNCGFFGSAATMNMCSKCHQDL----------ILKQEQAKLASSSINDIVNG  60

Query  473  --SPERTSPDXKRREDXTVARGE-KTVeeeeeeeENRSPPAKREV----NRCSGCRRKVG  315
              S     P      D  V   E KT+     +    S   + +V    NRCS CR++VG
Sbjct  61   SGSSSGEEPIVSGNADVAVGPVEPKTISAHLSDSTVISEGGETKVKVGPNRCSTCRKRVG  120

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF CRCG LFC   RYS+  +C +DY+  GRDAIA+ NP
Sbjct  121  LTGFNCRCGNLFCATHRYSEEHNCPFDYRTAGRDAIAKANP  161



>ref|XP_010228638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Brachypodium distachyon]
Length=163

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 85/166 (51%), Gaps = 21/166 (13%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            MAQ+   EET     PE   LC+NNCG  G+  T NMC KC+  T     + + A     
Sbjct  9    MAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVA  65

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                       +  E + P         V  G++ VEEE  +     PP+    NRC  C
Sbjct  66   VASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAPK-----PPS----NRCLSC  107

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R+KVGLTGFRCRCG+ FC   RY+D   C++DYK  GR+ IA++NP
Sbjct  108  RKKVGLTGFRCRCGDTFCSMHRYADAHKCTFDYKQAGREQIAKQNP  153



>ref|XP_004288126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
 ref|XP_004288127.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
Length=167

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 77/151 (51%), Gaps = 19/151 (13%)
 Frame = -1

Query  632  TLCVNNCGVTGNPATNNMCQKCFs----attaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
             LCVNNCG  G+  TN++C KC+       +  A   +  + +K GE     G   ++  
Sbjct  22   ILCVNNCGYYGSAKTNDLCSKCYKEFLLTQSKGAVEGTVIVENKVGE----GGANVVNKS  77

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
                  +      V  G  +             P KR  NRCS CR++VGLTGF+CRCG+
Sbjct  78   HVEQVVEEVRQSQVEEGTTS-----------ENPEKRPANRCSFCRKRVGLTGFKCRCGD  126

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             FC   RYS+  +C +DYK+ G+DAIA+ NP
Sbjct  127  TFCSLHRYSNSHNCMFDYKSAGQDAIAKANP  157



>ref|XP_010279014.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=172

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 75/167 (45%), Gaps = 31/167 (19%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LCVNNCG  G+ AT NMC KC               H     K  +      S E
Sbjct  11   PEGPILCVNNCGFFGSAATMNMCSKC---------------HKDLVLKQEQAKLAASSIE  55

Query  464  RT-----------SPDXKRREDXTVARGE-KTVeeeeeeeENRSPPAKREV----NRCSG  333
                          P      D ++   E K +  +       S   + +V    NRCS 
Sbjct  56   NIVNGSSSSSNGKEPVVAGSVDVSIGSVEPKLISTQVSSASASSEGVEVKVKEGPNRCSS  115

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR++VGLTGF CRCG +FC   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  116  CRKRVGLTGFNCRCGNIFCAVHRYSDKHDCPFDYRTAARDAIAKANP  162



>ref|XP_003557802.2| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X1 [Brachypodium distachyon]
Length=226

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 86/167 (51%), Gaps = 21/167 (13%)
 Frame = -1

Query  692  RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHK  513
            RMAQ+   EET     PE   LC+NNCG  G+  T NMC KC+  T     + + A    
Sbjct  71   RMAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKV  127

Query  512  XGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSG  333
                        +  E + P         V  G++ VEEE  +     PP+    NRC  
Sbjct  128  AVASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAPK-----PPS----NRCLS  169

Query  332  CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CR+KVGLTGFRCRCG+ FC   RY+D   C++DYK  GR+ IA++NP
Sbjct  170  CRKKVGLTGFRCRCGDTFCSMHRYADAHKCTFDYKQAGREQIAKQNP  216



>emb|CBI16408.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 73/159 (46%), Gaps = 40/159 (25%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            +ET  +  PE   LC+NNCG  G+PAT NMC KC                          
Sbjct  4    DETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMML--------------------  43

