BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029A21

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763752.1|  PREDICTED: uncharacterized protein LOC104215...    271   2e-83   Nicotiana sylvestris
ref|XP_009625540.1|  PREDICTED: uncharacterized protein LOC104116...    268   2e-82   
ref|XP_009625539.1|  PREDICTED: uncharacterized protein LOC104116...    268   2e-82   
ref|XP_010109738.1|  Cyclopropane-fatty-acyl-phospholipid synthase      253   1e-81   
ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...    270   7e-81   Nicotiana sylvestris
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...    267   4e-80   
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...    267   5e-80   
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...    268   6e-80   Nicotiana tomentosiformis
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...    268   7e-80   Nicotiana tomentosiformis
ref|XP_009617895.1|  PREDICTED: uncharacterized protein LOC104110...    261   1e-79   Nicotiana tomentosiformis
ref|XP_009780643.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    259   3e-79   Nicotiana sylvestris
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983    266   4e-79   Solanum tuberosum [potatoes]
ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476    265   7e-79   Solanum lycopersicum
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg                263   4e-78   Erythranthe guttata [common monkey flower]
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...    259   3e-77   Nicotiana tomentosiformis
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...    259   3e-77   Nicotiana tomentosiformis
ref|XP_004173387.1|  PREDICTED: probable fatty acid methyltransfe...    246   4e-77   
ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...    260   4e-77   Nicotiana tomentosiformis
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...    257   3e-76   
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg             258   3e-76   Prunus persica
ref|XP_008340641.1|  PREDICTED: uncharacterized protein LOC103403...    251   5e-76   
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...    257   6e-76   Sesamum indicum [beniseed]
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...    256   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817    256   1e-75   Fragaria vesca subsp. vesca
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...    256   2e-75   Prunus mume [ume]
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...    256   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...    256   2e-75   Nicotiana tomentosiformis
ref|XP_006606356.1|  PREDICTED: uncharacterized protein LOC100815...    250   2e-75   Glycine max [soybeans]
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...    256   2e-75   Prunus mume [ume]
ref|XP_008460676.1|  PREDICTED: pavine N-methyltransferase-like i...    249   3e-75   Cucumis melo [Oriental melon]
ref|XP_010650131.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    249   3e-75   Vitis vinifera
emb|CDY67345.1|  BnaCnng54600D                                          246   4e-75   Brassica napus [oilseed rape]
ref|XP_006589308.1|  PREDICTED: uncharacterized protein LOC100801...    249   4e-75   
ref|XP_011013987.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    246   6e-75   Populus euphratica
ref|XP_007144121.1|  hypothetical protein PHAVU_007G1305000g            250   1e-74   Phaseolus vulgaris [French bean]
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...    253   1e-74   
emb|CBI23694.3|  unnamed protein product                                253   1e-74   Vitis vinifera
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...    253   1e-74   
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...    253   1e-74   
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg             253   2e-74   Capsella rubella
ref|XP_011041421.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    243   2e-74   Populus euphratica
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765    253   2e-74   Tarenaya hassleriana [spider flower]
emb|CDY09021.1|  BnaC01g30700D                                          252   2e-74   Brassica napus [oilseed rape]
ref|XP_010317817.1|  PREDICTED: uncharacterized protein LOC101256...    252   2e-74   Solanum lycopersicum
ref|XP_010670963.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    244   3e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...    252   4e-74   Solanum lycopersicum
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865             251   7e-74   Arabidopsis lyrata subsp. lyrata
gb|KHN01041.1|  Putative fatty acid methyltransferase                   250   8e-74   Glycine soja [wild soybean]
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...    251   8e-74   
ref|XP_004307322.2|  PREDICTED: uncharacterized protein LOC101300392    233   8e-74   Fragaria vesca subsp. vesca
emb|CDO99279.1|  unnamed protein product                                251   8e-74   Coffea canephora [robusta coffee]
ref|XP_010650129.1|  PREDICTED: uncharacterized protein LOC100249...    248   9e-74   
ref|XP_006421140.1|  hypothetical protein CICLE_v10004346mg             250   1e-73   
ref|XP_009102618.1|  PREDICTED: uncharacterized protein LOC103828...    246   1e-73   Brassica rapa
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847    250   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_011029775.1|  PREDICTED: uncharacterized protein LOC105129...    245   1e-73   Populus euphratica
ref|XP_010264927.1|  PREDICTED: uncharacterized protein LOC104602...    249   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...    250   2e-73   Glycine max [soybeans]
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788    250   2e-73   
gb|KHN30725.1|  Putative fatty acid methyltransferase                   249   2e-73   Glycine soja [wild soybean]
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...    249   3e-73   Nelumbo nucifera [Indian lotus]
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...    249   3e-73   Cucumis melo [Oriental melon]
ref|XP_010488415.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    241   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...    249   3e-73   
ref|XP_010512500.1|  PREDICTED: uncharacterized protein LOC104788...    248   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...    249   5e-73   Glycine max [soybeans]
emb|CDX85109.1|  BnaC07g07970D                                          249   6e-73   
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...    248   7e-73   Citrus sinensis [apfelsine]
emb|CDX77504.1|  BnaA07g06420D                                          248   8e-73   
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...    248   8e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...    248   1e-72   Vitis vinifera
emb|CBI23697.3|  unnamed protein product                                248   1e-72   Vitis vinifera
ref|XP_009414043.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    236   1e-72   
emb|CDX77513.1|  BnaA07g06510D                                          246   1e-72   
ref|XP_011470583.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahyd...    239   1e-72   Fragaria vesca subsp. vesca
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase         247   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57657.1|  AT3g23510/MEE5_5                                        247   2e-72   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein           247   2e-72   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44154.1|  unnamed protein product                                247   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KGN61573.1|  hypothetical protein Csa_2G171940                       247   3e-72   Cucumis sativus [cucumbers]
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003    247   3e-72   Brassica rapa
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg             247   3e-72   
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731    247   3e-72   Brassica rapa
emb|CDX92987.1|  BnaA03g37090D                                          247   3e-72   
gb|KGN61577.1|  hypothetical protein Csa_2G172470                       231   3e-72   Cucumis sativus [cucumbers]
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...    246   4e-72   Brassica rapa
ref|XP_011470580.1|  PREDICTED: sterol 24-C-methyltransferase-like      232   4e-72   Fragaria vesca subsp. vesca
gb|KFK39641.1|  hypothetical protein AALP_AA3G270000                    238   5e-72   Arabis alpina [alpine rockcress]
ref|XP_011029773.1|  PREDICTED: uncharacterized protein LOC105129...    244   5e-72   Populus euphratica
ref|XP_006354535.1|  PREDICTED: pavine N-methyltransferase-like         238   5e-72   Solanum tuberosum [potatoes]
emb|CDX94854.1|  BnaC03g43340D                                          245   1e-71   
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...    245   1e-71   Populus euphratica
ref|XP_010670960.1|  PREDICTED: uncharacterized protein LOC104887...    243   2e-71   
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...    244   2e-71   Populus euphratica
ref|XP_002314494.2|  hypothetical protein POPTR_0010s07840g             236   2e-71   
dbj|BAB01742.1|  unnamed protein product                                243   2e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CAN68017.1|  hypothetical protein VITISV_025151                     244   3e-71   Vitis vinifera
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...    244   3e-71   
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    244   4e-71   Theobroma cacao [chocolate]
ref|XP_006420311.1|  hypothetical protein CICLE_v10005727mg             229   4e-71   
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg             243   5e-71   Eutrema salsugineum [saltwater cress]
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase         243   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...    243   7e-71   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX77514.1|  BnaA07g06520D                                          242   9e-71   
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase           242   1e-70   Medicago truncatula
gb|EPS65744.1|  cyclopropane fatty acid synthase                        237   2e-70   Genlisea aurea
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879    242   2e-70   
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...    241   5e-70   Populus euphratica
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...    241   5e-70   Populus euphratica
ref|XP_009586644.1|  PREDICTED: uncharacterized protein LOC104084...    239   8e-70   Nicotiana tomentosiformis
ref|XP_009388106.1|  PREDICTED: uncharacterized protein LOC103974927    229   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...    240   1e-69   Solanum tuberosum [potatoes]
gb|KDO40332.1|  hypothetical protein CISIN_1g0240962mg                  226   1e-69   Citrus sinensis [apfelsine]
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...    239   1e-69   Nicotiana tomentosiformis
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...    239   2e-69   Nicotiana tomentosiformis
gb|KDP40373.1|  hypothetical protein JCGZ_02371                         239   2e-69   Jatropha curcas
gb|KGN61575.1|  hypothetical protein Csa_2G171960                       226   2e-69   Cucumis sativus [cucumbers]
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999    239   2e-69   
ref|XP_008796359.1|  PREDICTED: uncharacterized protein LOC103711...    234   2e-69   
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase      239   2e-69   
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...    238   4e-69   Tarenaya hassleriana [spider flower]
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445    238   4e-69   Eucalyptus grandis [rose gum]
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740          238   6e-69   
ref|XP_004169418.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    233   7e-69   
ref|XP_002528810.1|  methyltransferase, putative                        237   9e-69   Ricinus communis
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444    237   1e-68   Eucalyptus grandis [rose gum]
gb|KDO54091.1|  hypothetical protein CISIN_1g0146251mg                  227   1e-68   Citrus sinensis [apfelsine]
ref|XP_002314497.2|  hypothetical protein POPTR_0010s07830g             229   1e-68   
ref|NP_188989.2|  cyclopropane-fatty-acyl-phospholipid synthase         229   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528379.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    226   2e-68   
ref|XP_008796357.1|  PREDICTED: uncharacterized protein LOC103711...    233   3e-68   
ref|XP_008796358.1|  PREDICTED: uncharacterized protein LOC103711...    233   3e-68   Phoenix dactylifera
ref|XP_004247760.1|  PREDICTED: uncharacterized protein LOC101261068    227   4e-68   Solanum lycopersicum
ref|XP_006299255.1|  hypothetical protein CARUB_v10015414mg             227   5e-68   
gb|AAT74602.1|  cyclopropane fatty acid synthase                        235   5e-68   Gossypium hirsutum [American cotton]
gb|KJB28514.1|  hypothetical protein B456_005G052900                    235   5e-68   Gossypium raimondii
ref|XP_004173332.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    223   6e-68   
ref|XP_011041574.1|  PREDICTED: uncharacterized protein LOC105137508    232   9e-68   Populus euphratica
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...    233   1e-67   
gb|KCW60259.1|  hypothetical protein EUGRSUZ_H029682                    226   1e-67   Eucalyptus grandis [rose gum]
gb|KJB38366.1|  hypothetical protein B456_006G251800                    233   1e-67   Gossypium raimondii
gb|KHG28468.1|  putative fatty acid methyltransferase                   233   1e-67   Gossypium arboreum [tree cotton]
gb|KJB38367.1|  hypothetical protein B456_006G251800                    234   2e-67   Gossypium raimondii
ref|XP_006489667.1|  PREDICTED: uncharacterized protein LOC102613...    229   2e-67   
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...    233   2e-67   Phoenix dactylifera
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...    233   2e-67   
gb|KHG28467.1|  putative fatty acid methyltransferase                   233   2e-67   Gossypium arboreum [tree cotton]
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651    233   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_002314496.2|  hypothetical protein POPTR_0010s07820g             226   3e-67   
ref|XP_006378321.1|  hypothetical protein POPTR_0010s07800g             226   3e-67   
ref|XP_006489666.1|  PREDICTED: uncharacterized protein LOC102613...    229   7e-67   Citrus sinensis [apfelsine]
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649    231   9e-67   Tarenaya hassleriana [spider flower]
ref|XP_010936015.1|  PREDICTED: uncharacterized protein LOC105055...    228   4e-66   Elaeis guineensis
ref|XP_006489664.1|  PREDICTED: uncharacterized protein LOC102612...    227   5e-66   Citrus sinensis [apfelsine]
emb|CDY18120.1|  BnaA01g23810D                                          223   5e-66   Brassica napus [oilseed rape]
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...    229   7e-66   Tarenaya hassleriana [spider flower]
ref|XP_004169247.1|  PREDICTED: uncharacterized protein LOC101225338    228   9e-66   
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    227   2e-65   
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...    228   2e-65   Elaeis guineensis
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...    228   2e-65   Citrus sinensis [apfelsine]
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg             227   3e-65   
ref|NP_001189954.1|  Cyclopropane-fatty-acyl-phospholipid synthase      221   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107970.1|  PREDICTED: uncharacterized protein LOC103833648    219   6e-65   Brassica rapa
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    226   1e-64   
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443    226   1e-64   Eucalyptus grandis [rose gum]
emb|CDY09025.1|  BnaC01g30660D                                          208   3e-64   Brassica napus [oilseed rape]
ref|XP_010532684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    216   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_009758040.1|  PREDICTED: uncharacterized protein LOC104210742    211   4e-64   Nicotiana sylvestris
gb|KGN61574.1|  hypothetical protein Csa_2G171950                       224   5e-64   Cucumis sativus [cucumbers]
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                     223   6e-64   Eucalyptus grandis [rose gum]
ref|XP_010532682.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    216   8e-64   Tarenaya hassleriana [spider flower]
ref|XP_007035220.1|  Cyclopropane fatty acid synthase                   214   1e-63   
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase           220   8e-63   Medicago truncatula
ref|XP_010466684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    213   1e-62   
ref|XP_010466685.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    212   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010466683.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    212   4e-62   
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...    217   1e-61   
ref|XP_010670925.1|  PREDICTED: uncharacterized protein LOC104887...    216   2e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007035218.1|  Cyclopropane fatty acid synthase isoform 2         209   2e-61   
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...    216   2e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007035217.1|  Cyclopropane fatty acid synthase isoform 1         209   3e-61   
ref|XP_002460494.1|  hypothetical protein SORBIDRAFT_02g029350          211   3e-61   
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...    216   3e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006420313.1|  hypothetical protein CICLE_v10005536mg             205   3e-61   
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    215   6e-61   
ref|XP_006420314.1|  hypothetical protein CICLE_v10007034mg             214   9e-61   
ref|XP_002883432.1|  predicted protein                                  205   2e-60   
ref|NP_001066537.1|  Os12g0267200                                       213   5e-60   
gb|ABG37642.1|  cyclopropane fatty acid synthase                        216   5e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002467653.1|  hypothetical protein SORBIDRAFT_01g031685          211   6e-60   
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924    211   2e-59   Citrus sinensis [apfelsine]
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                  210   3e-59   Citrus sinensis [apfelsine]
ref|NP_001059618.1|  Os07g0474600                                       203   4e-59   
dbj|BAJ91247.1|  predicted protein                                      201   4e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010532683.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    204   4e-59   Tarenaya hassleriana [spider flower]
gb|EEC78767.1|  hypothetical protein OsI_18995                          212   8e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_003590114.1|  Cyclopropane fatty acid synthase                   209   1e-58   
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...    208   2e-58   Populus euphratica
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557    207   3e-58   
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                   207   4e-58   
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850    210   4e-58   
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                   207   6e-58   Citrus sinensis [apfelsine]
ref|NP_001147782.1|  cyclopropane fatty acid synthase                   206   7e-58   Zea mays [maize]
gb|EEE62857.1|  hypothetical protein OsJ_17660                          206   8e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667917.1|  PREDICTED: cyclopropane fatty acid synthase ...    206   9e-58   
ref|XP_006658552.1|  PREDICTED: uncharacterized protein LOC102715408    205   2e-57   
ref|NP_188990.4|  Cyclopropane-fatty-acyl-phospholipid synthase         199   4e-57   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01740.1|  cyclopocyclopropane fatty acid synthase-like pro...    199   4e-57   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK04927.1|  predicted protein                                      190   4e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006350427.1|  PREDICTED: uncharacterized protein LOC102587606    200   4e-57   
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901    204   6e-57   Setaria italica
gb|EEE67149.1|  hypothetical protein OsJ_24210                          202   8e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EMS55075.1|  Cyclopropane-fatty-acyl-phospholipid synthase           202   2e-56   Triticum urartu
gb|EEC82010.1|  hypothetical protein OsI_25960                          202   3e-56   Oryza sativa Indica Group [Indian rice]
dbj|BAJ95828.1|  predicted protein                                      201   6e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93367.1|  predicted protein                                      201   7e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004296401.1|  PREDICTED: uncharacterized protein LOC101310979    196   7e-56   Fragaria vesca subsp. vesca
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751    201   8e-56   Sesamum indicum [beniseed]
gb|EMT03310.1|  Cyclopropane-fatty-acyl-phospholipid synthase           201   8e-56   
gb|AAM33848.1|AF470622_1  cyclopropane synthase                         200   1e-55   Sterculia foetida
ref|XP_010239672.1|  PREDICTED: uncharacterized protein LOC100842...    200   1e-55   
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...    200   2e-55   Brachypodium distachyon [annual false brome]
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747             198   8e-55   Selaginella moellendorffii
gb|KHG13738.1|  Cyclopropane-fatty-acyl-phospholipid synthase           197   2e-54   Gossypium arboreum [tree cotton]
gb|KJB12590.1|  hypothetical protein B456_002G025800                    196   4e-54   Gossypium raimondii
ref|XP_006664478.1|  PREDICTED: uncharacterized protein LOC102701601    195   6e-54   Oryza brachyantha
gb|AAT74601.1|  cyclopropane fatty acid synthase                        196   6e-54   Gossypium hirsutum [American cotton]
gb|KJB12595.1|  hypothetical protein B456_002G026100                    195   7e-54   Gossypium raimondii
ref|XP_011091266.1|  PREDICTED: uncharacterized protein LOC105171...    195   8e-54   Sesamum indicum [beniseed]
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...    195   8e-54   Sesamum indicum [beniseed]
ref|XP_010670965.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    189   1e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|AAT74600.1|  cyclopropane fatty acid synthase                        194   2e-53   Gossypium hirsutum [American cotton]
ref|XP_007035240.1|  Cyclopropane fatty acid synthase                   189   2e-53   
gb|EPS70161.1|  hypothetical protein M569_04599                         193   4e-53   Genlisea aurea
gb|EMS56688.1|  Cyclopropane-fatty-acyl-phospholipid synthase           191   1e-52   Triticum urartu
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                192   1e-52   Erythranthe guttata [common monkey flower]
dbj|BAJ86532.1|  predicted protein                                      181   4e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001769171.1|  predicted protein                                  190   4e-52   
gb|KJB70811.1|  hypothetical protein B456_011G092100                    189   1e-51   Gossypium raimondii
gb|EMT01203.1|  Cyclopropane-fatty-acyl-phospholipid synthase           174   2e-50   
gb|EMS47377.1|  Cyclopropane-fatty-acyl-phospholipid synthase           183   5e-50   Triticum urartu
ref|XP_006406023.1|  hypothetical protein EUTSA_v10022172mg             177   2e-49   
dbj|BAK05129.1|  predicted protein                                      182   7e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05892.1|  predicted protein                                      181   7e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS47376.1|  Cyclopropane-fatty-acyl-phospholipid synthase           176   2e-47   Triticum urartu
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900          172   2e-45   Sorghum bicolor [broomcorn]
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...    171   3e-45   Setaria italica
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920    171   4e-45   Setaria italica
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    171   5e-45   
ref|XP_002862681.1|  hypothetical protein ARALYDRAFT_359447             161   5e-45   
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    171   6e-45   
gb|EMT06798.1|  Cyclopropane-fatty-acyl-phospholipid synthase           169   9e-45   
gb|EMS64510.1|  Cyclopropane-fatty-acyl-phospholipid synthase           168   2e-44   Triticum urartu
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    169   3e-44   Zea mays [maize]
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    169   3e-44   Zea mays [maize]
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           168   2e-43   Triticum urartu
gb|AFW60130.1|  hypothetical protein ZEAMMB73_361545                    161   6e-43   
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    161   1e-41   Zea mays [maize]
gb|KJB70810.1|  hypothetical protein B456_011G092100                    160   4e-41   Gossypium raimondii
gb|KDO54094.1|  hypothetical protein CISIN_1g048309mg                   149   9e-40   Citrus sinensis [apfelsine]
emb|CDX85102.1|  BnaC07g08040D                                          146   2e-39   
gb|KDO40251.1|  hypothetical protein CISIN_1g042963mg                   144   4e-39   Citrus sinensis [apfelsine]
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          152   1e-38   
ref|XP_005717868.1|  unnamed protein product                            148   5e-38   Chondrus crispus [carageen]
gb|KJB28509.1|  hypothetical protein B456_005G052800                    147   8e-38   Gossypium raimondii
ref|WP_028577058.1|  cyclopropane-fatty-acyl-phospholipid synthase      144   7e-36   Desulfomicrobium escambiense
gb|KJB28512.1|  hypothetical protein B456_005G052900                    145   8e-36   Gossypium raimondii
ref|WP_015774604.1|  cyclopropane-fatty-acyl-phospholipid synthase      142   3e-35   Desulfomicrobium baculatum
ref|WP_043771147.1|  hypothetical protein                               139   5e-35   
gb|ADW18290.1|  Cyclopropane-fatty-acyl-phospholipid synthase           139   4e-34   Desulfobulbus propionicus DSM 2032
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...    134   9e-34   Tarenaya hassleriana [spider flower]
emb|CDY54629.1|  BnaCnng27480D                                          131   1e-33   Brassica napus [oilseed rape]
ref|WP_007641361.1|  cyclopropane-fatty-acyl-phospholipid synthase      134   4e-33   Cellvibrio sp. BR
ref|NP_188988.2|  S-adenosyl-L-methionine-dependent methyltransfe...    132   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|WP_038097960.1|  cyclopropane-fatty-acyl-phospholipid synthase      133   8e-33   
dbj|GAM27526.1|  hypothetical protein SAMD00019534_107020               133   2e-32   Acytostelium subglobosum LB1
dbj|GAK56531.1|  cyclopropane-fatty-acyl-phospholipid synthase          132   3e-32   Candidatus Vecturithrix granuli
ref|WP_007236107.1|  cyclopropane-fatty-acyl-phospholipid synthase      131   4e-32   
ref|WP_008107386.1|  cyclopropane-fatty-acyl-phospholipid synthase      131   4e-32   Methylophilales bacterium HTCC2181
ref|WP_037337739.1|  cyclopropane-fatty-acyl-phospholipid synthase      131   4e-32   
ref|WP_024775005.1|  cyclopropane-fatty-acyl-phospholipid synthase      130   6e-32   
ref|WP_012012891.1|  cyclopropane-fatty-acyl-phospholipid synthase      130   6e-32   
ref|XP_005537745.1|  probable mycolic acid methyl transferase           134   6e-32   
ref|WP_008293215.1|  cyclopropane-fatty-acyl-phospholipid synthase      130   6e-32   
ref|WP_036537494.1|  cyclopropane-fatty-acyl-phospholipid synthase      130   7e-32   
ref|XP_004147183.1|  PREDICTED: uncharacterized protein LOC101213610    134   8e-32   
ref|WP_015487921.1|  cyclopropane-fatty-acyl-phospholipid synthase      130   9e-32   
ref|WP_028573790.1|  cyclopropane-fatty-acyl-phospholipid synthase      132   1e-31   
ref|WP_009024070.1|  cyclopropane-fatty-acyl-phospholipid synthase      129   2e-31   
ref|WP_025258609.1|  cyclopropane-fatty-acyl-phospholipid synthase      129   3e-31   
ref|WP_008223526.1|  cyclopropane-fatty-acyl-phospholipid synthase      128   4e-31   
ref|WP_020414996.1|  hypothetical protein                               128   5e-31   
ref|WP_017221214.1|  hypothetical protein                               128   5e-31   
gb|KDO39428.1|  hypothetical protein CISIN_1g047022mg                   127   6e-31   
ref|WP_003182274.1|  cyclopropane-fatty-acyl-phospholipid synthase      128   6e-31   
gb|KFA00082.1|  cyclopropane-fatty-acyl-phospholipid synthase           122   8e-31   
ref|WP_009575288.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   8e-31   
ref|WP_019440999.1|  hypothetical protein                               127   9e-31   
ref|WP_026107288.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   9e-31   
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                  130   9e-31   
ref|WP_028630133.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   1e-30   
ref|WP_017011088.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   1e-30   
ref|WP_027671132.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   1e-30   
ref|WP_011758933.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   1e-30   
gb|EFA79547.1|  cyclopropane fatty acid synthase                        127   1e-30   
ref|WP_040352724.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   2e-30   
ref|WP_027331136.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   2e-30   
ref|WP_030138826.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   2e-30   
ref|WP_010151137.1|  cyclopropane-fatty-acyl-phospholipid synthase      127   2e-30   
gb|EAQ78945.1|  cyclopropane-fatty-acyl-phospholipid synthase           127   2e-30   
ref|WP_009472206.1|  cyclopropane-fatty-acyl-phospholipid synthase      126   2e-30   
ref|WP_020209621.1|  hypothetical protein                               126   3e-30   
ref|WP_009852233.1|  cyclopropane-fatty-acyl-phospholipid synthase      126   3e-30   
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      129   3e-30   
ref|WP_008610474.1|  cyclopropane-fatty-acyl-phospholipid synthase      126   3e-30   
ref|WP_041479999.1|  cyclopropane-fatty-acyl-phospholipid synthase      126   3e-30   
ref|WP_039591068.1|  cyclopropane-fatty-acyl-phospholipid synthase      126   3e-30   
ref|WP_043298452.1|  cyclopropane-fatty-acyl-phospholipid synthase      126   3e-30   
ref|XP_003289116.1|  hypothetical protein DICPUDRAFT_48369              126   4e-30   
ref|WP_037046900.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   4e-30   
ref|WP_008043908.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   4e-30   
ref|WP_002146706.1|  cyclopropane-fatty-acyl-phospholipid synthas...    119   4e-30   
ref|WP_008952004.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   4e-30   
ref|WP_008983445.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   5e-30   
ref|WP_041149642.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   5e-30   
ref|XP_004356254.1|  cyclopropane fatty acid synthase                   125   5e-30   
ref|WP_043101704.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   5e-30   
ref|WP_013031406.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   5e-30   
ref|WP_029148983.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   6e-30   
ref|WP_042145087.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   6e-30   
ref|WP_010384712.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   8e-30   
ref|WP_022973428.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   8e-30   
ref|WP_005993583.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   8e-30   
ref|WP_039423507.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   9e-30   
ref|WP_007951699.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   9e-30   
ref|WP_024014288.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   1e-29   
ref|WP_016773216.1|  cyclopropane-fatty-acyl-phospholipid synthase      125   1e-29   
ref|WP_016545452.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   1e-29   
ref|WP_027697442.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   1e-29   
ref|WP_013135425.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   1e-29   
gb|EMJ93734.1|  cyclopropane-fatty-acyl-phospholipid synthase           124   1e-29   
ref|WP_032829569.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    124   1e-29   
gb|EKO15287.1|  cyclopropane-fatty-acyl-phospholipid synthase           124   1e-29   
ref|WP_032830102.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   1e-29   
ref|WP_042609708.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   1e-29   
ref|WP_040987124.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    124   1e-29   
ref|WP_008588835.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   1e-29   
gb|EKM95559.1|  cyclopropane-fatty-acyl-phospholipid synthase           124   1e-29   
ref|WP_037020191.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   1e-29   
gb|EPN68324.1|  cyclopropane-fatty-acyl-phospholipid synthase           119   1e-29   
ref|WP_029221686.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   2e-29   
ref|WP_008025867.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    124   2e-29   
ref|WP_003208420.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    124   2e-29   
ref|WP_007967668.1|  cyclopropane-fatty-acyl-phospholipid synthase      124   2e-29   
ref|WP_003456705.1|  SAM dependent methyltransferase, cyclopropan...    124   2e-29   
ref|WP_016987210.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   3e-29   
ref|XP_009586643.1|  PREDICTED: uncharacterized protein LOC104084...    105   3e-29   
ref|WP_035517956.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   3e-29   
ref|WP_039766323.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   3e-29   
ref|WP_021701492.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   3e-29   
ref|WP_041585800.1|  hypothetical protein                               121   3e-29   
ref|WP_017475993.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   3e-29   
ref|WP_026295196.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   3e-29   
emb|CEL43918.1|  Putative cyclopropane-fatty-acyl-phospholipid sy...    121   3e-29   
ref|WP_017529903.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   4e-29   
ref|WP_040372386.1|  hypothetical protein                               125   4e-29   
ref|WP_010458259.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   4e-29   
ref|WP_044236782.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   4e-29   
ref|WP_019676732.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   4e-29   
gb|EDL61239.1|  cyclopropane-fatty-acyl-phospholipid synthase           123   4e-29   
gb|ERB64848.1|  hypothetical protein N779_13070                         119   4e-29   
ref|WP_004406950.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   4e-29   
ref|WP_019408878.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   4e-29   
ref|WP_011266739.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   5e-29   
ref|WP_024652616.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   5e-29   
ref|WP_010428686.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   5e-29   
ref|WP_024661275.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   5e-29   
ref|WP_003433715.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   5e-29   
ref|WP_003365609.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_003421694.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_044311961.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_024682685.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_016567259.1|  Cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_003415046.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_032658908.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_017277944.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
gb|EGH32293.1|  cyclopropane-fatty-acyl-phospholipid synthase           122   5e-29   
ref|WP_024665589.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_024691823.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_003408647.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
gb|EGH75650.1|  cyclopropane-fatty-acyl-phospholipid synthase           122   5e-29   
ref|WP_040151432.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   5e-29   
ref|WP_017171442.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_026145216.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_010177020.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_004419129.1|  Cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_032615929.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
ref|WP_039761286.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   5e-29   
gb|EGH44451.1|  cyclopropane-fatty-acyl-phospholipid synthase           122   5e-29   
ref|WP_039574900.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_034211777.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_017163033.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_005733596.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_011167849.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_017168650.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_002552156.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_010366079.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
gb|AAW75168.1|  cyclopropane-fatty-acyl-phospholipid synthase           125   6e-29   
ref|WP_011408294.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_039442644.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_039433432.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   6e-29   
ref|WP_027925959.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_011258655.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_005746219.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_017155651.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_019742551.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_017160022.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_044319716.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|XP_006676884.1|  hypothetical protein BATDEDRAFT_86144              122   7e-29   
gb|ABC78887.1|  cyclopropane-fatty-acyl-phospholipid synthase           122   7e-29   
ref|WP_044343954.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
gb|KGK59141.1|  cyclopropane-fatty-acyl-phospholipid synthase           122   7e-29   
gb|EPE84491.1|  cyclopropane-fatty-acyl-phospholipid synthase           119   7e-29   
ref|WP_014503964.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_017340747.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   7e-29   
ref|WP_011335916.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   8e-29   
ref|WP_003485448.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   8e-29   
gb|EPR40260.1|  Cyclopropane-fatty-acyl-phospholipid synthase           122   8e-29   
ref|WP_024940524.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   8e-29   
dbj|BAP41523.1|  cyclopropane-fatty-acyl-phospholipid synthase          122   8e-29   
ref|WP_016965510.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_039514269.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_005924870.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_032019166.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_034225625.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_040415201.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_004799086.1|  hypothetical protein                               122   9e-29   
ref|WP_019837887.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_027612228.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_016903512.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_024744102.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   9e-29   
ref|WP_016781761.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   1e-28   
ref|WP_020290471.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   1e-28   
ref|WP_004663912.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   1e-28   
ref|WP_006451778.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   1e-28   
ref|WP_008898188.1|  cyclopropane-fatty-acyl-phospholipid synthase      122   1e-28   
ref|WP_026007620.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_019825100.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_008373278.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_017126570.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_015636970.1|  methyltransferase                                  121   1e-28   
ref|WP_002997644.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_008086166.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_005891172.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_005911656.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    121   1e-28   
ref|WP_016850267.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_016493425.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_011734078.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   1e-28   
ref|WP_011346862.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_028614521.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_011050875.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    121   2e-28   
ref|WP_039580557.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_024647595.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_040280933.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_029295644.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_024073307.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_002814454.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_033423299.1|  cyclopropane-fatty-acyl-phospholipid synthase      123   2e-28   
ref|WP_010380444.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_016977067.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
ref|WP_038360934.1|  cyclopropane-fatty-acyl-phospholipid synthase      121   2e-28   
gb|EMS68326.1|  Cyclopropane-fatty-acyl-phospholipid synthase           120   2e-28   
gb|AAM36246.1|  cyclopropane-fatty-acyl-phospholipid synthase           121   2e-28   
ref|WP_038510630.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_005784626.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_019301959.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_023443719.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_006962791.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_029379353.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_038155939.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_029533711.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_010565618.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   2e-28   
ref|WP_020297633.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_043008625.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_007912863.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    120   3e-28   
ref|WP_004758028.1|  hypothetical protein                               120   3e-28   
ref|WP_019275710.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_034118005.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_024670120.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_044404485.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
gb|KGS14301.1|  cyclopropane-fatty-acyl-phospholipid synthase           120   3e-28   
ref|WP_025131839.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_035015231.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_019304527.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_038845762.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_033896967.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_010213303.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    120   3e-28   
ref|WP_037413108.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
ref|WP_009836691.1|  cyclopropane-fatty-acyl-phospholipid synthase      120   3e-28   
gb|EWH09403.1|  cyclopropane-fatty-acyl-phospholipid synthase           120   3e-28   



