BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF029A06

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG25437.1|  hypothetical protein F383_06753                         222   6e-109   Gossypium arboreum [tree cotton]
gb|KJB36871.1|  hypothetical protein B456_006G180000                    222   7e-109   Gossypium raimondii
gb|ADI87417.1|  fructokinase-like protein 1                             222   7e-109   Gossypium hirsutum [American cotton]
ref|XP_011077603.1|  PREDICTED: fructokinase-like 1, chloroplastic      223   8e-107   Sesamum indicum [beniseed]
ref|XP_007026821.1|  Fructokinase-like 1                                221   4e-106   
ref|XP_009772599.1|  PREDICTED: probable fructokinase-4                 219   5e-106   Nicotiana sylvestris
gb|ADI87421.1|  fructokinase-like protein 1                             219   6e-106   Nicotiana tabacum [American tobacco]
ref|XP_010256724.1|  PREDICTED: fructokinase-like 1, chloroplastic      218   8e-106   Nelumbo nucifera [Indian lotus]
ref|XP_009629251.1|  PREDICTED: fructokinase-1                          217   9e-106   Nicotiana tomentosiformis
gb|KHN26222.1|  Fructokinase-2                                          219   1e-105   Glycine soja [wild soybean]
ref|NP_001275447.1|  fructokinase-like protein 1                        219   2e-105   Solanum tuberosum [potatoes]
ref|XP_004246362.1|  PREDICTED: fructokinase-like 1, chloroplastic      219   2e-105   Solanum lycopersicum
gb|EYU26634.1|  hypothetical protein MIMGU_mgv1a005440mg                221   3e-105   Erythranthe guttata [common monkey flower]
ref|XP_004506641.1|  PREDICTED: fructokinase-2-like                     217   3e-105   Cicer arietinum [garbanzo]
emb|CDP06530.1|  unnamed protein product                                217   3e-105   Coffea canephora [robusta coffee]
ref|XP_010515923.1|  PREDICTED: fructokinase-like 1, chloroplastic      212   4e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010686350.1|  PREDICTED: fructokinase-like 1, chloroplastic      221   4e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003516930.1|  PREDICTED: fructokinase-2-like                     218   5e-105   Glycine max [soybeans]
gb|KHM98942.1|  Fructokinase-2                                          219   7e-105   Glycine soja [wild soybean]
ref|XP_010504200.1|  PREDICTED: fructokinase-like 1, chloroplastic      212   1e-104   Camelina sativa [gold-of-pleasure]
gb|ADI87414.1|  fructokinase-like protein 1                             222   1e-104   Nicotiana benthamiana
gb|ADI87420.1|  fructokinase-like protein 1                             216   1e-104   Vigna unguiculata
ref|XP_009116097.1|  PREDICTED: fructokinase-2                          214   2e-104   Brassica rapa
ref|XP_010528657.1|  PREDICTED: fructokinase-like 1, chloroplastic      213   2e-104   
ref|XP_006291033.1|  hypothetical protein CARUB_v10017145mg             212   2e-104   Capsella rubella
emb|CDX73510.1|  BnaC08g24930D                                          214   2e-104   
ref|XP_010427076.1|  PREDICTED: fructokinase-like 1, chloroplastic      210   4e-104   Camelina sativa [gold-of-pleasure]
emb|CDX78206.1|  BnaA09g34010D                                          213   4e-104   
gb|KDP24506.1|  hypothetical protein JCGZ_25070                         217   4e-104   Jatropha curcas
ref|XP_007133958.1|  hypothetical protein PHAVU_010G006700g             216   4e-104   Phaseolus vulgaris [French bean]
ref|XP_006429264.1|  hypothetical protein CICLE_v10011551mg             217   8e-104   Citrus clementina [clementine]
ref|XP_010039172.1|  PREDICTED: fructokinase-1                          213   8e-104   Eucalyptus grandis [rose gum]
ref|XP_002876240.1|  pfkB-type carbohydrate kinase family protein       212   9e-104   