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLT  309
                           ++E   +A       E   E + +  P     NRCS C+++VGLT
Sbjct  44   ---------------KQEQAKLASSFSFGSEGSGEAKPKEGP-----NRCSTCKKRVGLT  83

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GF CRCG LFC   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  84   GFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANP  122



>ref|XP_002285543.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=126

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +REVNRCSGC+RK+GL GFRCRCGE+FC + RYSDR +C +DYKA GR+ IA+ENP
Sbjct  61   RREVNRCSGCKRKLGLIGFRCRCGEMFCSKHRYSDRHECRFDYKAAGREMIAKENP  116



>ref|XP_010540147.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 7-like [Tarenaya hassleriana]
 ref|XP_010540154.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 7-like [Tarenaya hassleriana]
Length=167

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 76/151 (50%), Gaps = 6/151 (4%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P    LC N CG  G+P+  N+C KC+    A     +AA         P      L+PE
Sbjct  13   PSEPKLCANGCGFFGSPSNMNLCSKCYRDLRAMEDQKAAAKAAVEKSFKPSL----LTPE  68

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  285
            + +       +  V  G  T         ++  P +   NRCS C +KVG+ GF+C+CG 
Sbjct  69   QPAKPVPASAEAAVVNG--TEPTATPGAADKHEPPRHPSNRCSSCNKKVGVMGFKCKCGS  126

Query  284  LFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             FCG+ RY ++ +CS+D+K  GRDAIA+ NP
Sbjct  127  TFCGDHRYPEKHECSFDFKEAGRDAIAKANP  157



>emb|CBI16411.3| unnamed protein product [Vitis vinifera]
Length=142

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  359  KREVNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +REVNRCSGC+RK+GL GFRCRCGE+FC + RYSDR +C +DYKA GR+ IA+ENP
Sbjct  77   RREVNRCSGCKRKLGLIGFRCRCGEMFCSKHRYSDRHECRFDYKAAGREMIAKENP  132



>ref|XP_009365001.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 67/158 (42%), Gaps = 0/158 (0%)
 Frame = -1

Query  665  ETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXG  486
            ET  +  PE   LC NNCG  G+PAT N+C KC                           
Sbjct  5    ETGCQAPPEAPKLCANNCGFFGSPATMNLCSKCHKDLVLKQEQAKVVAASIDSAVNGSPS  64

Query  485  FRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTG  306
                 P  T+    +     V                R    K    RC  CR++VGLTG
Sbjct  65   ESGKGPVATAAVDVQAGPADVMLISTQASSTPSLNIKREEKVKETPTRCGTCRKRVGLTG  124

Query  305  FRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            F CRCG+LFC   RYSD+ +C YDY+   +DAIA+ NP
Sbjct  125  FSCRCGDLFCAVHRYSDKHNCPYDYRTAAQDAIAKANP  162



>gb|EPS60974.1| hypothetical protein M569_13826 [Genlisea aurea]
Length=150

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 75/147 (51%), Gaps = 22/147 (15%)
 Frame = -1

Query  629  LCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPERTSPD  450
            +CVNNCG  GNPA  N+C KC++               K G+          SP  T   
Sbjct  15   MCVNNCGFLGNPAKQNLCSKCYTVLCL----------EKSGD----------SPIFTPAL  54

Query  449  XKRREDXTVARGEKT-VeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCG  273
                E  T      T ++E+     + + P+ R   RCS CR+KVGL GF CRCG  FCG
Sbjct  55   SFSLEKSTAESVSPTQIDEKSATATSHALPSSRG-GRCSACRKKVGLFGFTCRCGASFCG  113

Query  272  EXRYSDRXDCSYDYKAXGRDAIARENP  192
              RY ++  CS+D+KA GRDAIA+ NP
Sbjct  114  THRYPEKHGCSFDFKAAGRDAIAKANP  140



>ref|XP_010105325.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 [Morus notabilis]
 gb|EXC04346.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 [Morus notabilis]
Length=168

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 71/152 (47%), Gaps = 4/152 (3%)
 Frame = -1

Query  647  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSP  468
             PE   LC+NNCG  G  ATNNMC KCF  T         A            G   +  
Sbjct  11   APERPILCINNCGFFGRAATNNMCSKCFKDTLLKQEQAKLAASSIDSIVNGGNGKEPVIA  70