>ref|XP_009763752.1| PREDICTED: uncharacterized protein LOC104215602 isoform X2 [Nicotiana 
sylvestris]
Length=566

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEH
Sbjct  425  ALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEH  484

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  485  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  544

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  545  VFSRPGNVAAFGDPYHGVPSTY  566



>ref|XP_009625540.1| PREDICTED: uncharacterized protein LOC104116392 isoform X6 [Nicotiana 
tomentosiformis]
Length=556

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEH
Sbjct  415  ALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEH  474

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  475  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  534

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  535  VFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_009625539.1| PREDICTED: uncharacterized protein LOC104116392 isoform X5 [Nicotiana 
tomentosiformis]
Length=556

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEH
Sbjct  415  ALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEH  474

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  475  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  534

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  535  VFSRPGNVAAFGDPYNGVPSTY  556



>ref|XP_010109738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
 gb|EXC24409.1| Cyclopropane-fatty-acyl-phospholipid synthase [Morus notabilis]
Length=161

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEH
Sbjct  20   ALAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEH  79

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHY+QTLRCWR NFLE+QS+IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQI
Sbjct  80   IENIGIHYHQTLRCWRKNFLEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQI  139

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGNV AF +PYK   SA
Sbjct  140  VFSRPGNVAAFRNPYKSFPSA  160



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =   270 bits (690),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEH
Sbjct  724  ALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  784  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  843

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  844  VFSRPGNVAAFGDPYHGVPSTY  865



>ref|XP_009625535.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625536.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625538.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   267 bits (683),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEH
Sbjct  661  ALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEH  720

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  721  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  780

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  781  VFSRPGNVAAFGDPYNGVPSTY  802



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   267 bits (682),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEH
Sbjct  667  ALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEH  726

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  727  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  786

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  787  VFSRPGNVAAFGDPYNGVPSTY  808



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEH
Sbjct  724  ALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  784  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  843

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  844  VFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   268 bits (684),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEH
Sbjct  724  ALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  784  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  843

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPY G+ S Y
Sbjct  844  VFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009617895.1| PREDICTED: uncharacterized protein LOC104110155 isoform X5 [Nicotiana 
tomentosiformis]
Length=566

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LA +G+ VLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEH
Sbjct  425  ALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEH  484

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  485  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQI  544

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN+ AFGDPY  + SAY
Sbjct  545  VFSRPGNIAAFGDPYSAVPSAY  566



>ref|XP_009780643.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Nicotiana sylvestris]
Length=543

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ V+QFISIPDERYDEYRQSSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV H
Sbjct  402  ALAEDGLLVVQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCVVH  461

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR  FL+ QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  462  LEEIGIHYYQTLRCWREKFLKNQSQIRALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  521

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV  FGDPY G+ SAY
Sbjct  522  VFSRPGNVAVFGDPYNGVPSAY  543



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAM+A+SRLCVEH
Sbjct  724  ALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMSAASRLCVEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFLE+QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  784  LEDIGIHYYQTLRCWRKNFLEKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  843

Query  331  VFSRPGNVTAFGDPYKGL  278
            VFSRPGNV AFGDPY G+
Sbjct  844  VFSRPGNVAAFGDPYNGV  861



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =   265 bits (676),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAM+A+SRLCVEH
Sbjct  724  ALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMSAASRLCVEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFLE+QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  784  LEDIGIHYYQTLRCWRKNFLEKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  843

Query  331  VFSRPGNVTAFGDPYKG  281
            VFSRPGNV AFGDPY G
Sbjct  844  VFSRPGNVAAFGDPYNG  860



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISIPDERY EYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA+SRLCVEH
Sbjct  728  ALAEDGLFVLQFISIPDERYTEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAAASRLCVEH  787