ref|XP_006403618.1|  hypothetical protein EUTSA_v10010328mg             213   1e-103   Eutrema salsugineum [saltwater cress]
ref|XP_008388106.1|  PREDICTED: probable fructokinase-4                 216   1e-103   
ref|NP_190977.1|  fructokinase-like 1                                   210   4e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480938.1|  PREDICTED: probable fructokinase-4-like            217   7e-103   
gb|KEH28950.1|  pfkB family carbohydrate kinase                         210   1e-102   Medicago truncatula
ref|XP_002527877.1|  fructokinase, putative                             209   3e-102   Ricinus communis
gb|ADI87415.1|  fructokinase-like protein 1                             217   3e-102   Citrus clementina [clementine]
ref|XP_007205056.1|  hypothetical protein PRUPE_ppa004431mg             216   6e-102   Prunus persica
ref|XP_009358825.1|  PREDICTED: uncharacterized protein LOC103949435    214   9e-102   
ref|XP_002273576.2|  PREDICTED: fructokinase-like 1, chloroplastic      214   2e-101   Vitis vinifera
ref|XP_004302649.2|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    219   2e-101   Fragaria vesca subsp. vesca
gb|KFK34655.1|  hypothetical protein AALP_AA5G174200                    209   1e-100   Arabis alpina [alpine rockcress]
ref|XP_008239829.1|  PREDICTED: uncharacterized protein LOC103338406    207   2e-100   
ref|XP_004137741.1|  PREDICTED: fructokinase-2-like                     217   5e-100   
ref|XP_008442480.1|  PREDICTED: uncharacterized protein LOC103486334    217   5e-100   
ref|XP_010101836.1|  hypothetical protein L484_023626                   212   8e-100   Morus notabilis
ref|XP_004156589.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    217   2e-99    
gb|ADI87419.1|  fructokinase-like protein 1                             197   5e-98    Euphorbia esula [wolf's milk]
gb|ADI87418.1|  fructokinase-like protein 1                             211   1e-96    Lactuca sativa [cultivated lettuce]
ref|XP_010928949.1|  PREDICTED: fructokinase-like 1, chloroplastic      208   4e-95    Elaeis guineensis
ref|XP_011009152.1|  PREDICTED: fructokinase-like 1, chloroplastic      209   1e-94    Populus euphratica
ref|XP_008798949.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    204   1e-94    
gb|EPS61748.1|  fructokinase-like protein 1                             204   6e-94    Genlisea aurea
ref|XP_002322950.1|  hypothetical protein POPTR_0016s11690g             208   8e-94    Populus trichocarpa [western balsam poplar]
ref|XP_009421323.1|  PREDICTED: fructokinase-1-like                     211   2e-93    
ref|XP_006848050.1|  hypothetical protein AMTR_s00029p00193780          220   2e-92    
emb|CBI30446.3|  unnamed protein product                                214   4e-91    Vitis vinifera
ref|NP_001147575.1|  protein kinase                                     192   2e-87    
tpg|DAA56815.1|  TPA: protein kinase                                    192   2e-87    
ref|XP_002456644.1|  hypothetical protein SORBIDRAFT_03g040010          190   2e-87    Sorghum bicolor [broomcorn]
gb|EMS45106.1|  hypothetical protein TRIUR3_04898                       188   5e-86    Triticum urartu
ref|XP_004970597.1|  PREDICTED: fructokinase-2-like                     187   6e-86    
ref|NP_001044818.1|  Os01g0851000                                       186   7e-86    
emb|CBH32521.1|  protein kinase, putative, expressed                    187   1e-85    Triticum aestivum [Canadian hard winter wheat]
gb|EEE55679.1|  hypothetical protein OsJ_04093                          186   1e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EMT01230.1|  hypothetical protein F775_26429                         187   1e-84    
ref|XP_003564619.1|  PREDICTED: fructokinase-like 1, chloroplastic      184   1e-84    Brachypodium distachyon [annual false brome]