Query  467  ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCRCG  288
            +         E   V     +     +  EN     K+  NRC+ CR++VGLTGF C+CG
Sbjct  71   DALDVQAGPVETEIVTTEPSSDSSSSKPVEN----VKQGPNRCTTCRKRVGLTGFNCKCG  126

Query  287  ELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             LFC   RYSD+ DC +DY+   RD IA+ NP
Sbjct  127  NLFCSSHRYSDKHDCPFDYRTAARDGIAKANP  158



>ref|XP_011080262.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=147

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 2/57 (4%)
 Frame = -1

Query  356  REVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            REV RCSG  CR+++GL GFRCRCG++FC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  81   REVTRCSGSGCRKRIGLMGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGREAIARENP  137



>ref|XP_008786424.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
Length=171

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 76/166 (46%), Gaps = 30/166 (18%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LCVNNCG  G+PAT NMC KC               H     K  +      S +
Sbjct  11   PEAPILCVNNCGFFGSPATMNMCSKC---------------HKDLLLKQEQAKLVASSVD  55

Query  464  RT----------SPDXKRREDXTVARGE-KTVeeeeeeeENRSPPAKREV----NRCSGC  330
             T           P      D  V   E KT           S   + +V    NRC+ C
Sbjct  56   STVSGSGSSSGKEPVVSWSVDFAVGPTEPKTTLAYPSNASAISKGGETKVKDGPNRCNTC  115

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGF CRCG LFC   RYSD  +C +DY++ GRDAI++ NP
Sbjct  116  RKRVGLTGFTCRCGNLFCAMHRYSDEHNCPFDYRSAGRDAISKANP  161



>ref|XP_010544226.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
 ref|XP_010544227.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
 ref|XP_010544228.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=167

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 76/161 (47%), Gaps = 25/161 (16%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKC----FsattaaaglxsaAIHHKXGEKXPRXGF--  483
            PE   LC+NNCG  G+PAT NMC KC           A L S         K    G   
Sbjct  12   PECPKLCINNCGFFGSPATMNMCSKCHKALLFQQEQGAKLASVVSGSSSTVKETVLGASM  71

Query  482  ----RRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVG  315
                + + P+  SP      D  V    K                K   +RC  C ++VG
Sbjct  72   EVQAQSMEPDAASPLPSPASDHGVGVEAKP---------------KEGPSRCIACNKRVG  116

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF+CRCG LFCG  RY+D+ DCS++Y+A  R+AIA+ NP
Sbjct  117  LTGFKCRCGSLFCGSHRYADKHDCSFNYRAVAREAIAKANP  157



>ref|XP_009618607.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=205

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 2/57 (4%)
 Frame = -1

Query  356  REVNRC--SGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RE NRC   GCRRKVGL  FRCRCGE+FC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  139  REANRCCGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENP  195



>ref|XP_009349757.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=173

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 75/157 (48%), Gaps = 11/157 (7%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P+   LCVNNCG  G  AT NMC KC+  T           +               S  
Sbjct  12   PDRPILCVNNCGFFGRAATMNMCSKCYKDTLLKQEQA----NLAASSIDSIVNGSSSSNI  67

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV------NRCSGCRRKVGLTGF  303
               P      D    R E +V   E   E+ SP  K E+      +RC+ CR++VGLTGF
Sbjct  68   VIDPVVASAVDVQAVRVETSVVSTEAYIES-SPSMKTEMKENKGPSRCTTCRKRVGLTGF  126

Query  302  RCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             C+CG  FC   RYSD+ DC +DY+  G+DAIA+ NP
Sbjct  127  NCKCGNTFCASHRYSDKHDCPFDYRTAGQDAIAKANP  163



>dbj|BAG50058.1| transcription factor C2H2 [Lotus japonicus]
Length=165

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 83/168 (49%), Gaps = 37/168 (22%)
 Frame = -1

Query  647  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSP  468
             PE   LCVNNCG +G+PAT ++C KC+                    +  R   ++ + 
Sbjct  9    APEGHRLCVNNCGFSGSPATMDLCSKCY--------------------RDIRLKEQQEAS  48