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +EDIGIHYYQTLRCWR NFL R S+I +LGFD+KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  788  VEDIGIHYYQTLRCWRENFLNRTSEIKNLGFDEKFIRTWEYYFDYCAAGFKTCTLGDYQI  847

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDPYK +  AY
Sbjct  848  VFSRPGNVAAFGDPYKSVPCAY  869



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LA +G+ VLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEH
Sbjct  667  ALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEH  726

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  727  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQI  786

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN+ AFGDPY  + SAY
Sbjct  787  VFSRPGNIAAFGDPYSAVPSAY  808



>ref|XP_009617893.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009617894.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LA +G+ VLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEH
Sbjct  661  ALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEH  720

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  721  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQI  780

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN+ AFGDPY  + SAY
Sbjct  781  VFSRPGNIAAFGDPYSAVPSAY  802



>ref|XP_004173387.1| PREDICTED: probable fatty acid methyltransferase-like, partial 
[Cucumis sativus]
Length=291

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHL
Sbjct  151  LAENGLFVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHL  210

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLRCWR NFLE +S+IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  211  ENIGIHYHQTLRCWRKNFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIV  270

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            +SRPGNV AF +PY+G+ SAY
Sbjct  271  YSRPGNVAAFTNPYQGIPSAY  291



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LA +G+ VLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL VEH
Sbjct  724  ALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASRLSVEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  784  LEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTLGDYQI  843

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN+ AFGDPY  + SAY
Sbjct  844  VFSRPGNIAAFGDPYSAVPSAY  865



>ref|XP_011073567.1| PREDICTED: uncharacterized protein LOC105158481 isoform X2 [Sesamum 
indicum]
Length=802

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+GI VLQFISIPDERY+EYRQS+DFIKEYIFPGGCLPSLSRVT+AM+A+SRLCVEHL
Sbjct  662  LQEDGILVLQFISIPDERYNEYRQSADFIKEYIFPGGCLPSLSRVTTAMSAASRLCVEHL  721

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            EDIGIHYYQTLR WR +FLE+QS+I  LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQIV
Sbjct  722  EDIGIHYYQTLRRWRESFLEKQSKIQALGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQIV  781

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV AFGDPYK + SAY
Sbjct  782  FSRPGNVEAFGDPYKTIPSAY  802



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL
Sbjct  724  LADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  783

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  784  ENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIV  843

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN  AF DPYKG  SA
Sbjct  844  FSRPGNTPAFADPYKGFPSA  863



>ref|XP_008340641.1| PREDICTED: uncharacterized protein LOC103403572 isoform X2 [Malus 
domestica]
Length=554

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL
Sbjct  415  LAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  474

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLR WR NFL+RQ +IL LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  475  ENIGIHYFQTLRYWRKNFLDRQGEILALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIV  534

Query  328  FSRPGNVTAFGDPYKG  281
            FSRPGNV AF +PYKG
Sbjct  535  FSRPGNVPAFSNPYKG  550



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+GI VLQFISIPDERY+EYRQS+DFIKEYIFPGGCLPSLSRVT+AM+A+SRLCVEHL
Sbjct  729  LQEDGILVLQFISIPDERYNEYRQSADFIKEYIFPGGCLPSLSRVTTAMSAASRLCVEHL  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            EDIGIHYYQTLR WR +FLE+QS+I  LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQIV
Sbjct  789  EDIGIHYYQTLRRWRESFLEKQSKIQALGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQIV  848

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV AFGDPYK + SAY
Sbjct  849  FSRPGNVEAFGDPYKTIPSAY  869



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL
Sbjct  724  LAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  783

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLR WR NFLERQS+IL LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+V
Sbjct  784  ENIGIHYFQTLRYWRKNFLERQSEILALGFDEKFIRTWEYYFDYCAAGFRTCTLGNYQMV  843

Query  328  FSRPGNVTAFGDPYKG  281
            FSRPGNV AF +PY+G
Sbjct  844  FSRPGNVPAFSNPYEG  859



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462298.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =   256 bits (654),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAM  SSRLCVEH+
Sbjct  725  LAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMVNSSRLCVEHI  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLERQS+IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  785  ENIGIHYYQTLRYWRKNFLERQSEILALGFNEKFIRTWEYYFDYCAAGFKTYTLGNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV AF +PYKG  SAY
Sbjct  845  FSRPGNVPAFSNPYKGFPSAY  865



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L +NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL
Sbjct  729  LTDNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  789  ENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIV  848

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN  AF DPYKG  SA
Sbjct  849  FSRPGNTPAFTDPYKGFPSA  868



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL
Sbjct  724  LAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  783

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLR WR NFLERQS+IL LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+V
Sbjct  784  ENIGIHYFQTLRYWRKNFLERQSEILALGFDEKFIRTWEYYFDYCAAGFRTCTLGNYQMV  843

Query  328  FSRPGNVTAFGDPYKG  281
            FSRPGNV AF +PY+G
Sbjct  844  FSRPGNVPAFSNPYEG  859



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ V+QFISIPDERY+EYR+SSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV H
Sbjct  724  ALAEDGLLVVQFISIPDERYEEYRRSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCVVH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR  FL+ QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQI
Sbjct  784  LEEIGIHYYQTLRCWREKFLKNQSQIRALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQI  843

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV  FGDPY G+ SAY
Sbjct  844  VFSRPGNVAVFGDPYNGVPSAY  865



>ref|XP_006606356.1| PREDICTED: uncharacterized protein LOC100815937 isoform X3 [Glycine 
max]
Length=566

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+
Sbjct  431  LADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHV  490

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  491  ENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVV  550

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A GDPYK
Sbjct  551  FSRPGNVPALGDPYK  565



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L +NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL
Sbjct  724  LTDNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  783

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  784  ENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAAGFKTYTLGNYQIV  843

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN  AF DPYKG  SA
Sbjct  844  FSRPGNTPAFTDPYKGFPSA  863



>ref|XP_008460676.1| PREDICTED: pavine N-methyltransferase-like isoform X3 [Cucumis 
melo]
Length=557

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPDERYDEYR SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHL
Sbjct  417  LAENGLFVLQFISIPDERYDEYRLSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHL  476

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLRCWR NFLE QS+IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  477  ENIGIHYHQTLRCWRKNFLENQSKILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIV  536

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            +SRPGNV AF +PY+G+ SAY
Sbjct  537  YSRPGNVAAFTNPYQGIPSAY  557



>ref|XP_010650131.1| PREDICTED: (S)-coclaurine N-methyltransferase isoform X4 [Vitis 
vinifera]
Length=556

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHL
Sbjct  416  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHL  475

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  476  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIV  535

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  AF +PY+ + S Y
Sbjct  536  FSRPGNAAAFSNPYESVVSTY  556



>emb|CDY67345.1| BnaCnng54600D [Brassica napus]
Length=454

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE+
Sbjct  312  ALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVEN  371

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG+HYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+
Sbjct  372  VENIGLHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQV  431

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDP++   SA+
Sbjct  432  VFSRPGNVAAFGDPFRNFPSAH  453



>ref|XP_006589308.1| PREDICTED: uncharacterized protein LOC100801659 isoform X2 [Glycine 
max]
Length=566

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+
Sbjct  431  LADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHV  490

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  491  ENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVV  550

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A GDPYK
Sbjct  551  FSRPGNVAALGDPYK  565



>ref|XP_011013987.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013989.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013990.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
Length=460

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH
Sbjct  315  ALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEH  374

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYCAAGF + TLGDYQ+
Sbjct  375  VENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQV  434

Query  331  VFSRPGNVTAFGDPYKGLASAY*AHSLL  248
            VFSRPGNV A G+PYKG  SAY  H LL
Sbjct  435  VFSRPGNVVALGNPYKGFPSAY--HHLL  460



>ref|XP_007144121.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
 gb|ESW16115.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
Length=694

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA +SRLCVEH+
Sbjct  559  LAQNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMATTSRLCVEHV  618

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E++GIHYYQTLRCWR NF+ERQ++IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  619  ENLGIHYYQTLRCWRKNFMERQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVV  678

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV AFGDPYK
Sbjct  679  FSRPGNVAAFGDPYK  693



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHL
Sbjct  728  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHL  787

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIV
Sbjct  788  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIV  847

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN TAF DPYK + S Y
Sbjct  848  FSRPGNATAFSDPYKSVVSPY  868



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHL
Sbjct  741  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHL  800

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIV
Sbjct  801  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIV  860

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN TAF DPYK + S Y
Sbjct  861  FSRPGNATAFSDPYKSVVSPY  881



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHL
Sbjct  725  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIV
Sbjct  785  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN TAF DPYK + S Y
Sbjct  845  FSRPGNATAFSDPYKSVVSPY  865



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA +SRLCVEHL
Sbjct  726  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMATASRLCVEHL  785

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLGDYQIV
Sbjct  786  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTRTLGDYQIV  845

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN TAF DPYK + S Y
Sbjct  846  FSRPGNATAFSDPYKSVVSPY  866



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  723  ALAENGLIVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LGFD+KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  783  VENIGIHYYQTLRLWRKNFLERQKQIMALGFDEKFIRTWEYYFDYCAAGFKTLTLGNYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_011041421.1| PREDICTED: (S)-coclaurine N-methyltransferase-like, partial [Populus 
euphratica]
Length=419

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH
Sbjct  274  ALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEH  333

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYCAAGF + TLGDYQ+
Sbjct  334  VENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQV  393

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV A G+PYKG  SAY
Sbjct  394  VFSRPGNVVALGNPYKGFPSAY  415



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =   253 bits (646),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH
Sbjct  727  ALAEDGVIVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEH  786

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLRCWR NFLERQ QI+ LGF+++FIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  787  VENIGIHYYQTLRCWRKNFLERQKQIMALGFNEEFIRTWEYYFDYCAAGFKTLTLGNYQV  846

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN  AFGDPY+   SA+
Sbjct  847  VFSRPGNTAAFGDPYRSFPSAH  868



>emb|CDY09021.1| BnaC01g30700D [Brassica napus]
Length=804

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL RVTSAMA+SSRLCVE+
Sbjct  662  ALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLGRVTSAMASSSRLCVEN  721

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLRCWR NFLERQ QI+DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  722  VENIGIHYYQTLRCWRKNFLERQKQIIDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  781

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGNV A GDP+    SA
Sbjct  782  VFSRPGNVAALGDPFHCFPSA  802



>ref|XP_010317817.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317818.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317819.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score =   252 bits (643),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERY+EYRQSSDF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEH
Sbjct  661  ALAEYGLLVLQFISIPDERYEEYRQSSDFMKEYIFPGGCVPALSRVTSAMAAASRLCVEH  720

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQI
Sbjct  721  LEEIGIHYYQTLRCWRENFLKNKSQIRSLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQI  780

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV  FGDPY    S Y
Sbjct  781  VFSRPGNVAVFGDPYNYSPSTY  802



>ref|XP_010670963.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+
Sbjct  317  LAANGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHI  376

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  377  ENIGIHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIV  436

Query  328  FSRPGNVTAFGDPYKG  281
            FSRPGN+ +FG  Y G
Sbjct  437  FSRPGNLASFGGAYAG  452



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQFISIPDERY+EYRQSSDF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEH
Sbjct  724  ALAEYGLLVLQFISIPDERYEEYRQSSDFMKEYIFPGGCVPALSRVTSAMAAASRLCVEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQI
Sbjct  784  LEEIGIHYYQTLRCWRENFLKNKSQIRSLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQI  843

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV  FGDPY    S Y
Sbjct  844  VFSRPGNVAVFGDPYNYSPSTY  865



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =   251 bits (641),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  723  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  783  VENIGIHYYQTLRVWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYRGFPSAY  864



>gb|KHN01041.1| Putative fatty acid methyltransferase [Glycine soja]
Length=794

 Score =   250 bits (638),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+
Sbjct  659  LADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHV  718

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  719  ENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVV  778

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A GDPYK
Sbjct  779  FSRPGNVPALGDPYK  793



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =   251 bits (641),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL
Sbjct  724  LAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  783

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLR WR NFL+RQ +IL LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  784  ENIGIHYFQTLRYWRKNFLDRQGEILALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIV  843

Query  328  FSRPGNVTAFGDPYKG  281
            FSRPGNV AF +PYKG
Sbjct  844  FSRPGNVPAFSNPYKG  859



>ref|XP_004307322.2| PREDICTED: uncharacterized protein LOC101300392 [Fragaria vesca 
subsp. vesca]
Length=161

 Score =   233 bits (594),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQF S+PDE YDEYR+   FI+EYIFPGGCLPSLSR+T+AMAASSRL VEH
Sbjct  20   ALAENGLLVLQFTSLPDELYDEYRRCPSFIREYIFPGGCLPSLSRLTAAMAASSRLSVEH  79

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IG HYY+TL+ WR  FLE+QS+IL LGFD KFIRTWEYYFDYCAAGF+ CTLG+YQI
Sbjct  80   LENIGSHYYRTLKYWRKKFLEKQSEILALGFDDKFIRTWEYYFDYCAAGFNACTLGNYQI  139

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV    DPYKG  SAY
Sbjct  140  VFSRPGNVALLNDPYKGFPSAY  161



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =   251 bits (640),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI VLQFISIPDERY+EYRQSSDFI+EYIFPGGCLPSLSRVTSAMAA+S LCVEHL
Sbjct  711  LAEDGILVLQFISIPDERYEEYRQSSDFIREYIFPGGCLPSLSRVTSAMAAASGLCVEHL  770

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+ GIHYY TLR WR NFL +QS+IL+LGFD+KFIRTWEYYFDYCAAGF TCTLG+YQ+V
Sbjct  771  ENFGIHYYHTLRRWRTNFLSKQSEILELGFDEKFIRTWEYYFDYCAAGFKTCTLGNYQVV  830

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV +FG+  KG+ SAY
Sbjct  831  FSRPGNVVSFGNLQKGVPSAY  851



>ref|XP_010650129.1| PREDICTED: uncharacterized protein LOC100249441 isoform X2 [Vitis 
vinifera]
Length=684

 Score =   248 bits (633),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHL
Sbjct  544  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHL  603

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  604  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIV  663

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  AF +PY+ + S Y
Sbjct  664  FSRPGNAAAFSNPYESVVSTY  684



>ref|XP_006421140.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34380.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=802

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TSAM+A+SRLCVE +
Sbjct  662  LAEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITSAMSAASRLCVEQV  721

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  722  ENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQIV  781

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV AF +PYKG  SAY
Sbjct  782  FSRPGNVAAFSNPYKGFPSAY  802



>ref|XP_009102618.1| PREDICTED: uncharacterized protein LOC103828740 isoform X2 [Brassica 
rapa]
Length=619

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE+
Sbjct  477  ALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVEN  536

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+
Sbjct  537  VENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQV  596

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDP++   SA+
Sbjct  597  VFSRPGNVAAFGDPFRNFPSAH  618



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  723  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  783  VENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_011029775.1| PREDICTED: uncharacterized protein LOC105129420 isoform X4 [Populus 
euphratica]
Length=566

 Score =   245 bits (625),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+
Sbjct  426  LAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHV  485

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+V
Sbjct  486  ENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVV  545

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PYK   SAY
Sbjct  546  FSRPGNVVALSNPYKSFPSAY  566



>ref|XP_010264927.1| PREDICTED: uncharacterized protein LOC104602804 isoform X2 [Nelumbo 
nucifera]
Length=776

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGC+PSLSRVTSAMA++SRLCVEHL
Sbjct  636  LAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCIPSLSRVTSAMASASRLCVEHL  695

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL  WR +F+E+QS+IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQIV
Sbjct  696  ENIGIHYYQTLIYWRNSFMEKQSEILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQIV  755

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN+TAF DPYKGL SA+
Sbjct  756  FSRPGNLTAFSDPYKGLPSAF  776



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLCVEH+
Sbjct  726  LADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCVEHV  785

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  786  ENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVV  845

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A GDPYK
Sbjct  846  FSRPGNVPALGDPYK  860



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  718  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  777

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  778  VENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQL  837

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  838  VFSRPGNVAAFADSYQGFPSAY  859



>gb|KHN30725.1| Putative fatty acid methyltransferase [Glycine soja]
Length=787

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+
Sbjct  652  LADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHV  711

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  712  ENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVV  771

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A GDPYK
Sbjct  772  FSRPGNVAALGDPYK  786



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGC+PSLSRVTSAMA++SRLCVEHL
Sbjct  725  LAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCIPSLSRVTSAMASASRLCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL  WR +F+E+QS+IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQIV
Sbjct  785  ENIGIHYYQTLIYWRNSFMEKQSEILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN+TAF DPYKGL SA+
Sbjct  845  FSRPGNLTAFSDPYKGLPSAF  865



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPDERYDEYR SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHL
Sbjct  725  LAENGLFVLQFISIPDERYDEYRLSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLRCWR NFLE QS+IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  785  ENIGIHYHQTLRCWRKNFLENQSKILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            +SRPGNV AF +PY+G+ SAY
Sbjct  845  YSRPGNVAAFTNPYQGIPSAY  865



>ref|XP_010488415.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Camelina sativa]
Length=455

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +L E+GI ++QFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH
Sbjct  308  ALTEDGITIIQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEH  367

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL+R +QI+DLGFD KFIRTWEYYFDYCAAGF T TLGDYQI
Sbjct  368  VENIGIHYYQTLRLWRKNFLDRHNQIMDLGFDDKFIRTWEYYFDYCAAGFKTRTLGDYQI  427

Query  331  VFSRPGNVTAFG--DPYK  284
            VFSRPGNV AFG  DP++
Sbjct  428  VFSRPGNVAAFGDDDPFR  445



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMAASSRLCVEH+
Sbjct  718  LAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMAASSRLCVEHV  777

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  778  ENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVV  837

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PYK   SAY
Sbjct  838  FSRPGNVVALSNPYKSFPSAY  858



>ref|XP_010512500.1| PREDICTED: uncharacterized protein LOC104788434 isoform X2 [Camelina 
sativa]
Length=803

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  659  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  718

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LG D KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  719  VENIGIHYYQTLRLWRKNFLERQKQIMALGIDDKFIRTWEYYFDYCAAGFKTLTLGNYQL  778

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  779  VFSRPGNVAAFADSYQGFPSAY  800



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+
Sbjct  725  LADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  785  ENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVV  844

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A GDPYK
Sbjct  845  FSRPGNVAALGDPYK  859



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =   249 bits (635),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  724  ALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  784  VENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  843

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D YKG  SAY
Sbjct  844  VFSRPGNVAAFADSYKGFPSAY  865



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TSAM+A+SRLCVE +
Sbjct  729  LVEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITSAMSAASRLCVEQV  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  789  ENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQIV  848

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV AF +PYKG  SAY
Sbjct  849  FSRPGNVAAFSNPYKGFPSAY  869



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =   248 bits (634),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  717  ALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  776

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  777  VENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  836

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D YKG  SAY
Sbjct  837  VFSRPGNVAAFADSYKGFPSAY  858



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =   248 bits (634),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  723  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LG D KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  783  VENIGIHYYQTLRLWRKNFLERQKQIMALGIDDKFIRTWEYYFDYCAAGFKTLTLGNYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHL
Sbjct  725  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  785  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  AF +PY+ + S Y
Sbjct  845  FSRPGNAAAFSNPYESVVSTY  865



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHL
Sbjct  758  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHL  817

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  818  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIV  877

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  AF +PY+ + S Y
Sbjct  878  FSRPGNAAAFSNPYESVVSTY  898



>ref|XP_009414043.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Musa acuminata subsp. malaccensis]
Length=333

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+T+AMA SSR C+EHL
Sbjct  192  LAEDGIFVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITTAMATSSRFCIEHL  251

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF   + +IL LGFD+KF RTWEYYF Y AAGF +CTLGDYQIV
Sbjct  252  ENIGIHYYQTLRCWRNNFFANKEKILALGFDEKFFRTWEYYFMYRAAGFKSCTLGDYQIV  311

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN+ AFG+P+  + + 
Sbjct  312  FSRPGNLRAFGEPFNSIPAT  331



>emb|CDX77513.1| BnaA07g06510D [Brassica napus]
Length=778

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE+
Sbjct  636  ALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVEN  695

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+
Sbjct  696  VENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQV  755

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDP++   SA+
Sbjct  756  VFSRPGNVAAFGDPFRNFPSAH  777



>ref|XP_011470583.1| PREDICTED: LOW QUALITY PROTEIN: (S)-tetrahydroprotoberberine 
N-methyltransferase-like [Fragaria vesca subsp. vesca]
Length=445

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE G+ VLQF S+PDERYD+YRQSSDFI EYIFPG C+PSLSRVTSAMA SS+L VEHL
Sbjct  305  LAEKGLLVLQFTSLPDERYDKYRQSSDFINEYIFPGACIPSLSRVTSAMATSSKLSVEHL  364

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY TL+CW+  FLE Q++IL LGFD++FIRTWEYYFDYCAAGF++CTLG+YQIV
Sbjct  365  ENIGIHYYPTLKCWKKIFLENQNEILALGFDEEFIRTWEYYFDYCAAGFNSCTLGNYQIV  424

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV   G+P+KG  SAY
Sbjct  425  FSRPGNVPVLGNPFKGFPSAY  445



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH
Sbjct  723  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+
Sbjct  783  VENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYRGFPSAY  864



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH
Sbjct  723  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+
Sbjct  783  VENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYRGFPSAY  864



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH
Sbjct  698  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEH  757

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+
Sbjct  758  VENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQL  817

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  818  VFSRPGNVAAFADSYRGFPSAY  839



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+AM++SSRLC+EH
Sbjct  723  ALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAAGF T TLG+YQ+
Sbjct  783  VENIGIHYYQTLRLWRENFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFKTLTLGNYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYRGFPSAY  864



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHL
Sbjct  725  LAENGLFVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLRCWR NFLE +S+IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  785  ENIGIHYHQTLRCWRKNFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            +SRPGNV AF +PY+G+ SAY
Sbjct  845  YSRPGNVAAFTNPYQGIPSAY  865



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  728  ALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEN  787

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR  FLERQ QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  788  VENIGIHYYQTLRLWRKTFLERQKQINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  847

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGNV A GDP++   SA
Sbjct  848  VFSRPGNVAALGDPFRSFPSA  868



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  713  ALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEN  772

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR  FLER+ QI+DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  773  VENIGIHYYQTLRSWRKTFLEREKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  832

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGNV A GDP+    SA
Sbjct  833  VFSRPGNVAALGDPFHSFPSA  853



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+EH
Sbjct  726  ALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEH  785

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  786  VENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  845

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF + YKG  SAY
Sbjct  846  VFSRPGNVAAFANSYKGFPSAY  867



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  734  ALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEN  793

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR  FLERQ QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  794  VENIGIHYYQTLRLWRKTFLERQKQINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  853

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGNV A GDP++   SA
Sbjct  854  VFSRPGNVAALGDPFRSFPSA  874



>gb|KGN61577.1| hypothetical protein Csa_2G172470 [Cucumis sativus]
Length=213

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ENG+ V+QFIS+PD+RYDE+R SSDF++EYIFPGGCLPSL+RVT+AMA +SR CVEHL
Sbjct  70   LVENGLLVVQFISMPDDRYDEHRLSSDFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHL  129

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF + T+GDYQIV
Sbjct  130  ENIGIHYYQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGFKSRTIGDYQIV  189

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSR GNVT F +PY+G+ SA
Sbjct  190  FSRAGNVTTFNNPYQGIPSA  209



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =   246 bits (629),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE+
Sbjct  729  ALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVEN  788

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+
Sbjct  789  VENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQV  848

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDP++   SA+
Sbjct  849  VFSRPGNVAAFGDPFRNFPSAH  870



>ref|XP_011470580.1| PREDICTED: sterol 24-C-methyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=270

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQF S+PDE YDEYR+   FI+EYI PGGCLPSLSR+T+AMAASSRL VEH
Sbjct  129  ALAENGLLVLQFTSLPDELYDEYRRCPSFIREYILPGGCLPSLSRLTAAMAASSRLSVEH  188

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IG HYY+TL+ WR NFLE+QS+I  LGFD KFIRTWEYYFDYCAAGF+ CTLG+YQI
Sbjct  189  LENIGSHYYRTLKYWRKNFLEKQSEIQALGFDDKFIRTWEYYFDYCAAGFNACTLGNYQI  248

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV    DPYKG  SAY
Sbjct  249  VFSRPGNVVLLNDPYKGFPSAY  270



>gb|KFK39641.1| hypothetical protein AALP_AA3G270000 [Arabis alpina]
Length=438

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFI+EYIFPGGCLPSL+RVTSAM++SSRLC+E 
Sbjct  301  ALAEDGIFVLQFISIPEERYNEYRLNSDFIREYIFPGGCLPSLARVTSAMSSSSRLCIES  360

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYY TL+ WR NFLE+Q +I+DLGF+ KFIRTWEYYFDYCAAGF T TLGDYQ+
Sbjct  361  VENIGIHYYHTLKYWRKNFLEKQKEIMDLGFNDKFIRTWEYYFDYCAAGFKTLTLGDYQV  420

Query  331  VFSRPGNVTAFGDPY  287
            VFSRPGNV AFGDP+
Sbjct  421  VFSRPGNVAAFGDPF  435



>ref|XP_011029773.1| PREDICTED: uncharacterized protein LOC105129420 isoform X3 [Populus 
euphratica]
Length=732

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+
Sbjct  592  LAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHV  651

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+V
Sbjct  652  ENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVV  711

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PYK   SAY
Sbjct  712  FSRPGNVVALSNPYKSFPSAY  732



>ref|XP_006354535.1| PREDICTED: pavine N-methyltransferase-like [Solanum tuberosum]
Length=439

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +L E+G+ VLQFIS+PD  YDEYR S+ FI EYIFPGGCLP+LSRVTSAMAA+SRLCV H
Sbjct  297  ALTEDGLLVLQFISMPDPMYDEYRHSAGFINEYIFPGGCLPALSRVTSAMAAASRLCVVH  356

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIG+HYYQTLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF T TLGDYQI
Sbjct  357  LEDIGVHYYQTLRCWRKNFLKNKSQIHALGFDDKFIRTWEYYFDYCAAGFKTHTLGDYQI  416

Query  331  VFSRPGNVTAFGDPYK-GLASAY  266
            VFSRPGNV  FGDPY   + SAY
Sbjct  417  VFSRPGNVATFGDPYNVTMPSAY  439



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  752  ALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEN  811

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR  FLERQ QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  812  VENIGIHYYQTLRLWRKTFLERQKQINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQV  871

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGNV A GDP +   SA
Sbjct  872  VFSRPGNVAALGDPSRSFPSA  892



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+
Sbjct  726  LAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHV  785

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+V
Sbjct  786  ENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVV  845

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PYK   SAY
Sbjct  846  FSRPGNVVALSNPYKSFPSAY  866



>ref|XP_010670960.1| PREDICTED: uncharacterized protein LOC104887889 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=725

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+
Sbjct  585  LAANGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHI  644

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  645  ENIGIHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIV  704

Query  328  FSRPGNVTAFGDPYKG  281
            FSRPGN+ +FG  Y G
Sbjct  705  FSRPGNLASFGGAYAG  720



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+
Sbjct  725  LAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+V
Sbjct  785  ENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PYK   SAY
Sbjct  845  FSRPGNVVALSNPYKSFPSAY  865



>ref|XP_002314494.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
 gb|EEF00665.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
Length=460

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH
Sbjct  315  ALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEH  374

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDY +AGF + TL DYQ+
Sbjct  375  VENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYSSAGFKSYTLRDYQV  434

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV A G+PYKG  SAY
Sbjct  435  VFSRPGNVEALGNPYKGFPSAY  456



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFIS P+ERY+EYR SSDFIKEYIFPG C+PSL++VTSAM++SSRLC+EH
Sbjct  649  ALAEDGLMVLQFISTPEERYNEYRLSSDFIKEYIFPGACVPSLAKVTSAMSSSSRLCIEH  708

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LGFD KF+RTWEYYFDYCAAGF T TLGDYQ+
Sbjct  709  VENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFVRTWEYYFDYCAAGFKTRTLGDYQL  768

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  769  VFSRPGNVAAFADSYRGFPSAY  790



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAA+SRLC+EHL
Sbjct  712  LAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAAASRLCMEHL  771

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  772  ENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIV  831

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGN  AF +PYK
Sbjct  832  FSRPGNAAAFSNPYK  846



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAMA+SSRLCVEH+
Sbjct  729  LAENGLFVLQFISIPEERYDEYRKSSDFIKEYIFPGGCLPSLTRITSAMASSSRLCVEHV  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGI YYQTLR WR NFLE Q + L LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  789  ENIGIQYYQTLRYWRKNFLENQRETLSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVV  848

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PY+G  SAY
Sbjct  849  FSRPGNVVALSNPYRGFPSAY  869



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLCVEH+
Sbjct  725  LAEDGLLVLQFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE+QS+IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+V
Sbjct  785  ENIGLHYYQTLRHWRKNFLEKQSKILALGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGNV A G+PYK   +A
Sbjct  845  FSRPGNVAALGNPYKRFPTA  864



>ref|XP_006420311.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
 gb|ESR33551.1| hypothetical protein CICLE_v10005727mg [Citrus clementina]
Length=246

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF S PD+ YDEYR S  F+ EYIFPGGC+PSLSRVT+AM +SSRLCVEH+
Sbjct  104  LAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCVEHV  163

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+E+QS+IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIV
Sbjct  164  ENIGIHYYQTLRCWRKNFMEKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIV  223

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPG+V+AF +PY+GL SAY
Sbjct  224  FSRPGDVSAFSNPYEGLPSAY  244



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LA++G+ VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH
Sbjct  726  ALAQDGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEH  785

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYY+TLR WR NFLERQ  I+ LGFD +FIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  786  VENIGIHYYKTLRLWRKNFLERQKPIIALGFDDQFIRTWEYYFDYCAAGFKTLTLGNYQV  845

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN+ AF D YKG  SAY
Sbjct  846  VFSRPGNLAAFADSYKGFPSAY  867



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFIS P+ERY+EYR SSDFIKEYIFPG C+PSL++VTSAM++SSRLC+EH
Sbjct  723  ALAEDGLMVLQFISTPEERYNEYRLSSDFIKEYIFPGACVPSLAKVTSAMSSSSRLCIEH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+ LGFD KF+RTWEYYFDYCAAGF T TLGDYQ+
Sbjct  783  VENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFVRTWEYYFDYCAAGFKTRTLGDYQL  842

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AF D Y+G  SAY
Sbjct  843  VFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA NG+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+
Sbjct  726  LAANGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHI  785

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIV
Sbjct  786  ENIGIHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIV  845

Query  328  FSRPGNVTAFGDPYKG  281
            FSRPGN+ +FG  Y G
Sbjct  846  FSRPGNLASFGGAYAG  861



>emb|CDX77514.1| BnaA07g06520D [Brassica napus]
Length=803

 Score =   242 bits (617),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE+
Sbjct  661  ALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVEN  720

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+
Sbjct  721  VENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQV  780

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDP+     A+
Sbjct  781  VFSRPGNVAAFGDPFHSFPYAH  802



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =   242 bits (618),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            +A +G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TS+MA++SRLCVEH+
Sbjct  723  MANDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSSMASTSRLCVEHV  782

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+ GIHYYQTLR WR NFLERQS+IL LGF++KFIRTWEYYFDYC AGF + TLG+YQ+V
Sbjct  783  ENFGIHYYQTLRLWRKNFLERQSEILALGFNEKFIRTWEYYFDYCGAGFKSRTLGNYQVV  842

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNVTAF DPYK
Sbjct  843  FSRPGNVTAFTDPYK  857



>gb|EPS65744.1| cyclopropane fatty acid synthase, partial [Genlisea aurea]
Length=567

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ++G+ VLQFISIPD RYD YR+SSDFIKEYIFPGGCLPSLSRVT+AMA +SR CVEHL
Sbjct  428  LVKDGLLVLQFISIPDVRYDTYRRSSDFIKEYIFPGGCLPSLSRVTAAMATASRFCVEHL  487

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            EDIGIHYY TLRCWR  FL  + +I DLGFD+KFIRTW YYFDYCAAGF +CTLG+YQIV
Sbjct  488  EDIGIHYYPTLRCWREKFLGSRKEIEDLGFDEKFIRTWVYYFDYCAAGFKSCTLGNYQIV  547

Query  328  FSRPGNVTAFGDPYKGLASA  269
             SRPGNVTAFG+PY  L SA
Sbjct  548  MSRPGNVTAFGNPYSSLPSA  567



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE+
Sbjct  720  ALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVEN  779

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+
Sbjct  780  VENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQV  839

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV AFGDP+     A+
Sbjct  840  VFSRPGNVAAFGDPFHSFPYAH  861



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+
Sbjct  728  LDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHV  787

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  788  ENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVV  847

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PY+G  SAY
Sbjct  848  FSRPGNVAALSNPYRGFPSAY  868



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+
Sbjct  729  LDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHV  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  789  ENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVV  848

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV A  +PY+G  SAY
Sbjct  849  FSRPGNVAALSNPYRGFPSAY  869



>ref|XP_009586644.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009586645.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
Length=747

 Score =   239 bits (609),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ V+QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV H
Sbjct  606  ALAEDGLLVVQFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNH  665

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQI
Sbjct  666  LEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQI  725

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGN+ AFGDPY  + SA
Sbjct  726  VFSRPGNIAAFGDPYSAVPSA  746



>ref|XP_009388106.1| PREDICTED: uncharacterized protein LOC103974927, partial [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSL R+T+AM ASSR C+EHL
Sbjct  200  LAEDGIFVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLGRITTAMVASSRFCIEHL  259

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLRCWR N    + +IL LGFD+KF RTWEYYF YCAAGF +CTL +YQIV
Sbjct  260  ENIGIHYNQTLRCWRNNIFANKEKILALGFDEKFFRTWEYYFMYCAAGFKSCTLANYQIV  319

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN+ AFG P+  + + 
Sbjct  320  FSRPGNLRAFGGPFNSIPAT  339



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +L E+G+  LQFIS+PD RYDEYR S+ FIKEYIFPGGCLPSLSRVTSAMAA+SRLCV H
Sbjct  724  ALTEDGLLALQFISMPDGRYDEYRHSTGFIKEYIFPGGCLPSLSRVTSAMAATSRLCVVH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR NF + +SQI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQI
Sbjct  784  LEEIGIHYYQTLRCWRKNFQKNKSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQI  843

Query  331  VFSRPGNVTAFGDPYKG-LASAY  266
            VFSRPGNV  FGDPY   + SAY
Sbjct  844  VFSRPGNVATFGDPYNDTMPSAY  866



>gb|KDO40332.1| hypothetical protein CISIN_1g0240962mg [Citrus sinensis]
Length=272

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFIS PD+ YDEYR S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHL
Sbjct  130  LATHGLLVLQFISAPDQCYDEYRLSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHL  189

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+ +QS+IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIV
Sbjct  190  ENIGIHYYQTLRCWRKNFMGKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIV  249

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPG V AF DPY+G  SAY
Sbjct  250  FSRPGKVAAFRDPYEGFPSAY  270



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ V+QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV H
Sbjct  723  ALAEDGLLVVQFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQI
Sbjct  783  LEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQI  842

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGN+ AFGDPY  + SA
Sbjct  843  VFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ V+QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV H
Sbjct  723  ALAEDGLLVVQFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNH  782

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQI
Sbjct  783  LEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQI  842

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGN+ AFGDPY  + SA
Sbjct  843  VFSRPGNIAAFGDPYSAVPSA  863



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIP+ERY+EYRQSSDFIKEYIFPGGCLPSL+R+ SAM+A+SRLC+EH+
Sbjct  729  LAEDGLIVLQFISIPEERYEEYRQSSDFIKEYIFPGGCLPSLTRIASAMSAASRLCMEHV  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NFL+ Q +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  789  ENIGIHYYQTLRYWRKNFLDNQGKILALGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQVV  848

Query  328  FSRPGNVTAFGDPYKGLASAY  266
             SRPGN+ A G+P++G  SAY
Sbjct  849  LSRPGNIAALGNPFQGFPSAY  869



>gb|KGN61575.1| hypothetical protein Csa_2G171960 [Cucumis sativus]
Length=273

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +L ENG+ VLQFIS+PD++YDE+R SS F++EYIFPGGCLPSL+RVT+AMA +SR CVEH
Sbjct  129  ALVENGLLVLQFISMPDDQYDEHRLSSGFMREYIFPGGCLPSLNRVTTAMAKASRFCVEH  188