Query  467  ERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV----------------NRCS  336
             +++ +       +VA+   +         + +PPAK E                 NRC+
Sbjct  49   TKSTIETALSSSSSVAKPPSS-TSSPSPAVDLAPPAKAETASISLTAGPILQAAQPNRCA  107

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR++VGLTGF+CRC   FCG  RY ++  CS+D+K  GR+AIARENP
Sbjct  108  TCRKRVGLTGFKCRCEVTFCGAHRYPEKHACSFDFKTVGREAIARENP  155



>ref|XP_010907320.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=169

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 85/170 (50%), Gaps = 15/170 (9%)
 Frame = -1

Query  689  MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHH  516
            MAQ + K+ETE      P++ TLC NNCG  G+  TNN+C KC+             +  
Sbjct  1    MAQDSWKQETEETECQRPKSPTLCANNCGYFGSAMTNNLCSKCYRDFI---------MKQ  51

Query  515  KXGEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPA--KREVNR  342
            +     P  G  + +   T+    +RE                   ++S  A  K+  NR
Sbjct  52   QSVATPPVIGVEKAAS--TACSSVQREPAIEKSDTLDGGNLMNVGNDQSEDACDKQPTNR  109

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            C  CR+KVGLTGF+CRCG  FC   R+S+  +CS DYK+ GR  IA+ENP
Sbjct  110  CLRCRKKVGLTGFKCRCGGTFCSAHRHSETHECSIDYKSAGRQYIAKENP  159



>gb|ABI23728.1| stress-tolerance zinc finger protein [Chrysanthemum x morifolium]
Length=170

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRCS CR++VGLTGFRCRCG LFCGE RYSDR  CSYDYK+  RDAIAR+NP
Sbjct  108  VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  160



>gb|ACF80251.1| unknown [Zea mays]
Length=174

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 76/170 (45%), Gaps = 35/170 (21%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC               H +   K  +      S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSID  55

Query  464  RTSPDXKRREDXTVARGEKTVeeeee---eeENRSPPA----------------KREVNR  342
                      +  VA G  TV    +   +  N   PA                K   NR
Sbjct  56   SIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGSSEGVAAISKGGKVGPNR  114

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CS CR++VGLTGF CRCG L+C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  115  CSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP  164



>gb|EPS66139.1| hypothetical protein M569_08638, partial [Genlisea aurea]
Length=76

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 2/57 (4%)
 Frame = -1

Query  356  REVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            REV RCSG  CR++VGL GFRCRCG+LFC E RYSDR DCSYDYKA GR++IARENP
Sbjct  10   REVARCSGSGCRKRVGLVGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  66



>ref|XP_002304765.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE79744.2| zinc finger family protein [Populus trichocarpa]
Length=178

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 81/166 (49%), Gaps = 4/166 (2%)
 Frame = -1

Query  683  QKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGE  504
            QK  ++ET  +  PE   LC+NNCG  G+ AT NMC KC             A     G 
Sbjct  5    QKMDRDETGCQAPPERPILCINNCGFFGSAATMNMCSKCHKDMLLKQEQTKLA-ASSIGS  63

Query  503  KXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE--VNRCSGC  330
                     ++ E    D    +   V     TV+            AK +   +RC+ C
Sbjct  64   IVNGSASSNVN-EPVIADTINVQINAVEPKTITVQPSCASVSGERVEAKPKEGPSRCTSC  122

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +++VGLTGF+CRCG+LFC   RYSD+ DC +DY+   R+AIA+ NP
Sbjct  123  KKRVGLTGFKCRCGDLFCASHRYSDKHDCPFDYRTAAREAIAKANP  168



>gb|EYU18023.1| hypothetical protein MIMGU_mgv1a015860mg [Erythranthe guttata]
Length=143

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 2/57 (4%)
 Frame = -1

Query  356  REVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            REV RCSG  CR+++GLTGF+CRCG+ FC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  77   REVTRCSGSGCRKRIGLTGFQCRCGDTFCSEHRYSDRHDCSYDYKAAGREAIARENP  133



>ref|XP_011090386.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=143

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 2/57 (4%)
 Frame = -1

Query  356  REVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            REV RCSG  CR+++GL GFRCRCG++FC E RYSDR DCSYDYKA GR+AIARENP
Sbjct  77   REVTRCSGSGCRKRIGLMGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGREAIARENP  133