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF +  +GDYQI
Sbjct  189  LENIGIHYYQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGFKSRIIGDYQI  248

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSR GNVT F +PY+G+ SA
Sbjct  249  VFSRAGNVTTFNNPYQGIPSA  269



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC--VE  515
            LA++G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA++S+LC  VE
Sbjct  725  LADDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMASTSKLCCSVE  784

Query  514  HLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            H+E++GIHYYQTLR WR NFLERQS+ILDLGF++KFIRTWEYYFDYC  GF + TLG+YQ
Sbjct  785  HVENMGIHYYQTLRWWRKNFLERQSEILDLGFNEKFIRTWEYYFDYCGGGFKSRTLGNYQ  844

Query  334  IVFSRPGNVTAFGDPYK  284
            +VFSRPGNVT F DPYK
Sbjct  845  VVFSRPGNVTTFSDPYK  861



>ref|XP_008796359.1| PREDICTED: uncharacterized protein LOC103711840 isoform X6 [Phoenix 
dactylifera]
Length=558

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHL
Sbjct  418  LAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHL  477

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  478  ENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  537

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN TAF +PY G+ SA
Sbjct  538  FSRPGNSTAFSNPYDGVPSA  557



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFISIP+ER++EYR+SSDFIKEYIFPGGCLPSL+R+ + MAA+SRLCVEH
Sbjct  717  ALAEDGLLVLQFISIPEERFEEYRRSSDFIKEYIFPGGCLPSLNRIVTGMAAASRLCVEH  776

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG++YY TLRCWR NFLE QS+IL LGFD+KF+RTWEYYFDYCAAGF T TLGDYQ+
Sbjct  777  VENIGMNYYLTLRCWRKNFLENQSKILALGFDEKFMRTWEYYFDYCAAGFRTYTLGDYQV  836

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN  A G PY+G  SAY
Sbjct  837  VFSRPGNYKALGYPYQGFPSAY  858



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQ ISIP+ERYDEYR SSDFIKEYIFPGGC+ SL+R+TSAMA+SSRLC+E +
Sbjct  725  LAEDGLLVLQTISIPEERYDEYRLSSDFIKEYIFPGGCILSLARITSAMASSSRLCIEQV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY+TLRCWR N LERQ +I+DLGFD+KFIRTWEYYFDY AAGF T TLGDYQ+V
Sbjct  785  ENIGIHYYRTLRCWRQNLLERQKRIVDLGFDEKFIRTWEYYFDYSAAGFKTLTLGDYQMV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN   FGDPY+G  SA
Sbjct  845  FSRPGNAALFGDPYRGFPSA  864



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFISIPDERYDE+R+SS F+KEYIFPGGCLPSLSR+TSAMA++SRLCVEHL
Sbjct  725  LAKNGLLVLQFISIPDERYDEHRRSSSFMKEYIFPGGCLPSLSRITSAMASASRLCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            ++IGIHYYQTL+CWR NFLE++ +IL LGF+++FIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  785  DNIGIHYYQTLQCWRKNFLEKKRKILALGFNEEFIRTWEYYFDYCAAGFKSHTLGNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN  AF DPY G  S+
Sbjct  845  FSRPGNDAAFADPYVGFLSS  864



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENGI VLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPS SR+TSAMAA S+LCVEH+
Sbjct  725  LAENGILVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSFSRLTSAMAAVSKLCVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL  WR NF+  +S+I++LGFD+KFIRTWEYYF YCAAGF +CTL DYQ+V
Sbjct  785  ENIGIHYYQTLIKWRDNFMANKSKIMELGFDEKFIRTWEYYFIYCAAGFKSCTLEDYQVV  844

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV AFG+PYK
Sbjct  845  FSRPGNVNAFGNPYK  859



>ref|XP_004169418.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like, 
partial [Cucumis sativus]
Length=577

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ENG+ V+QFIS+PD+RYDE+R SSDF++EYIFPGGCLPSL+RVT+AMA +SR CVEHL
Sbjct  434  LVENGLLVVQFISMPDDRYDEHRLSSDFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHL  493

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF + T+GDYQIV
Sbjct  494  ENIGIHYYQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGFKSRTIGDYQIV  553

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSR GNVT F +PY+G+ SA
Sbjct  554  FSRAGNVTTFNNPYQGIPSA  573



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =   237 bits (605),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+T+AMAAS+RLCVEH+
Sbjct  725  LAKDGVIVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLTRITTAMAASTRLCVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLR WR NF+E +S+I+ LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  785  ENIGIHYYQTLRYWRKNFVENKSKIMALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
             SRPGNV A G+PYK   +A
Sbjct  845  LSRPGNVAALGNPYKEFPAA  864



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA++SRLCVEHL
Sbjct  725  LAKDGLVVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMASASRLCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            ++IGIHYYQTL+CWR NF+E++ +IL LGF+++FIRTWEYYFDYCAAGF   TLG+YQIV
Sbjct  785  DNIGIHYYQTLQCWRKNFMEKKRKILALGFNEEFIRTWEYYFDYCAAGFKLHTLGNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN  AF DPY    S+
Sbjct  845  FSRPGNDDAFADPYVSFPSS  864



>gb|KDO54091.1| hypothetical protein CISIN_1g0146251mg, partial [Citrus sinensis]
Length=389

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF S PD+ YDEYR S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+
Sbjct  247  LAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHV  306

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+E+QS+IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIV
Sbjct  307  ENIGIHYYQTLRCWRKNFMEKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIV  366

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPG+V AF +PY+GL SAY
Sbjct  367  FSRPGDVAAFSNPYEGLPSAY  387



>ref|XP_002314497.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
 gb|EEF00668.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
Length=464

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH
Sbjct  319  ALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEH  378

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY TLRCW+  FLE +S+IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQI
Sbjct  379  VENIGSHYYLTLRCWKKYFLENKSKILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQI  438

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV   G+PYKG  SAY
Sbjct  439  VFSRPGNVGVLGNPYKGFPSAY  460



>ref|NP_188989.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAV84488.1| At3g23470 [Arabidopsis thaliana]
 gb|AAW30030.1| At3g23470 [Arabidopsis thaliana]
 gb|AEE76768.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=461

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENGI VLQF +IP+  YDE R +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  315  ALAENGIFVLQFTAIPEALYDESRLTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIEN  374

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYY TLRCWR NFLERQ QI+DLGFD KFIRTWEYYFDYCAAGF T TL  YQI
Sbjct  375  VENIGIHYYHTLRCWRKNFLERQKQIIDLGFDDKFIRTWEYYFDYCAAGFKTLTLRSYQI  434

Query  331  VFSRPGNVTAFG--DPYK  284
            VFSRPGNV AFG  DP++
Sbjct  435  VFSRPGNVAAFGDDDPFR  452



>ref|XP_002528379.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF34051.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=372

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF SIP+ERY+EYR+SSD IKEYIFPG C+PSL+R+T AMAAS+RLCVEH+
Sbjct  233  LADDGLIVLQFTSIPEERYEEYRRSSDVIKEYIFPGTCVPSLTRITIAMAASTRLCVEHV  292

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE +S+I  LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  293  ENIGMHYYQTLRLWRKNFLESKSKITALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVV  352

Query  328  FSRPGNVTAFGDPYKGLASA  269
             SRPGNV A G+PY    +A
Sbjct  353  LSRPGNVAALGNPYNEFPAA  372



>ref|XP_008796357.1| PREDICTED: uncharacterized protein LOC103711840 isoform X4 [Phoenix 
dactylifera]
Length=684

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHL
Sbjct  544  LAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHL  603

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  604  ENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  663

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN TAF +PY G+ SA
Sbjct  664  FSRPGNSTAFSNPYDGVPSA  683



>ref|XP_008796358.1| PREDICTED: uncharacterized protein LOC103711840 isoform X5 [Phoenix 
dactylifera]
Length=683

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHL
Sbjct  543  LAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHL  602

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  603  ENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  662

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN TAF +PY G+ SA
Sbjct  663  FSRPGNSTAFSNPYDGVPSA  682



>ref|XP_004247760.1| PREDICTED: uncharacterized protein LOC101261068 [Solanum lycopersicum]
Length=436

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQFIS+PD  YDE R SS FIKEYIFPGG LP+LSRVTSAMA++SRLCV H
Sbjct  297  ALAEDGLLVLQFISLPDTMYDENRLSSGFIKEYIFPGGYLPALSRVTSAMASASRLCVVH  356

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LEDIG+HYYQTLRCWR NFL  +SQI  LGFD+KFIRTWEYYFDYCAAGF T TLGDYQI
Sbjct  357  LEDIGVHYYQTLRCWRKNFLNNKSQIRALGFDEKFIRTWEYYFDYCAAGFKTRTLGDYQI  416

Query  331  VFSRPGNVTAFGD-PYK  284
            VFSRPGNV  FGD PY 
Sbjct  417  VFSRPGNVATFGDHPYN  433



>ref|XP_006299255.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
 gb|EOA32153.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
Length=424

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LA+NGI VLQF +IP++ YDE R SS FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  278  ALAQNGIFVLQFTAIPEKLYDESRLSSGFITEYIFPGGCLPSLARVTSAMASSSRLCIEN  337

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+ GIHYY TLRCWR NFLERQ QI+DLGFD KFIRTWEYYFDYCAAGF T TL +YQI
Sbjct  338  VENFGIHYYHTLRCWRKNFLERQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLKNYQI  397

Query  331  VFSRPGNVTAFGD  293
            VFSRPGN+ AFGD
Sbjct  398  VFSRPGNLAAFGD  410



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+T+AM A+S+LCVEH+
Sbjct  725  LADDGLLVLQFISIPEERYNEYRRSSDFIKEYIFPGGCLPSLARITTAMNAASKLCVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE+QS+I  LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+V
Sbjct  785  ENIGLHYYQTLRYWRKNFLEKQSKIHALGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGNV A G+PYK   SA
Sbjct  845  FSRPGNVVALGNPYKDFPSA  864



>gb|KJB28514.1| hypothetical protein B456_005G052900 [Gossypium raimondii]
Length=865

 Score =   235 bits (599),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+T+AM A+S+LCVEH+
Sbjct  725  LADDGLLVLQFISIPEERYNEYRRSSDFIKEYIFPGGCLPSLARITTAMNAASKLCVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE+QS+I  LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+V
Sbjct  785  ENIGLHYYQTLRYWRKNFLEKQSKIHALGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGNV A G+PYK   SA
Sbjct  845  FSRPGNVVALGNPYKDFPSA  864



>ref|XP_004173332.1| PREDICTED: LOW QUALITY PROTEIN: probable fatty acid methyltransferase-like, 
partial [Cucumis sativus]
Length=325

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  +SR C+EHL
Sbjct  185  LAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHL  244

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV
Sbjct  245  ENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIV  304

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            +SRPGNV  F +PY+G  SAY
Sbjct  305  YSRPGNVAVFNNPYQGFPSAY  325



>ref|XP_011041574.1| PREDICTED: uncharacterized protein LOC105137508 [Populus euphratica]
Length=668

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH
Sbjct  281  ALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEH  340

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYCAAGF + TL +YQI
Sbjct  341  VENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLWNYQI  400

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV   G+PYKG  SAY
Sbjct  401  VFSRPGNVGVLGNPYKGFPSAY  422



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHL
Sbjct  671  LAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHL  730

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  731  ENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  790

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN TAF +PY G+ SA
Sbjct  791  FSRPGNSTAFSNPYDGVPSA  810



>gb|KCW60259.1| hypothetical protein EUGRSUZ_H029682, partial [Eucalyptus grandis]
Length=458

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF SIPDERY+EYRQSSDFIKEYIFPG C+PSLSR+TSAMA++SRL VEH+
Sbjct  318  LAKDGLLVLQFTSIPDERYEEYRQSSDFIKEYIFPGCCVPSLSRITSAMASASRLSVEHV  377

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            ++IGIH+YQTLRCWR NF+E+Q +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  378  DNIGIHFYQTLRCWRKNFMEKQRKILALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQIV  437

Query  328  FSRPGNVTAFGDPY  287
            FSRPGN  AF D Y
Sbjct  438  FSRPGNEAAFTDLY  451



>gb|KJB38366.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=802

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+
Sbjct  662  LAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHV  721

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE QS+I+ LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+V
Sbjct  722  ENIGLHYYQTLRYWRRNFLENQSKIMSLGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVV  781

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A G+PYK
Sbjct  782  FSRPGNVAALGNPYK  796



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+
Sbjct  688  LAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHV  747

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE QS+I+ LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+V
Sbjct  748  ENIGLHYYQTLRYWRRNFLENQSKIMSLGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVV  807

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A G+PYK
Sbjct  808  FSRPGNVAALGNPYK  822



>gb|KJB38367.1| hypothetical protein B456_006G251800 [Gossypium raimondii]
Length=865

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+
Sbjct  725  LAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE QS+I+ LGF++KFIRTWEYYFDYCAAGF + TLG+YQ+V
Sbjct  785  ENIGLHYYQTLRYWRRNFLENQSKIMSLGFNEKFIRTWEYYFDYCAAGFKSNTLGNYQVV  844

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A G+PYK
Sbjct  845  FSRPGNVAALGNPYK  859



>ref|XP_006489667.1| PREDICTED: uncharacterized protein LOC102613225 isoform X2 [Citrus 
sinensis]
Length=603

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF S PD+ YDEYR S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+
Sbjct  461  LAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHV  520

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+E+QS+IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIV
Sbjct  521  ENIGIHYYQTLRCWRKNFMEKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIV  580

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV AF +PY+GL SAY
Sbjct  581  FSRPGNVAAFSNPYEGLPSAY  601



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHL
Sbjct  724  LAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHL  783

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  784  ENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  843

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN TAF +PY G+ SA
Sbjct  844  FSRPGNSTAFSNPYDGVPSA  863



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHL
Sbjct  725  LAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  785  ENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN TAF +PY G+ SA
Sbjct  845  FSRPGNSTAFSNPYDGVPSA  864



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A+SRLCVEH+
Sbjct  693  LAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSATSRLCVEHV  752

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTLR WR NFLE QS+I+ LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ+V
Sbjct  753  ENIGLHYYQTLRYWRRNFLENQSKIMSLGFNDKFIRTWEYYFDYCAAGFKSNTLGNYQVV  812

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGNV A G+PYK
Sbjct  813  FSRPGNVAALGNPYK  827



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQF+SIPD RYDE R SSDFIKE+IFPGGCLPSL+RVTSAMA+SSRLC+EH
Sbjct  726  ALAEEGLLVLQFVSIPDSRYDENRLSSDFIKEHIFPGGCLPSLARVTSAMASSSRLCIEH  785

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGI+YY+TLRCWR NFLERQ Q+  LGFD+KFIR WEYY DY AAGF T TLGDYQ+
Sbjct  786  VENIGINYYKTLRCWRHNFLERQEQVKALGFDEKFIRKWEYYLDYFAAGFKTLTLGDYQV  845

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGN   FGDPY    SA
Sbjct  846  VFSRPGNTAVFGDPYMSFPSA  866



>ref|XP_002314496.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
 gb|EEF00667.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
Length=460

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQ  SI DERYDEYR+SSDFIKEYIFPG C+PSLSR+TSAM  +SRLCVEH
Sbjct  315  ALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGACVPSLSRITSAMGVASRLCVEH  374

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY TLRCW+  FLE +S+IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQI
Sbjct  375  VENIGSHYYLTLRCWKKYFLENKSKILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQI  434

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV   G+PYKG  SAY
Sbjct  435  VFSRPGNVGVLGNPYKGFPSAY  456



>ref|XP_006378321.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
 gb|ERP56118.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
Length=466

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ VLQ ISI DE YDE+R+SS F++EYIFPGGCLPSLSR+TSAM  +SRLCVEH
Sbjct  321  ALAEDGLLVLQSISIADECYDEHRRSSCFMREYIFPGGCLPSLSRITSAMGVASRLCVEH  380

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY TLR WR  FLE +S+IL +GFD+KFIRTWEYYFDYCAAGF + TLGDYQI
Sbjct  381  VENIGSHYYHTLRRWRKTFLENKSKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLGDYQI  440

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGNV   G+PYKG  SAY
Sbjct  441  VFSRPGNVGVLGNPYKGFPSAY  462



>ref|XP_006489666.1| PREDICTED: uncharacterized protein LOC102613225 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF S PD+ YDEYR S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+
Sbjct  532  LAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHV  591

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+E+QS+IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIV
Sbjct  592  ENIGIHYYQTLRCWRKNFMEKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIV  651

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGNV AF +PY+GL SAY
Sbjct  652  FSRPGNVAAFSNPYEGLPSAY  672



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -2

Query  694  ISLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVE  515
            + LAE+G+ VLQFI++PD RYDE R S  FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E
Sbjct  722  VVLAEDGLLVLQFITVPDSRYDEIRLSPGFITEYIFPGGCLPSLTRVTSAMASSSRLCIE  781

Query  514  HLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            H+E+IGIHYY+TLRCWR NF ERQ +I  +GFD+KFIR WEYYFDYCAAGF T T+GDYQ
Sbjct  782  HVENIGIHYYKTLRCWRQNFKERQEEIKAIGFDEKFIRKWEYYFDYCAAGFKTLTVGDYQ  841

Query  334  IVFSRPGNVTAFGDPYKGLASA  269
            +VFSRPGN   FGDPY    SA
Sbjct  842  VVFSRPGNTATFGDPYMNFPSA  863



>ref|XP_010936015.1| PREDICTED: uncharacterized protein LOC105055750 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEY+FPGGC+PSLSR+TSAMAA+SR CVEH+
Sbjct  543  LAEDGLFVLQFISIPDERYDEYRRSSDFIKEYVFPGGCIPSLSRITSAMAATSRFCVEHV  602

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY+TLRCWR N ++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  603  ENIGIHYYETLRCWRNNLMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  662

Query  328  FSRPGNVTAFGDPY  287
            FSRPGN+TA G  Y
Sbjct  663  FSRPGNLTALGSLY  676



>ref|XP_006489664.1| PREDICTED: uncharacterized protein LOC102612222 isoform X3 [Citrus 
sinensis]
Length=674

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFIS PD+ YDEYR S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHL
Sbjct  532  LATHGLLVLQFISAPDQCYDEYRLSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHL  591

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+ +QS+IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIV
Sbjct  592  ENIGIHYYQTLRCWRKNFMGKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIV  651

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPG V AF DPY+G  SAY
Sbjct  652  FSRPGKVAAFRDPYEGFPSAY  672



>emb|CDY18120.1| BnaA01g23810D [Brassica napus]
Length=460

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -2

Query  694  ISLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVE  515
            ++LA++GI V+QF ++P+E YDE R SS FI EYIFPGGCLPSL+RVTSAM++SSRLC+E
Sbjct  314  VALAKDGIFVMQFTAVPEELYDETRLSSGFITEYIFPGGCLPSLARVTSAMSSSSRLCIE  373

Query  514  HLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
             +E+IGIHYY TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY AAGF T TL  YQ
Sbjct  374  DVENIGIHYYYTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQ  433

Query  334  IVFSRPGNVTAFGDPYKGLASA  269
            IVFSRPGN+ AFGDP+    SA
Sbjct  434  IVFSRPGNIAAFGDPFHSFPSA  455



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+G+ V+QF  IPD+RYDEYR SSDFIKEYIF GGCLPSL+R+TSAMA+SSRL ++ 
Sbjct  731  ALAEDGLLVMQFAWIPDQRYDEYRLSSDFIKEYIFHGGCLPSLARLTSAMASSSRLYIQQ  790

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG+HYYQT+RCWR NF ER+ QI+DLGFD+KFIRTWEYYFDYC+AGF T TLG+YQ+
Sbjct  791  VENIGVHYYQTIRCWRKNFTERRRQIMDLGFDEKFIRTWEYYFDYCSAGFRTFTLGNYQM  850

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSR G+ +AFGDPY+   SAY
Sbjct  851  VFSRLGSTSAFGDPYRSFPSAY  872



>ref|XP_004169247.1| PREDICTED: uncharacterized protein LOC101225338, partial [Cucumis 
sativus]
Length=800

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +L ENG+ VLQFIS+PD++YDE+R SS F++EYIFPGGCLPSL+RVT+AMA +SR CVEH
Sbjct  656  ALVENGLLVLQFISMPDDQYDEHRLSSGFMREYIFPGGCLPSLNRVTTAMAKASRFCVEH  715

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF +  +GDYQI
Sbjct  716  LENIGIHYYQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGFKSRIIGDYQI  775

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSR GNVT F +PY+G+ SA
Sbjct  776  VFSRAGNVTTFNNPYQGIPSA  796



>ref|XP_006489663.1| PREDICTED: uncharacterized protein LOC102612222 isoform X2 [Citrus 
sinensis]
Length=779

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFIS PD+ YDEYR S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHL
Sbjct  637  LATHGLLVLQFISAPDQCYDEYRLSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHL  696

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+ +QS+IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIV
Sbjct  697  ENIGIHYYQTLRCWRKNFMGKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIV  756

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPG V AF DPY+G  SAY
Sbjct  757  FSRPGKVAAFRDPYEGFPSAY  777



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERYDEYR+SSDFIKEY+FPGGC+PSLSR+TSAMAA+SR CVEH+
Sbjct  724  LAEDGLFVLQFISIPDERYDEYRRSSDFIKEYVFPGGCIPSLSRITSAMAATSRFCVEHV  783

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY+TLRCWR N ++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+V
Sbjct  784  ENIGIHYYETLRCWRNNLMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMV  843

Query  328  FSRPGNVTAFGDPY  287
            FSRPGN+TA G  Y
Sbjct  844  FSRPGNLTALGSLY  857



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFIS PD+ YDEYR S  FIKEYIFPGGCLPSL RVTSAM +SS LCVEHL
Sbjct  729  LATHGLLVLQFISAPDQCYDEYRLSPGFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHL  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYYQTLRCWR NF+ +QS+IL LGF++KFIRTWEYYFDYCAA F +  +GDYQIV
Sbjct  789  ENIGIHYYQTLRCWRKNFMGKQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIV  848

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPG V AF DPY+G  SAY
Sbjct  849  FSRPGKVAAFRDPYEGFPSAY  869



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI V QFI+IP+ERY+EYR +SDF++EYIFPGGCLPSL+RVTSAMA+SSRLCVE+
Sbjct  727  ALAEDGIIVHQFIAIPEERYNEYRLNSDFVREYIFPGGCLPSLARVTSAMASSSRLCVEN  786

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYY+TLR WR NFLE + QI+DLGFD KFIRTWEYYFDY AA   T T+ DYQ+
Sbjct  787  VENIGNHYYKTLRSWRKNFLENEKQIMDLGFDDKFIRTWEYYFDYSAAALKTLTIADYQV  846

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGNV A GDP++   SA
Sbjct  847  VFSRPGNVAALGDPFRSFPSA  867



>ref|NP_001189954.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76770.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=492

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  292  ALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIEN  351

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDYCAAGF T TL +YQI
Sbjct  352  VENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQI  411

Query  331  VFSRPGNVTAFG--DPYKGLA  275
            VFSRPGNV AFG  DP+   A
Sbjct  412  VFSRPGNVAAFGNDDPFHSSA  432



>ref|XP_009107970.1| PREDICTED: uncharacterized protein LOC103833648 [Brassica rapa]
Length=460

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  694  ISLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVE  515
            ++LA++GI V+QF ++P+E YDE R SS FI EYIFPGGCLPSL+RVTSAM++SSRLC+E
Sbjct  314  VALAKDGIFVMQFTAVPEELYDETRLSSGFITEYIFPGGCLPSLARVTSAMSSSSRLCIE  373

Query  514  HLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
             +E+IGIHYY TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY AAGF T TL  YQ
Sbjct  374  DVENIGIHYYYTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQ  433

Query  334  IVFSRPGNVTAFGDPYKGLASA  269
            IVFSRPGN+ AFG P+    SA
Sbjct  434  IVFSRPGNIAAFGHPFHSFPSA  455



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFI+IPD+RYDE R+S DF+KEYIFPGGCLPSL R+TSAM  +SRLC+EH+
Sbjct  725  LAEDGLLVLQFIAIPDKRYDEVRKSIDFLKEYIFPGGCLPSLYRITSAMRTASRLCMEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +YY TL+CWR NFL+ + +IL +GFD+KFIRTWEYYFDYCAAGF + TL DYQIV
Sbjct  785  ENIGSNYYLTLKCWRKNFLKNKEKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLLDYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN+ A G+PYKG  SAY
Sbjct  845  FSRPGNIAALGNPYKGFPSAY  865



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF SIPDERY+EYRQSSDFIKEYIFPG C+PSLSR+TSAMA++SRL VEH+
Sbjct  725  LAKDGLLVLQFTSIPDERYEEYRQSSDFIKEYIFPGCCVPSLSRITSAMASASRLSVEHV  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            ++IGIH+YQTLRCWR NF+E+Q +IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  785  DNIGIHFYQTLRCWRKNFMEKQRKILALGFNEKFIRTWEYYFDYCAAGFKSHTLGNYQIV  844

Query  328  FSRPGNVTAFGDPY  287
            FSRPGN  AF D Y
Sbjct  845  FSRPGNEAAFTDLY  858



>emb|CDY09025.1| BnaC01g30660D [Brassica napus]
Length=137

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -2

Query  664  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  485
            +QF ++P+E YDE R SS FI EYIFPGGCLPSL+RVTSAM+ SS+LC+E +E+IGIHYY
Sbjct  1    MQFTAVPEELYDEIRLSSGFITEYIFPGGCLPSLARVTSAMSFSSKLCIEDVENIGIHYY  60

Query  484  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  305
             TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY AAGF T TL  YQIVFSRPGN+ 
Sbjct  61   YTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYVAAGFKTLTLRSYQIVFSRPGNIA  120

Query  304  AFGDPYKGLASA  269
            AFGDP++   SA
Sbjct  121  AFGDPFRSFPSA  132



>ref|XP_010532684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Tarenaya hassleriana]
Length=389

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SSRLC+EH
Sbjct  244  ALAEEGLLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSSRLCIEH  303

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+
Sbjct  304  VENIGIHYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQV  363

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGN T FGDPY    SA
Sbjct  364  VFSRPGNTTMFGDPYMSYPSA  384



>ref|XP_009758040.1| PREDICTED: uncharacterized protein LOC104210742, partial [Nicotiana 
sylvestris]
Length=251

 Score =   211 bits (538),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            SLAE+G+ VLQF+S+PDERYDEYR S  FIKEYIFPGGCLP+LSRVTSAMAA+S+LCV H
Sbjct  130  SLAEDGLLVLQFVSMPDERYDEYRYSIGFIKEYIFPGGCLPALSRVTSAMAAASKLCVVH  189

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IGIHYYQTLRCWR NFLE QSQI  LGFD KFIRTWEYYFDYCAAGF T T+GDYQ+
Sbjct  190  LEEIGIHYYQTLRCWRKNFLENQSQIRALGFDDKFIRTWEYYFDYCAAGFKTRTIGDYQV  249



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =   224 bits (570),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  +SR C+EHL
Sbjct  725  LAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV
Sbjct  785  ENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIV  844

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            +SRPGNV  F +PY+G  SAY
Sbjct  845  YSRPGNVAVFNNPYQGFPSAY  865



>gb|KCW60262.1| hypothetical protein EUGRSUZ_H02971, partial [Eucalyptus grandis]
Length=807

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIPDERY+EYR+SSDFIKEYIFPGGCLPSLSRVTSAMA++SRL VEH+
Sbjct  667  LAKDGLFVLQFISIPDERYEEYRRSSDFIKEYIFPGGCLPSLSRVTSAMASASRLSVEHV  726

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            ++IGIHY+QTLRCWR NF+E+Q +IL  GF++KFIRTW+YYFDYCAAGF + TLG+YQIV
Sbjct  727  DNIGIHYHQTLRCWRKNFMEKQRKILAPGFNEKFIRTWQYYFDYCAAGFKSHTLGNYQIV  786

Query  328  FSRPGNVTAFGDPY  287
            F RPGN  AF D Y
Sbjct  787  FLRPGNDAAFTDLY  800



>ref|XP_010532682.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SSRLC+EH
Sbjct  295  ALAEEGLLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSSRLCIEH  354

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+
Sbjct  355  VENIGIHYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQV  414

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGN T FGDPY    SA
Sbjct  415  VFSRPGNTTMFGDPYMSYPSA  435



>ref|XP_007035220.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06146.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=375

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFIS+ +E++ EY +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+
Sbjct  233  LAKDGLFVLQFISMTEEQFPEYLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHV  292

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +Y QTLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+V
Sbjct  293  ENIGPNYVQTLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVV  352

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  A GDPY+G  SAY
Sbjct  353  FSRPGNFAALGDPYQGFPSAY  373



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =   220 bits (561),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF SIPDERYD YR+SS+FIKEYIFPG C+PSLSRVT AMAA+SRLCVEH 
Sbjct  687  LADDGLLVLQFTSIPDERYDAYRRSSEFIKEYIFPGCCIPSLSRVTLAMAAASRLCVEHA  746

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHYY TLR WR NF+E  S+IL LGFD+KFIR WEYYFDYCAAGF + TLG+YQ+V
Sbjct  747  ENIGIHYYPTLRWWRKNFMENHSKILALGFDEKFIRIWEYYFDYCAAGFKSRTLGNYQMV  806

Query  328  FSRPGNVTAFGDPYKGLAS  272
            FSRPGN TAF +  K +AS
Sbjct  807  FSRPGNKTAFSNLDKKMAS  825



>ref|XP_010466684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X2 [Camelina sativa]
Length=434

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  682  ENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  503
            E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+
Sbjct  313  EDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVEN  372

Query  502  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ+ 
Sbjct  373  IGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQVT  430



>ref|XP_010466685.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Camelina sativa]
Length=428

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  682  ENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  503
            E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+
Sbjct  313  EDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVEN  372

Query  502  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  373  IGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>ref|XP_010466683.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Camelina sativa]
Length=440

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  682  ENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  503
            E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+EH+E+
Sbjct  313  EDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIEHVEN  372

Query  502  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DYCAAGF T TLGDYQ
Sbjct  373  IGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDYCAAGFKTRTLGDYQ  428



>ref|XP_002528378.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
 gb|EEF34050.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
Length=809

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = -2

Query  664  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  485
            LQFIS+P+ERYDEYR+SS+F+KEYIFPG C PSL+R+T+AMA+S+RLC+EH+E+IGIHYY
Sbjct  677  LQFISMPEERYDEYRKSSEFLKEYIFPGLCAPSLTRITTAMASSTRLCMEHVENIGIHYY  736

Query  484  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  305
            QTLR WR NFLE +S+IL LGF++KFIRTWEYYFDYCA+GF T TLGDYQ+V SRP NV 
Sbjct  737  QTLRYWRKNFLENKSKILALGFNEKFIRTWEYYFDYCASGFKTRTLGDYQVVLSRPRNVA  796

Query  304  AFGDPYKGLASA  269
            A G+PY   A+A
Sbjct  797  ALGNPYDEFAAA  808



>ref|XP_010670925.1| PREDICTED: uncharacterized protein LOC104887860 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=793

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+ G+ VLQ ISIPDERYD +R+SSDF++EYIFPGGCLPSLSR+T+AMA++SRLCVEH+
Sbjct  650  LADTGLLVLQTISIPDERYDGHRKSSDFMREYIFPGGCLPSLSRLTTAMASASRLCVEHV  709

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HY Q LRCWR NFLE Q +I  LGFD KF+R WEYYFDY A+ F T TLGDYQIV
Sbjct  710  ENIGVHYGQALRCWRKNFLENQGKIRSLGFDDKFMRAWEYYFDYMASMFKTRTLGDYQIV  769

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN+ AF DPY+ + S++
Sbjct  770  FSRQGNLVAFSDPYECIPSSH  790



>ref|XP_007035218.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
 gb|EOY06144.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
Length=412

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFIS+ +E++ E+ +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+
Sbjct  270  LAKDGLFVLQFISMTEEQFPEHLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHV  329

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +Y QTLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+V
Sbjct  330  ENIGPNYVQTLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVV  389

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  A GDPY+G   AY
Sbjct  390  FSRPGNFAALGDPYQGFPLAY  410



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+ G+ VLQ ISIPDERYD +R+SSDF++EYIFPGGCLPSLSR+T+AMA++SRLCVEH+
Sbjct  729  LADTGLLVLQTISIPDERYDGHRKSSDFMREYIFPGGCLPSLSRLTTAMASASRLCVEHV  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HY Q LRCWR NFLE Q +I  LGFD KF+R WEYYFDY A+ F T TLGDYQIV
Sbjct  789  ENIGVHYGQALRCWRKNFLENQGKIRSLGFDDKFMRAWEYYFDYMASMFKTRTLGDYQIV  848

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN+ AF DPY+ + S++
Sbjct  849  FSRQGNLVAFSDPYECIPSSH  869



>ref|XP_007035217.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
 gb|EOY06143.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
Length=433

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFIS+ +E++ E+ +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+
Sbjct  291  LAKDGLFVLQFISMTEEQFPEHLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHV  350

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +Y QTLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+V
Sbjct  351  ENIGPNYVQTLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVV  410

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  A GDPY+G   AY
Sbjct  411  FSRPGNFAALGDPYQGFPLAY  431



>ref|XP_002460494.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
 gb|EER97015.1| hypothetical protein SORBIDRAFT_02g029350 [Sorghum bicolor]
Length=490

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 119/142 (84%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++GI VLQFISIP+ERY+EYR+SSDFIKEYIFPGGC+PSL+R+TSAM+A+SRLC+EHL
Sbjct  345  LAQDGIFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCIPSLARITSAMSAASRLCIEHL  404

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD+KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  405  ENIGYHYYPTLIQWRDNFMVNKDAILALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIV  464

Query  328  FSRPGN--VTAFGDPYKGLASA  269
            FSRPGN  ++  GDPY    +A
Sbjct  465  FSRPGNDKLSNNGDPYASFPAA  486



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA+NG+ VLQFIS+PDE YD +R+SS F+ EYIFPGGCLPSLSR+TSAM ++SRLCVEH+
Sbjct  734  LADNGLLVLQFISVPDELYDGFRRSSGFVYEYIFPGGCLPSLSRITSAMVSASRLCVEHV  793

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY QTLRCWR NFLE  S+I  LGFD+KF+R WEYYFDY A+ F T  LGDYQIV
Sbjct  794  ENIGIHYGQTLRCWRKNFLENHSKIRSLGFDEKFMRAWEYYFDYTASAFKTRALGDYQIV  853

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSR GN+ AF DPY+ ++S+
Sbjct  854  FSRLGNLVAFSDPYETISSS  873



>ref|XP_006420313.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
 gb|ESR33553.1| hypothetical protein CICLE_v10005536mg [Citrus clementina]
Length=296

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  661  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  482
            QF S+PD+ YD +R S  FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQ
Sbjct  166  QFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQ  225

Query  481  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  302
            T RCWR N +E+QS+IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFS P NV A
Sbjct  226  TRRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSHPSNVAA  285

Query  301  FGDPYKGLASA  269
            F +P++   SA
Sbjct  286  FSNPHESFPSA  296



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =   215 bits (548),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 121/144 (84%), Gaps = 10/144 (7%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL-----  524
            LA++G+ VLQFISIPDERY+EYR+SSDFIKEYIFPGGCLPSLSRVTSAMA++SRL     
Sbjct  691  LAKDGLFVLQFISIPDERYEEYRRSSDFIKEYIFPGGCLPSLSRVTSAMASASRLRYNCI  750

Query  523  -----CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  359
                  VEH+++IGIHY+QTLRCWR NF+E+Q +IL  GF++KFIRTW+YYFDYCAAGF 
Sbjct  751  TSSAQSVEHVDNIGIHYHQTLRCWRKNFMEKQRKILAPGFNEKFIRTWQYYFDYCAAGFK  810

Query  358  TCTLGDYQIVFSRPGNVTAFGDPY  287
            + TLG+YQIVF RPGN  AF D Y
Sbjct  811  SHTLGNYQIVFLRPGNDAAFTDLY  834



>ref|XP_006420314.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
 gb|ESR33554.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
Length=810

 Score =   214 bits (546),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -2

Query  661  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  482
            QFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHYYQ
Sbjct  680  QFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYYQ  739

Query  481  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  302
            TLRCWR NFLE+QS+IL LGF +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV A
Sbjct  740  TLRCWRKNFLEKQSKILALGFSEKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAA  799

Query  301  FGDPYKGLASA  269
            F + ++   SA
Sbjct  800  FRNQHESFPSA  810