>gb|AAX14637.1| zinc finger protein [Zea mays]
 gb|ABS83244.1| AN13 [Zea mays]
 gb|ACG36018.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG48526.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|AFW87476.1| zinc finger protein1 isoform 1 [Zea mays]
 gb|AFW87477.1| zinc finger protein1 isoform 2 [Zea mays]
 gb|AFW87478.1| zinc finger protein1 isoform 3 [Zea mays]
Length=174

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 76/170 (45%), Gaps = 35/170 (21%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC               H +   K  +      S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSID  55

Query  464  RTSPDXKRREDXTVARGEKTVeeeee---eeENRSPPA----------------KREVNR  342
                      +  VA G  TV    +   +  N   PA                K   NR
Sbjct  56   SIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGPSEGVAAISKGGKVGPNR  114

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CS CR++VGLTGF CRCG L+C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  115  CSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP  164



>ref|XP_009799138.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=142

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = -1

Query  359  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            + E NRCSG  CRRKVGL GFRCRCGE+FC E RYSDR  CSYDYKA GR+AIARENP
Sbjct  75   REEANRCSGIGCRRKVGLIGFRCRCGEVFCYEHRYSDRHSCSYDYKAAGREAIARENP  132



>ref|XP_007145644.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 ref|XP_007145645.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 gb|ESW17638.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 gb|ESW17639.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
Length=172

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 6/155 (4%)
 Frame = -1

Query  647  VPETITLCVNNCGVTGNPATNNMCQKCFsattaaagl---xsaAIHHKXGEKXPRXGFRR  477
             PE   LC NNCG  G  AT NMC KC+  T          +A++ +         G + 
Sbjct  11   APERPILCTNNCGFFGRAATMNMCSKCYKDTLLKQEQDKLAAASVENIVNGGSGCSGKQA  70

Query  476  LSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRC  297
            ++           E  TV+     +  +    +N    AK   +RC+ CR++VGLTGF C
Sbjct  71   VTAGSVDVQVGNVEMKTVS---AEISGDSSSGQNLEMKAKTGPSRCATCRKRVGLTGFSC  127

Query  296  RCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +CG LFC   RYSD+ DC +DY+  GR+AIA+ NP
Sbjct  128  KCGNLFCAMHRYSDKHDCPFDYQTVGREAIAKANP  162



>ref|XP_002279037.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 [Vitis vinifera]
 emb|CAN73104.1| hypothetical protein VITISV_042893 [Vitis vinifera]
Length=141

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 82/166 (49%), Gaps = 35/166 (21%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKX  510
            M QK+ + E    +      LC NNCG  G+ ATNN+C KC+          ++ + +  
Sbjct  1    MEQKSQENEVNAAI------LCANNCGFFGSAATNNLCSKCYKEFVIKQSKEASVVEN--  52

Query  509  GEKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGC  330
                                    E+ TV  GE +    EE     SP  K   NRCS C
Sbjct  53   ------------------------ENNTV--GENSGSGIEEGAAAGSPE-KCPANRCSFC  85

Query  329  RRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            R++VGLTGF+CRCG+ FC   RYSD+ +C +DYK+  +DAIA+ NP
Sbjct  86   RKRVGLTGFKCRCGQTFCSMHRYSDKHNCVFDYKSAAQDAIAKANP  131



>gb|AAQ84334.1| stress-associated protein 8 [Oryza sativa Indica Group]
Length=171

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 77/161 (48%), Gaps = 20/161 (12%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            P+   LC+NNCG  G+ AT NMC KC              I  +   K        +   
Sbjct  11   PKGPILCINNCGFFGSAATMNMCSKCHKEM----------IMKQEQAKLAASSIDSIVNG  60

Query  464  RTS---PDXKRREDXTVARGE-KTVeeeeeeeENRS------PPAKREVNRCSGCRRKVG  315
              S   P      +  VA+ E KT+  +  E    S      P  +   NRCS CR++VG
Sbjct  61   GDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTCRKRVG  120

Query  314  LTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            LTGF CRCG L+C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  121  LTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANP  161



>ref|XP_009593342.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Nicotiana tomentosiformis]
 ref|XP_009593343.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Nicotiana tomentosiformis]
 ref|XP_009593344.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Nicotiana tomentosiformis]
Length=172

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 84/173 (49%), Gaps = 28/173 (16%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+  T          +  +   K    
Sbjct  4    DETGCQPHPEGPILCVNNCGFFGSAANMNMCSKCYRDT----------VLKQEQAKLAAS  53

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPP--------------AKRE  351
                L    T+ +    +  TV  G   V+ +  E +  + P              AK  
Sbjct  54   SIENLVNGSTASE----KGGTVVVGSIDVQPDSVEAKAVALPSSQTSSSSVVAEVKAKEG  109

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             NRC  C+++VG TGF+CRCG L+CG  RYSD+ DC +DY++  +DAIA+ NP
Sbjct  110  PNRCGTCKKRVGFTGFKCRCGNLYCGAHRYSDKHDCQFDYRSAAQDAIAKANP  162



>ref|NP_001062181.1| Os08g0504700 [Oryza sativa Japonica Group]
 sp|Q84PD8.1|SAP11_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 11; Short=OsSAP11 [Oryza sativa Japonica 
Group]
 gb|AAO72541.1| pathogenesis-related protein-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD08826.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD10163.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 gb|AAT11791.1| putative zinc finger transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF24095.1| Os08g0504700 [Oryza sativa Japonica Group]
 gb|EAZ07540.1| hypothetical protein OsI_29795 [Oryza sativa Indica Group]
 gb|EAZ43265.1| hypothetical protein OsJ_27862 [Oryza sativa Japonica Group]
Length=170

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  350  VNRCSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            VNRC  CRR+VGLTGFRCRCGEL+CG  RYSDR DCS+DYK+  RDAIARENP
Sbjct  108  VNRCHSCRRRVGLTGFRCRCGELYCGAHRYSDRHDCSFDYKSAARDAIARENP  160


 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  689  MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF  564
            MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF
Sbjct  1    MAQREKKVEEPTELRAPEMTLCANSCGFPGNPATNNLCQNCF  42



>gb|ACM68447.1| stress-associated protein 10 [Solanum lycopersicum]
Length=160

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 2/58 (3%)
 Frame = -1

Query  359  KREVNRCSG--CRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +RE NR SG  CRRKVGL  FRCRCGE+FC E RYSDR DCSYDYKA GR+AIA+ENP
Sbjct  93   QREANRSSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  150



>ref|XP_006354259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=170

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 82/162 (51%), Gaps = 8/162 (5%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF---sattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         A L +++I +      
Sbjct  4    DETGCQPHPEGPILCINNCGFFGSAANMNMCSKCYKDVILKQEQAKLAASSIENFVNGST  63

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKV  318
             + G   +      P     +    +    +   E  E   +  P+     RCS C++KV
Sbjct  64   SQKGPVIVGSVDVQPALLESKSVIFSSPPSSSSGEAAELMAKEGPS-----RCSTCKKKV  118

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GLTGF+CRCG  +CG  RYSD+ DC +DY++  R+AIA+ NP
Sbjct  119  GLTGFKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANP  160



>ref|XP_008354997.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008354998.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008354999.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=172

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 68/159 (43%), Gaps = 0/159 (0%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            EET  +  PE   LCVNNCG  G+ AT NMC KC             A            
Sbjct  4    EETGCQAAPEGPILCVNNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSFGSIVNGTS  63

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLT  309
                  P   +     +      +   +         +   P      RC+ C ++VGLT
Sbjct  64   SIBANEPVVAAATVDVQPHPVEPKTLSSQPSFSFGSGSSGEPXPEGPKRCNTCNKRVGLT  123

Query  308  GFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GF CRCG  FC   RYSD+ DC YDY+  GRDAIA+ NP
Sbjct  124  GFNCRCGHXFCAVHRYSDKHDCPYDYRTAGRDAIAKANP  162



>ref|XP_011090378.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011090379.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=167

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 79/162 (49%), Gaps = 11/162 (7%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF---sattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+         A L +++I +      
Sbjct  4    DETGCQPHPEGPVLCVNNCGFFGSAANMNMCSKCYKDLMLKQEQAKLAASSIENIVNGSS  63