>ref|XP_002883432.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59691.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VL FISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RVTSAM++SSRLC+E+
Sbjct  208  ALAEDGIFVLLFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVTSAMSSSSRLCIEN  267

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYYQTLR WR NFLERQ QI+DLGFD KFIR WEYYFDYCAAGF T TLG +++
Sbjct  268  VENIGIHYYQTLRLWRKNFLERQKQIIDLGFDDKFIRIWEYYFDYCAAGFKTLTLGPWRL  327



>ref|NP_001066537.1| Os12g0267200 [Oryza sativa Japonica Group]
 gb|ABA97030.2| cyclopropane fatty acid synthase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29556.1| Os12g0267200 [Oryza sativa Japonica Group]
 dbj|BAG91262.1| unnamed protein product [Oryza sativa Japonica Group]
Length=837

 Score =   213 bits (541),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENGI V QFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+
Sbjct  705  LAENGIFVTQFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHV  764

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQIV
Sbjct  765  ENIGYHYYTTLIRWRDNFMANKDKILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIV  824

Query  328  FSRPGNV  308
            FSRPGN 
Sbjct  825  FSRPGNT  831



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   216 bits (549),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAMA+SSRLCVEH+
Sbjct  642  LAENGLFVLQFISIPEERYDEYRKSSDFIKEYIFPGGCLPSLTRITSAMASSSRLCVEHV  701

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ++
Sbjct  702  ENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQLL  761

Query  328  F-SRPGNVTAFGDPYKGLAS  272
               RPG  T   DP   +A 
Sbjct  762  NPDRPGGSTR--DPVDPVAG  779


 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 85/120 (71%), Gaps = 27/120 (23%)
 Frame = -2

Query  691   SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
             +LAE+G+ VLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLC   
Sbjct  1246  ALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLC---  1302

Query  511   LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
                                     +IL +GFD+KFIRTWEYYFDY +AGF + TLGDYQ+
Sbjct  1303  ------------------------KILAMGFDEKFIRTWEYYFDYSSAGFKSYTLGDYQL  1338


 Score =   137 bits (346),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 81/119 (68%), Gaps = 27/119 (23%)
 Frame = -2

Query  691   SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
             +LAE+G+ VLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLC   
Sbjct  1533  ALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLC---  1589

Query  511   LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
                                     +IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQ
Sbjct  1590  ------------------------KILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQ  1624



>ref|XP_002467653.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
 gb|EER94651.1| hypothetical protein SORBIDRAFT_01g031685 [Sorghum bicolor]
Length=685

 Score =   211 bits (537),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+ +SRLC+EH+
Sbjct  557  LKEHGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSNASRLCIEHV  616

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL CWR NF+  + ++L +GFD+KFIRTWEYYF YCAAGF + TLGDYQIV
Sbjct  617  ENIGYHYYTTLMCWRDNFMTHRDKVLAIGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIV  676

Query  328  FSRPGNV  308
            FSRPGNV
Sbjct  677  FSRPGNV  683



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  661  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  482
            QFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+TSAM +SSRLCVE LE+IGIHY+Q
Sbjct  734  QFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRITSAMTSSSRLCVEDLENIGIHYFQ  793

Query  481  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  302
            TLRCWR NFLE+QS+I  LGF +KFIRTWEYYFDYCAAGF + TLGDYQIVFSRP NV A
Sbjct  794  TLRCWRKNFLEKQSKIRALGFSEKFIRTWEYYFDYCAAGFKSRTLGDYQIVFSRPSNVAA  853

Query  301  FGDPYKGLASA  269
            F + ++   SA
Sbjct  854  FRNQHESFPSA  864



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TSAM+ +SRLCVE +
Sbjct  667  LAEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITSAMSVASRLCVEQV  726

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAAGF + TLG+YQ
Sbjct  727  ENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAAGFKSYTLGNYQ  784



>ref|NP_001059618.1| Os07g0474600 [Oryza sativa Japonica Group]
 dbj|BAF21532.1| Os07g0474600, partial [Oryza sativa Japonica Group]
Length=390

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHL
Sbjct  248  LAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHL  307

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  308  ENIGYHYYPTLIRWRDNFMANREEIKSLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIV  367

Query  328  FSRPGN--VTAFGD-PYKGLASA  269
             SRPGN  +  F D PY    +A
Sbjct  368  LSRPGNDKLLPFADNPYATFPAA  390



>dbj|BAJ91247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +
Sbjct  184  LAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQV  243

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAAGF + TLG YQIV
Sbjct  244  ENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIV  303

Query  328  FSRPGN--VTAFGDPYKGLASA  269
            FSRPGN  +    +P+  L +A
Sbjct  304  FSRPGNDKLANTDNPFASLPAA  325



>ref|XP_010532683.1| PREDICTED: (S)-coclaurine N-methyltransferase-like isoform X2 
[Tarenaya hassleriana]
Length=438

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE G+ VLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SS   +EH
Sbjct  295  ALAEEGLLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSS--SIEH  352

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+
Sbjct  353  VENIGIHYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQV  412

Query  331  VFSRPGNVTAFGDPYKGLASA  269
            VFSRPGN T FGDPY    SA
Sbjct  413  VFSRPGNTTMFGDPYMSYPSA  433



>gb|EEC78767.1| hypothetical protein OsI_18995 [Oryza sativa Indica Group]
Length=1429

 Score =   212 bits (540),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  688   LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
             LAENGI V QF SIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+
Sbjct  1297  LAENGIFVTQFTSIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHV  1356

Query  508   EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
             E+IG HYY TL  WR NF+  + +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQIV
Sbjct  1357  ENIGYHYYTTLIRWRDNFMANKDKILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQIV  1416

Query  328   FSRPGNV  308
             FSRPGN 
Sbjct  1417  FSRPGNT  1423


 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = -2

Query  664  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  485
            L+FISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY
Sbjct  557  LEFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYY  616



>ref|XP_003590114.1| Cyclopropane fatty acid synthase [Medicago truncatula]
Length=793

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 118/149 (79%), Gaps = 10/149 (7%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC----  521
            LA++G+ VLQF SIPDERYD YR+SS+FIKEYIFPG C+PSLSRVT AMAA+SRL     
Sbjct  645  LADDGLLVLQFTSIPDERYDAYRRSSEFIKEYIFPGCCIPSLSRVTLAMAAASRLWYMLY  704

Query  520  ------VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  359
                  VEH E+IGIHYY TLR WR NF+E  S+IL LGFD+KFIR WEYYFDYCAAGF 
Sbjct  705  FNTANNVEHAENIGIHYYPTLRWWRKNFMENHSKILALGFDEKFIRIWEYYFDYCAAGFK  764

Query  358  TCTLGDYQIVFSRPGNVTAFGDPYKGLAS  272
            + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  765  SRTLGNYQMVFSRPGNKTAFSNLDKKMAS  793



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TSAMA+SSRLCVEH+
Sbjct  729  LDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITSAMASSSRLCVEHV  788

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+
Sbjct  789  ENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQV  847



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  661  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  482
            QF S+PD+ YD +R S  FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQ
Sbjct  735  QFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQ  794

Query  481  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  302
            TLRCWR N +E+QS+IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP NV A
Sbjct  795  TLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSNVAA  854

Query  301  FGDPYK  284
            F +P++
Sbjct  855  FSNPHE  860



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFIS+ +E + EY +S  F KEYIFPGGCL SL+R+ SAM A SRL VEH+
Sbjct  775  LAKDGLFVLQFISVTEELFHEYLRSPGFAKEYIFPGGCLLSLTRMLSAMGAGSRLSVEHV  834

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +Y QTLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+V
Sbjct  835  ENIGPNYVQTLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVV  894

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRP N  A GDPY+G  SAY
Sbjct  895  FSRPSNFAALGDPYQGFPSAY  915



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =   210 bits (535),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 115/145 (79%), Gaps = 4/145 (3%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  +SR C+EHL
Sbjct  646  LAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTKASRFCIEHL  705

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF + TL +YQIV
Sbjct  706  ENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKSRTLNNYQIV  765

Query  328  FSRPGN----VTAFGDPYKGLASAY  266
            +SRPGN    V   G    GL SA+
Sbjct  766  YSRPGNVAMKVAVVGGGISGLVSAF  790


 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 103/141 (73%), Gaps = 27/141 (19%)
 Frame = -2

Query  688   LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
             LAENG+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLP LSR+T+AMA +SRLC    
Sbjct  1498  LAENGLFVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPCLSRLTTAMANASRLC----  1553

Query  508   EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
                                    +IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV
Sbjct  1554  -----------------------KILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIV  1590

Query  328   FSRPGNVTAFGDPYKGLASAY  266
             +SRPGNV AF +PY+G+ SAY
Sbjct  1591  YSRPGNVAAFTNPYQGIPSAY  1611



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  661  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  482
            QF S+PD+ YD +R S  FI EY+FPGGCLPSL+R+TSAM +SSRLCVEHLE+IGIH+YQ
Sbjct  720  QFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLCVEHLENIGIHFYQ  779

Query  481  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  302
            TLRCWR N +E+QS+IL LGF++KFIRTWEYYFDYCAAGF + TLG+YQIVFSRP  V A
Sbjct  780  TLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGNYQIVFSRPSIVAA  839

Query  301  FGDPYKGLASA  269
            F +P++   SA
Sbjct  840  FSNPHESFPSA  850



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =   206 bits (525),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++GI VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHL
Sbjct  735  LAQDGIFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEHL  794

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD+KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  795  ENIGYHYYPTLIQWRDNFMANKDAILALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIV  854

Query  328  FSRPGN  311
            FSRPGN
Sbjct  855  FSRPGN  860



>gb|EEE62857.1| hypothetical protein OsJ_17660 [Oryza sativa Japonica Group]
Length=796

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENGI V QFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+
Sbjct  657  LAENGIFVTQFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHV  716

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ--  335
            E+IG HYY TL  WR NF+  + +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQ  
Sbjct  717  ENIGYHYYTTLIRWRDNFMANKDKILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQAS  776

Query  334  -----IVFSRPGNV  308
                 IVFSRPGN 
Sbjct  777  TVLLYIVFSRPGNT  790



>ref|XP_008667917.1| PREDICTED: cyclopropane fatty acid synthase isoform X1 [Zea mays]
Length=807

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++GI VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHL
Sbjct  665  LAQDGIFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEHL  724

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD+KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  725  ENIGYHYYPTLIQWRDNFMANKDAILALGFDEKFIRIWEYYFIYCAAGFKSRTLGNYQIV  784

Query  328  FSRPGN  311
            FSRPGN
Sbjct  785  FSRPGN  790



>ref|XP_006658552.1| PREDICTED: uncharacterized protein LOC102715408 [Oryza brachyantha]
Length=764

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 3/143 (2%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ASSRLC+EHL
Sbjct  622  LAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSASSRLCIEHL  681

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  682  ENIGYHYYPTLIRWRDNFMVNREEISALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIV  741

Query  328  FSRPGN--VTAFGD-PYKGLASA  269
            FSRPGN  +  F D PY    +A
Sbjct  742  FSRPGNDKLMPFADNPYTTFPAA  764



>ref|NP_188990.4| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76769.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=447

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  313  ALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIEN  372

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDYCAAGF T TL +YQ+
Sbjct  373  VENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQV  432

Query  331  VFSRPGNVT  305
              +    +T
Sbjct  433  THTHSSTLT  441



>dbj|BAB01740.1| cyclopocyclopropane fatty acid synthase-like protein [Arabidopsis 
thaliana]
Length=436

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E+
Sbjct  302  ALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLARVTSAMASSSRLCIEN  361

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDYCAAGF T TL +YQ+
Sbjct  362  VENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDYCAAGFKTLTLRNYQV  421

Query  331  VFSRPGNVT  305
              +    +T
Sbjct  422  THTHSSTLT  430



>dbj|BAK04927.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   190 bits (483),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI VLQFIS P+ERY++YR+ +DFIKEYIFPGGCLPSL RV SAM  SSR C+EH+
Sbjct  24   LAEDGILVLQFISAPEERYEQYRRRTDFIKEYIFPGGCLPSLGRVMSAMTTSSRFCIEHV  83

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + Q+L LGFD+KFIR WE+Y  Y AAGF + T+GDYQ+V
Sbjct  84   ENIGPHYYTTLMHWRDNFMTNKDQVLALGFDEKFIRIWEFYLIYSAAGFKSRTVGDYQVV  143

Query  328  FSRPGN  311
            FSRPGN
Sbjct  144  FSRPGN  149



>ref|XP_006350427.1| PREDICTED: uncharacterized protein LOC102587606 [Solanum tuberosum]
Length=513

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            SLAE+G+ VLQFISIPDERYD +R S+DF++EYIFPGG L + S+VTS MAA+SRLCVEH
Sbjct  394  SLAEDGLLVLQFISIPDERYDSHRHSTDFMREYIFPGGGLNAPSQVTSVMAAASRLCVEH  453

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            LE+IGIHYYQTL+CWR NF + QSQI  LGFD KFIRTWEYYFDYCAAG  TCT+GDYQ
Sbjct  454  LENIGIHYYQTLKCWRRNFFKNQSQIRALGFDDKFIRTWEYYFDYCAAGLKTCTIGDYQ  512



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 114/141 (81%), Gaps = 1/141 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EHL
Sbjct  735  LAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEHL  794

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  795  ENIGYHYYPTLIRWRDNFMANKDAISALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIV  854

Query  328  FSRPGN-VTAFGDPYKGLASA  269
            FSRPGN      DPY    +A
Sbjct  855  FSRPGNDKLGDNDPYASFPAA  875



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHL
Sbjct  577  LAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHL  636

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  637  ENIGYHYYPTLIRWRDNFMANREEIKSLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIV  696

Query  328  FSRPGN--VTAFGD-PYKGLASA  269
             SRPGN  +  F D PY    +A
Sbjct  697  LSRPGNDKLLPFADNPYATFPAA  719



>gb|EMS55075.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=826

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +
Sbjct  685  LAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQV  744

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAAGF + TLG YQIV
Sbjct  745  ENIGYHYYSTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIV  804

Query  328  FSRPGN--VTAFGDPYKGLASA  269
            FSRPGN  +    +PY  L +A
Sbjct  805  FSRPGNDKLACADNPYASLPAA  826



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ SSRLC+EHL
Sbjct  748  LAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSTSSRLCIEHL  807

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  808  ENIGYHYYPTLIRWRDNFMANREEIKSLGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIV  867

Query  328  FSRPGN--VTAFGD-PYKGLASA  269
             SRPGN  +  F D PY    +A
Sbjct  868  LSRPGNDKLLPFADNPYATFPAA  890



>dbj|BAJ95828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +
Sbjct  608  LAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQV  667

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAAGF + TLG YQIV
Sbjct  668  ENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIV  727

Query  328  FSRPGN--VTAFGDPYKGLASA  269
            FSRPGN  +    +P+  L +A
Sbjct  728  FSRPGNDKLANTDNPFASLPAA  749



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +
Sbjct  731  LAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQV  790

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAAGF + TLG YQIV
Sbjct  791  ENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIV  850

Query  328  FSRPGN--VTAFGDPYKGLASA  269
            FSRPGN  +    +P+  L +A
Sbjct  851  FSRPGNDKLANTDNPFASLPAA  872



>ref|XP_004296401.1| PREDICTED: uncharacterized protein LOC101310979 [Fragaria vesca 
subsp. vesca]
Length=455

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ENG+ +LQFIS+PD+RYD+YR+ + FIKEYIFPGGCLPSL RV SAMAASSRLCVEHL
Sbjct  314  LEENGLFILQFISMPDDRYDDYRRGTGFIKEYIFPGGCLPSLGRVISAMAASSRLCVEHL  373

Query  508  EDIGIHYYQTLRCWRANFLE-RQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            E+IGI    T+  ++  FL    S+IL LGF++ FIRTWEYYFDYCAAGF +  +GDYQI
Sbjct  374  ENIGIFMTATV-LYKMQFLFCIYSEILALGFNENFIRTWEYYFDYCAAGFKSHIVGDYQI  432

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSRPGN   + +PYKG  SAY
Sbjct  433  VFSRPGNALTYNNPYKGFPSAY  454



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAENG+ VLQFI+  DE+YDE R+S  F+KEYIFPGGC PSLS V S MAA+SRL   H
Sbjct  724  ALAENGLLVLQFIASADEKYDESRRSPGFVKEYIFPGGCTPSLSHVISCMAAASRLSAVH  783

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+IG HY+ TLR WR N L+  S+IL +GF++KFIRTWEYYFDYCAAGF  C LGDYQI
Sbjct  784  LEEIGCHYFHTLRRWRENLLKNHSKILAMGFNEKFIRTWEYYFDYCAAGFKYCILGDYQI  843

Query  331  VFSRPGNVTAFGD-PYKGLASAY  266
            VFSRPG+V AF + PY  +   Y
Sbjct  844  VFSRPGDVAAFSNKPYNAVPGDY  866



>gb|EMT03310.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=829

 Score =   201 bits (510),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+ +SRLC+E +
Sbjct  688  LAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSTASRLCIEQV  747

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAAGF + TLG YQIV
Sbjct  748  ENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAGFKSRTLGTYQIV  807

Query  328  FSRPGN-VTAFGD-PYKGLASA  269
            FSRPGN   A+ D PY  L +A
Sbjct  808  FSRPGNDKLAYADNPYASLPAA  829



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAENG+ VLQFISIP+    E +Q++ F+KEYIFPGG L SL R  SAMAA+SR  VEH+
Sbjct  719  LAENGLFVLQFISIPEILSKEIQQTAGFLKEYIFPGGTLLSLDRTLSAMAAASRFSVEHV  778

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGI YY TLR WR NFL  +S++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+V
Sbjct  779  ENIGISYYHTLRWWRKNFLANESKVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVV  838

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN  A GDPY G  SAY
Sbjct  839  FSRAGNFAALGDPYIGFPSAY  859



>ref|XP_010239672.1| PREDICTED: uncharacterized protein LOC100842201 isoform X2 [Brachypodium 
distachyon]
Length=821

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +
Sbjct  680  LAQDGLLVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQV  739

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF   +  I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  740  ENIGYHYYPTLVRWRDNFFANKYAISALGFDDKFIRIWEYYFMYCAAGFKSRTLGNYQIV  799