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKV  318
                    + E  +      E   ++    TV           P       RC  C+++V
Sbjct  64   SGSEKESTAAEAGNAQTDLAEKKAISV--PTVNASTXXXTKEGP------KRCGTCKKRV  115

Query  317  GLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            GL GF+CRCG LFCG  RYS++ DC +DY++ GRDAIA+ NP
Sbjct  116  GLAGFKCRCGNLFCGSHRYSEKHDCPFDYRSAGRDAIAKANP  157



>ref|XP_006381027.1| hypothetical protein POPTR_0006s05520g [Populus trichocarpa]
 gb|ERP58824.1| hypothetical protein POPTR_0006s05520g [Populus trichocarpa]
Length=171

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 74/160 (46%), Gaps = 19/160 (12%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC              I  +   +        +   
Sbjct  12   PEGPILCINNCGFFGSAATMNMCSKCHKDI----------ILKQQQAQLAASSIESIVNG  61

Query  464  RTS-----PDXKRREDXTVARGEKTVeeeeeeeENRSPP----AKREVNRCSGCRRKVGL  312
             +S     P      D   A  E  +   E      S P    AK   +RC+ CR++VGL
Sbjct  62   NSSGNGKEPVVAVAVDVQSAPVEVKIISTEPSSATSSKPSEMKAKEGPSRCTSCRKRVGL  121

Query  311  TGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            TGF CRCG LFC   RYSD+ +C +DY+   RDAIA+ NP
Sbjct  122  TGFSCRCGNLFCAVHRYSDKHNCRFDYRNAARDAIAKANP  161



>ref|XP_008384532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008384535.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=169

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 78/170 (46%), Gaps = 25/170 (15%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRX  489
            EET  +  PE   LCVNNCG  G+ AT NMC KC              +  +   K    
Sbjct  4    EETGCQSAPEGPILCVNNCGFFGSAATMNMCSKCHKDM----------VLKQEQXKLAAS  53

Query  488  GFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSP-----------PAKREVNR  342
             F  +   RTS       +  VA  +      E +  +  P           P      R
Sbjct  54   SFGSIV-NRTS---SINANEPVASVDVQPHPMEPKTLSSQPSFSFGSGSSGEPKPEGPKR  109

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            C+ C ++VGLTGF CRCG LFC   RYSD+ DCSYDY   G+DAIA+ NP
Sbjct  110  CNTCNKRVGLTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANP  159



>gb|AFW87479.1| zinc finger protein1 [Zea mays]
Length=193

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 76/170 (45%), Gaps = 35/170 (21%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LC+NNCG  G+ AT NMC KC               H +   K  +      S +
Sbjct  30   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSID  74

Query  464  RTSPDXKRREDXTVARGEKTVeeeee---eeENRSPPA----------------KREVNR  342
                      +  VA G  TV    +   +  N   PA                K   NR
Sbjct  75   SIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGPSEGVAAISKGGKVGPNR  133

Query  341  CSGCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CS CR++VGLTGF CRCG L+C   RYSD+ DC +DY+   RDAIA+ NP
Sbjct  134  CSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP  183



>ref|XP_011037831.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011037832.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
Length=172

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 81/164 (49%), Gaps = 10/164 (6%)
 Frame = -1

Query  668  EETEFKVVPETITLCVNNCGVTGNPATNNMCQKC---FsattaaaglxsaAIHHKXGEKX  498
            +ET  +  PE   LC NNCG  G+ AT NMC KC          A L +++I        
Sbjct  4    DETGCQAPPEGPILCTNNCGFFGSAATMNMCSKCHKDMLLKQEQANLAASSIGSIVNGSS  63

Query  497  PRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE--VNRCSGCRR  324
                F  +  +         E  T+     TV+            AK +   NRC+ C++
Sbjct  64   SSDVFETVIADIIDVQNNAVEPKTI-----TVQPSCASGSGERVEAKPKEGPNRCTSCKK  118

Query  323  KVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +VGLTGF+CRCG LFC   RYSD+ DC +DY++  R+AIA+ NP
Sbjct  119  RVGLTGFKCRCGSLFCASHRYSDKHDCPFDYRSAAREAIAKANP  162



>ref|XP_009354716.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=171

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 73/164 (45%), Gaps = 13/164 (8%)
 Frame = -1

Query  665  ETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXG  486
            ET  +  PE   LC NNCG  G+PAT N+C KC              +    G       
Sbjct  5    ETGCQAPPEAPKLCANNCGFFGSPATMNLCSKCHKDLVLKQEQAKV-VAASIGS------  57

Query  485  FRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKRE------VNRCSGCRR  324
                SP  +           V  G   V     +  + S   K E        RC  CR+
Sbjct  58   VVNGSPTESGKGPVATAAVDVQAGSADVMLISTQASSTSLNIKSEDKVKETPTRCGTCRK  117

Query  323  KVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            +VGLTGF CRCG+LFC   RYSD+ +C YDY+   +DAIA+ NP
Sbjct  118  RVGLTGFSCRCGDLFCAVHRYSDKHNCPYDYRTAAQDAIAKANP  161



>ref|XP_010544224.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
 ref|XP_010544225.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Tarenaya hassleriana]
Length=170

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 74/155 (48%), Gaps = 10/155 (6%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXGEKXPRXGFRRLSPE  465
            PE   LCVNNCG  G+PAT NMC KC  A        +       G      G   +   
Sbjct  12   PECPKLCVNNCGFFGSPATMNMCSKCHKAMLFQEKQDAKLASAVAGS---SSGIDTVKET  68

Query  464  RTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPA----KREVNRCSGCRRKVGLTGFRC  297
             + P    +    ++ G K          +         K   +RCS C ++VGLTGF+C
Sbjct  69   VSGPSSDVQ---VISMGMKITSPPSSSASDPGITLETKPKEGPSRCSTCNKRVGLTGFKC  125

Query  296  RCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            RCG LFCG  RY+D+ DCS++Y    ++AIA+ NP
Sbjct  126  RCGNLFCGSHRYADKHDCSFNYHEAAQEAIAKANP  160



>ref|XP_002310618.2| hypothetical protein POPTR_0007s06890g [Populus trichocarpa]
 gb|EEE91068.2| hypothetical protein POPTR_0007s06890g [Populus trichocarpa]
Length=156

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 81/168 (48%), Gaps = 29/168 (17%)
 Frame = -1

Query  686  AQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFsattaaaglxsaAIHHKXG  507
            +QK   E++       T  LCVNNCG  G+P TNN+C KC+                   
Sbjct  5    SQKRKLEDSSSNEAQNTPILCVNNCGFFGSPNTNNLCSKCYK------------------  46

Query  506  EKXPRXGFRRLSPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREV---NRCS  336
                      L  ++ +          VA        E E ++      KR V   NRC+
Sbjct  47   --------EFLLTQQDTTTTTIDVPVHVAENSAAAAAEVEGQQEGGEEEKRPVVVANRCN  98

Query  335  GCRRKVGLTGFRCRCGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
             CR+KVGLTGF+CRCG  FC + RYSD+ +C +DYK+ G+DAIA+ NP
Sbjct  99   FCRKKVGLTGFKCRCGYTFCSQHRYSDKHNCVFDYKSAGQDAIAKANP  146



>ref|XP_010271706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=173

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 73/154 (47%), Gaps = 3/154 (2%)
 Frame = -1

Query  644  PETITLCVNNCGVTGNPATNNMCQKCFs---attaaaglxsaAIHHKXGEKXPRXGFRRL  474
            PE   LC NNCG  G+PAT N+C KC+         A     A+                
Sbjct  10   PEGHHLCANNCGFFGSPATLNLCSKCYRDLCLKEEQASSAKLAVEKSCAASPSSSSSADS  69

Query  473  SPERTSPDXKRREDXTVARGEKTVeeeeeeeENRSPPAKREVNRCSGCRRKVGLTGFRCR  294
            S    SP      D                + N +P +  + NRC+ CR++VGLTGF+CR
Sbjct  70   SRAPVSPLLLENPDVGRNPVNVPATVASPSKSNPAPSSASQPNRCATCRKRVGLTGFKCR  129

Query  293  CGELFCGEXRYSDRXDCSYDYKAXGRDAIARENP  192
            CG  FCG  RY ++  C +D+KA GR+AIA+ NP
Sbjct  130  CGITFCGSHRYPEQHACMFDFKAMGREAIAKANP  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520