Query  328  FSRPGN-VTAFGD-PYKGLASA  269
            FSRPGN   A+ D PY  L +A
Sbjct  800  FSRPGNDKLAYADNPYASLPAA  821



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+E +
Sbjct  735  LAQDGLLVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSAASRLCIEQV  794

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF   +  I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  795  ENIGYHYYPTLVRWRDNFFANKYAISALGFDDKFIRIWEYYFMYCAAGFKSRTLGNYQIV  854

Query  328  FSRPGN-VTAFGD-PYKGLASA  269
            FSRPGN   A+ D PY  L +A
Sbjct  855  FSRPGNDKLAYADNPYASLPAA  876



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ V+Q I++P+ERYDE R+SS+FIKEYIFPGG LP L+ +T+AM  +S LCVEHL
Sbjct  725  LAEDGLAVIQVITVPEERYDELRRSSEFIKEYIFPGGSLPCLAALTAAMFRASSLCVEHL  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+HYYQTL CWR NF  + S+I  LGF + F+R W+YYF YCAAGF TCTLG+ QIV
Sbjct  785  ENIGLHYYQTLMCWRRNFNSKTSEIAKLGFSESFMRKWDYYFIYCAAGFLTCTLGNLQIV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSR GN  A G+PY+   +A
Sbjct  845  FSRSGNAAALGNPYRSFPTA  864



>gb|KHG13738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Gossypium arboreum]
Length=799

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+
Sbjct  654  LKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHV  713

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+ YY TLR WR  FLE  S++L LGFDKKF+RTWEYYFDYCAAGF T TL DYQ+V
Sbjct  714  ENIGMSYYHTLRWWRKLFLENTSKVLALGFDKKFMRTWEYYFDYCAAGFKTGTLIDYQVV  773

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN    GDPYKG  SAY
Sbjct  774  FSRAGNFGTLGDPYKGFPSAY  794



>gb|KJB12590.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
 gb|KJB12591.1| hypothetical protein B456_002G025800 [Gossypium raimondii]
Length=873

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+
Sbjct  728  LKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHV  787

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+ YY TLR WR  FLE  S++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+V
Sbjct  788  ENIGMSYYHTLRWWRKLFLENTSKVLALGFDEKFMRTWEYYFDYCAAGFKTGTLTDYQVV  847

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN    GDPYKG  SAY
Sbjct  848  FSRAGNFGTLGDPYKGFRSAY  868



>ref|XP_006664478.1| PREDICTED: uncharacterized protein LOC102701601 [Oryza brachyantha]
Length=822

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI V+QF SIP+ERYDEYR+SSDFIKEYIFPGGC+P L+R+TSAM+A+SRLC+EH+
Sbjct  686  LAEDGIFVIQFSSIPEERYDEYRRSSDFIKEYIFPGGCIPCLTRITSAMSAASRLCIEHV  745

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + +IL LGFD++F RTWEYYF Y AAGF + TLG YQIV
Sbjct  746  ENIGHHYYPTLVRWRDNFMANKDKILALGFDERFTRTWEYYFMYSAAGFKSRTLGVYQIV  805

Query  328  FSRPGNVTAFGDPYK  284
            FSRPGN    G  +K
Sbjct  806  FSRPGNAK-LGSGFK  819



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+
Sbjct  720  LKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHV  779

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+ YY TLR WR  FLE  S++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+V
Sbjct  780  ENIGMSYYHTLRWWRKLFLENTSKVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVV  839

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN    GDPYKG  SAY
Sbjct  840  FSRAGNFGTLGDPYKGFPSAY  860



>gb|KJB12595.1| hypothetical protein B456_002G026100 [Gossypium raimondii]
Length=865

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+
Sbjct  720  LKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHV  779

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+ YY TLR WR  FLE  S++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+V
Sbjct  780  ENIGMSYYHTLRWWRKLFLENTSKVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVV  839

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN    GDPYKG  SAY
Sbjct  840  FSRAGNFGTLGDPYKGFPSAY  860



>ref|XP_011091266.1| PREDICTED: uncharacterized protein LOC105171752 isoform X2 [Sesamum 
indicum]
Length=813

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +L ENGI VLQFI+I DE+YDE+  S+ FIKEYIFPG  L SLSR+TSAMAA+SRL V H
Sbjct  671  ALTENGILVLQFIAIADEKYDEFTHSAGFIKEYIFPGSWLASLSRLTSAMAAASRLSVVH  730

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+ G+HY+QTL CWR N L  QS+IL+LGFD+KF+RTW YYFDYCAAG     +G YQ+
Sbjct  731  LEERGLHYFQTLECWRENLLRNQSKILELGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQV  790

Query  331  VFSRPGNVTAFGD-PYK  284
            VF+RPG++ AFG+ PY 
Sbjct  791  VFTRPGDIAAFGNKPYN  807



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +L ENGI VLQFI+I DE+YDE+  S+ FIKEYIFPG  L SLSR+TSAMAA+SRL V H
Sbjct  725  ALTENGILVLQFIAIADEKYDEFTHSAGFIKEYIFPGSWLASLSRLTSAMAAASRLSVVH  784

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            LE+ G+HY+QTL CWR N L  QS+IL+LGFD+KF+RTW YYFDYCAAG     +G YQ+
Sbjct  785  LEERGLHYFQTLECWRENLLRNQSKILELGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQV  844

Query  331  VFSRPGNVTAFGD-PYK  284
            VF+RPG++ AFG+ PY 
Sbjct  845  VFTRPGDIAAFGNKPYN  861



>ref|XP_010670965.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=436

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            SL  NG+ VLQF ++ DE Y+++R+   FI EYIFPGG L SLSRVTSAM  +S+L VEH
Sbjct  295  SLTTNGLLVLQFTAVRDEGYEKFRKCPGFIPEYIFPGGHLFSLSRVTSAMGTASKLSVEH  354

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
            +E+IG HYYQTLRCWR NFLE QS+IL LGF++KFI+TWEYYFDYCAAGF    L +YQI
Sbjct  355  VENIGEHYYQTLRCWRKNFLENQSKILSLGFNEKFIQTWEYYFDYCAAGFKMRFLKNYQI  414

Query  331  VFSRPGNVTAFGDPYKGLASAY  266
            VFSR G  TAF DP   + SA+
Sbjct  415  VFSRRG--TAFNDPSATIPSAH  434



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R  VEH+
Sbjct  728  LKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFSVEHV  787

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG+ YY TLR WR  FL+  S++L LGFD+KF+RTWEYYFDYCAAGF T TL DYQ+V
Sbjct  788  ENIGMSYYHTLRWWRKLFLKNTSKVLALGFDEKFMRTWEYYFDYCAAGFKTGTLIDYQVV  847

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR GN    GDPYKG  SAY
Sbjct  848  FSRAGNFGTLGDPYKGFPSAY  868



>ref|XP_007035240.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06166.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=461

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ VLQF S+ +  Y EY +S  F KEYIFPG CL SL+R+ SAMA +SRL VEH+
Sbjct  319  LAKDGLFVLQFTSVTEGLYHEYLRSPGFAKEYIFPGACLLSLTRILSAMATASRLSVEHV  378

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +Y QTL+ WR NFL+ +S+IL LGFD+KF RTWEY+FDY AAGF + TL  YQ+V
Sbjct  379  ENIGSNYVQTLKGWRKNFLKNKSKILALGFDEKFTRTWEYFFDYAAAGFKSRTLETYQVV  438

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSRPGN  A GDPY+G  SAY
Sbjct  439  FSRPGNFAALGDPYQGFPSAY  459



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L E+G+ V+QF ++PD R++  R++S FI EYIF G C+PSLS VTSAM A+SR  VEHL
Sbjct  717  LVEDGLLVVQFTTVPDSRFENNRRTSGFISEYIFQGSCIPSLSYVTSAMGAASRFWVEHL  776

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            EDIG+HYY  LRCWR NFL  ++QI  LGFD KF+R +EYYFDYCA+ F TC +G+YQ+V
Sbjct  777  EDIGVHYYPALRCWRDNFLRNRNQIEALGFDDKFVRMFEYYFDYCASAFKTCAIGNYQLV  836

Query  328  FSRPGNVTAFGDPY  287
             SRPGNV  FGDPY
Sbjct  837  LSRPGNVAIFGDPY  850



>gb|EMS56688.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=624

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI VLQFIS PDERY++YR+ +DFIKEYIFPGGCLPSL RV SAM  SSR C+EH+
Sbjct  493  LAEDGILVLQFISAPDERYEQYRRRTDFIKEYIFPGGCLPSLGRVVSAMTTSSRFCIEHV  552

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + Q+L LGFD+KF+R WE+Y  Y AAGF +  +GDYQ+V
Sbjct  553  ENIGPHYYTTLMHWRDNFMTNKDQVLALGFDEKFMRIWEFYLIYSAAGFKSRAVGDYQVV  612

Query  328  FSRPGN  311
            FSRPGN
Sbjct  613  FSRPGN  618



>gb|EYU18296.1| hypothetical protein MIMGU_mgv1a024671mg [Erythranthe guttata]
Length=809

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 106/136 (78%), Gaps = 4/136 (3%)
 Frame = -2

Query  694  ISLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVE  515
            I + E G   LQ  SI D++YDE+R S  FIKEYIFPGG LPSLSR+TS MA++SRLCV 
Sbjct  673  IKVKEAG---LQTSSIVDQKYDEFRLSHGFIKEYIFPGGFLPSLSRITSTMASASRLCVV  729

Query  514  HLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  335
            H EDIG HYYQTLRCWR NFL  Q +I+ LGFD+KFIRTWEYYF Y AAGF    +G+YQ
Sbjct  730  HAEDIGSHYYQTLRCWRENFLRNQRKIMALGFDEKFIRTWEYYFSYTAAGFKMSIMGNYQ  789

Query  334  IVFSRPGNVTAFG-DP  290
            IVF+RPG+V AFG DP
Sbjct  790  IVFTRPGDVAAFGNDP  805



>dbj|BAJ86532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI VLQFIS P+ERY++YR+ +DFIKEYIFPGGCLPSL+RV SAM  SSR  +EH+
Sbjct  128  LAEDGILVLQFISAPEERYEQYRRRTDFIKEYIFPGGCLPSLARVMSAMTTSSRFSIEHV  187

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + +IL LGFD KF+R WEYY  + A+ F + TLGDYQ+V
Sbjct  188  ENIGPHYYTTLMRWRDNFMINKDEILALGFDDKFMRIWEYYLIFSASCFKSRTLGDYQVV  247

Query  328  FSRPGN  311
            FSRPGN
Sbjct  248  FSRPGN  253



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA++G+ V+Q ISIP+ERYD YRQSSDFIKEYIFPGGCLPS + +T+AM++ S  CVEH+
Sbjct  725  LAKDGLVVVQVISIPEERYDGYRQSSDFIKEYIFPGGCLPSFAALTTAMSSGSSFCVEHM  784

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IGIHY +TL  W+  F   +++I+ LGF +KFIRTW+YYF YCAAGF +CTLG  QIV
Sbjct  785  ENIGIHYCETLLRWQEQFTRNRNKIMKLGFGEKFIRTWDYYFFYCAAGFKSCTLGVLQIV  844

Query  328  FSRPGNVTAFGDPYKGLASA  269
            FSRPGN    G PY    +A
Sbjct  845  FSRPGNEAFLGCPYVSFPTA  864



>gb|KJB70811.1| hypothetical protein B456_011G092100 [Gossypium raimondii]
Length=865

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            L ++G+ VLQFI++P+E   E +Q++ FIKEYIFPGG L S +   SAMAA+S  CVEH+
Sbjct  720  LKKDGLFVLQFITLPEELSKEVQQTAGFIKEYIFPGGMLLSFNTHLSAMAAASGFCVEHV  779

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG  YY TLR WR NFLE  S++L LGFD KF+RTWEYYFDYCAAGF T TL DYQ+V
Sbjct  780  ENIGSSYYHTLRWWRKNFLENTSKVLALGFDDKFMRTWEYYFDYCAAGFKTGTLLDYQVV  839

Query  328  FSRPGNVTAFGDPYKGLASAY  266
            FSR  N    GDPYKG  SAY
Sbjct  840  FSRADNFATLGDPYKGFPSAY  860



>gb|EMT01203.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=198

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI  LQFIS P+ERY++YR+  DF+ EYIFPGGCLPSL+RV SAM+ SSR C+EH+
Sbjct  63   LAEDGIMALQFISAPEERYEQYRKRPDFLTEYIFPGGCLPSLARVVSAMSTSSRFCIEHV  122

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +YY TL CW  NF   + ++L LGFD+KFIR WEYY  + AA   + TLG YQ+V
Sbjct  123  ENIGPNYYPTLMCWMDNFTANKDKMLALGFDEKFIRIWEYYLIFSAACMKSRTLGVYQVV  182

Query  328  FSRPGN  311
            FSRPGN
Sbjct  183  FSRPGN  188



>gb|EMS47377.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=640

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI  LQFIS+PDERY++YR+  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH 
Sbjct  505  LAEDGIMALQFISVPDERYEQYRRKPDFIKEYIFPGGCLPSLSRVMSAMTTSSRFSIEHA  564

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL CW  N++  + +IL LGFD+KFIR WEYY  + AA      LGDYQ+V
Sbjct  565  ENIGPHYYTTLMCWMDNYIANRDKILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVV  624

Query  328  FSRPGN  311
            FSRPGN
Sbjct  625  FSRPGN  630



>ref|XP_006406023.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
 gb|ESQ47476.1| hypothetical protein EUTSA_v10022172mg, partial [Eutrema salsugineum]
Length=394

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LA  GI V+QF ++PDERYDE R SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLCVE +
Sbjct  279  LAPYGIFVMQFTALPDERYDECRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCVEDV  338

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  341
            E+IGIHYY TL+ WR +FLERQ +I++LGFD KFIRTW YYF+Y AAGF   +L +
Sbjct  339  ENIGIHYYLTLKFWRKSFLERQKEIMNLGFDDKFIRTWVYYFNYYAAGFKAHSLKN  394



>dbj|BAK05129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI  LQFIS+PDERY++YR+  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+
Sbjct  737  LAEDGIMALQFISVPDERYEQYRRKPDFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHV  796

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL CW  N+   + +IL LGFD+KFIR WEYY  + AA      LGDYQ+V
Sbjct  797  ENIGPHYYTTLMCWMDNYTANRDKILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVV  856

Query  328  FSRPGN  311
            FSRPGN
Sbjct  857  FSRPGN  862



>dbj|BAK05892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI  LQFIS+PDERY++YR+  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+
Sbjct  737  LAEDGIMALQFISVPDERYEQYRRKPDFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHV  796

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL CW  N+   + +IL LGFD+KFIR WEYY  + AA      LGDYQ+V
Sbjct  797  ENIGPHYYTTLMCWMDNYTANRDKILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVV  856

Query  328  FSRPGN  311
            FSRPGN
Sbjct  857  FSRPGN  862



>gb|EMS47376.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=676

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+GI VLQFISI +ERY++YR+   F+KEYIFPGGC+PSL+RV SAM  SSR  +EH+
Sbjct  545  LAEDGILVLQFISIAEERYEQYRRRPHFVKEYIFPGGCIPSLARVMSAMTTSSRFSIEHV  604

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG +YY TL  WR NF+  + Q+L+LGFD+KFI  WE+Y  Y AAGF +  +GDYQ+V
Sbjct  605  ENIGPNYYTTLMHWRDNFMANKDQVLELGFDEKFILIWEFYLIYSAAGFKSRAVGDYQVV  664

Query  328  FSRPGN  311
            FSRPGN
Sbjct  665  FSRPGN  670



>ref|XP_002451281.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
 gb|EES10269.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
Length=872

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQ I+ P+E YD+ R   +F+KEYIFPGGCLPSL+R+TSAM+ +SRLCV H+
Sbjct  737  LAEHGLLVLQSIACPEELYDKMRTRPEFLKEYIFPGGCLPSLARITSAMSNASRLCVHHV  796

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + ++L LGFD+KFIRTWEYY +YCAA F +    DYQIV
Sbjct  797  ENIGYHYYPTLIHWRDNFVANREKVLALGFDEKFIRTWEYYLNYCAAMFKSHMGLDYQIV  856

Query  328  FSRPGN  311
            F+RPG+
Sbjct  857  FARPGD  862



>ref|XP_004956057.1| PREDICTED: uncharacterized protein LOC101762231 isoform X2 [Setaria 
italica]
Length=872

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+
Sbjct  737  LAEHGLFVLQFIAIPEELYDKLRTRPEFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHV  796

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + ++  LGFD+KF+ TW+YY  YCAA F + TL DYQIV
Sbjct  797  ENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIV  856

Query  328  FSRPGNV  308
            FSR G+ 
Sbjct  857  FSRSGDA  863



>ref|XP_004972625.1| PREDICTED: uncharacterized protein LOC101764920 [Setaria italica]
Length=871

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+
Sbjct  736  LAEHGLFVLQFIAIPEELYDKMRTRPEFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHV  795

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + ++  LGFD+KF+ TW+YY  YCAA F + TL DYQIV
Sbjct  796  ENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIV  855

Query  328  FSRPGNV  308
            FSR G+ 
Sbjct  856  FSRSGDA  862



>ref|XP_004956056.1| PREDICTED: uncharacterized protein LOC101762231 isoform X1 [Setaria 
italica]
Length=912

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -2

Query  688  LAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  509
            LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+
Sbjct  777  LAEHGLFVLQFIAIPEELYDKLRTRPEFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHV  836

Query  508  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  329
            E+IG HYY TL  WR NF+  + ++  LGFD+KF+ TW+YY  YCAA F + TL DYQIV
Sbjct  837  ENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIV  896

Query  328  FSRPGNV  308
            FSR G+ 
Sbjct  897  FSRSGDA  903



>ref|XP_002862681.1| hypothetical protein ARALYDRAFT_359447 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38939.1| hypothetical protein ARALYDRAFT_359447 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 91/133 (68%), Gaps = 34/133 (26%)
 Frame = -2

Query  691  SLAENGIXVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  512
            +LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RVTSA+          
Sbjct  100  ALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVTSAI----------  149

Query  511  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  332
                                    QI+DLGFD KFIR WEYYFDYCAAGF T TLGDYQI
Sbjct  150  ------------------------QIIDLGFDDKFIRIWEYYFDYCAAGFKTLTLGDYQI  185

Query  331  VFSRPGNVTAFGD  293
             FSRPGNV AFGD
Sbjct  186  FFSRPGNVVAFGD  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160