dbj|BAJ87729.1|  predicted protein                                      187   5e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002973268.1|  hypothetical protein SELMODRAFT_54157              175   7e-67    
ref|XP_002986741.1|  hypothetical protein SELMODRAFT_44136              175   3e-66    
ref|XP_010675364.1|  PREDICTED: cytochrome P450 81D1-like               215   4e-64    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001774794.1|  predicted protein                                  167   4e-64    
ref|XP_009358994.1|  PREDICTED: fructokinase-2-like                     186   3e-54    
gb|KHN44929.1|  Fructokinase-2                                          131   2e-51    Glycine soja [wild soybean]
ref|XP_006573158.1|  PREDICTED: putative fructokinase-5-like            131   3e-51    Glycine max [soybeans]
ref|XP_004490214.1|  PREDICTED: uncharacterized protein LOC101493906    135   1e-50    Cicer arietinum [garbanzo]
ref|XP_004982464.1|  PREDICTED: putative fructokinase-5-like            115   5e-50    Setaria italica
ref|XP_004160828.1|  PREDICTED: putative fructokinase-5-like            122   7e-50    
gb|KGN54881.1|  hypothetical protein Csa_4G571770                       122   8e-50    Cucumis sativus [cucumbers]
ref|XP_004144690.1|  PREDICTED: fructokinase-2-like                     122   9e-50    
ref|XP_002273674.2|  PREDICTED: fructokinase-like 2, chloroplasti...    124   9e-50    Vitis vinifera
ref|XP_008442238.1|  PREDICTED: uncharacterized protein LOC103486152    123   1e-49    Cucumis melo [Oriental melon]
ref|XP_010649953.1|  PREDICTED: fructokinase-like 2, chloroplasti...    124   2e-49    Vitis vinifera
ref|XP_010257983.1|  PREDICTED: fructokinase-like 2, chloroplastic      120   2e-49    Nelumbo nucifera [Indian lotus]
ref|XP_006856418.1|  hypothetical protein AMTR_s00047p00218860          119   3e-49    Amborella trichopoda
ref|XP_002512061.1|  fructokinase, putative                             133   3e-49    
ref|XP_003518781.1|  PREDICTED: probable fructokinase-2-like            124   4e-49    Glycine max [soybeans]
gb|KHN29971.1|  Fructokinase-2                                          124   4e-49    Glycine soja [wild soybean]
gb|AAT81682.1|  putative kinase                                         111   5e-49    Oryza sativa Japonica Group [Japonica rice]
gb|EEE59468.1|  hypothetical protein OsJ_11670                          111   5e-49    Oryza sativa Japonica Group [Japonica rice]
gb|ABF97502.1|  pfkB-type carbohydrate kinase family protein, put...    111   5e-49    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466840.1|  hypothetical protein SORBIDRAFT_01g015030          113   6e-49    Sorghum bicolor [broomcorn]
tpg|DAA50254.1|  TPA: hypothetical protein ZEAMMB73_178722              112   8e-49    
ref|XP_008665080.1|  PREDICTED: uncharacterized protein LOC103643674    112   1e-48    
gb|KDP41324.1|  hypothetical protein JCGZ_15731                         129   1e-48    Jatropha curcas
gb|KHG26530.1|  Fructokinase-2                                          124   1e-48    Gossypium arboreum [tree cotton]
emb|CDY40900.1|  BnaC06g30380D                                          124   2e-48    Brassica napus [oilseed rape]
gb|EEC75710.1|  hypothetical protein OsI_12536                          110   2e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_010551378.1|  PREDICTED: fructokinase-like 2, chloroplastic      128   2e-48    Tarenaya hassleriana [spider flower]
emb|CDY54150.1|  BnaCnng26300D                                          125   2e-48    Brassica napus [oilseed rape]
ref|XP_003562305.1|  PREDICTED: fructokinase-like 2, chloroplastic      111   3e-48    Brachypodium distachyon [annual false brome]
ref|XP_009105465.1|  PREDICTED: uncharacterized protein LOC103831320    124   3e-48    Brassica rapa
emb|CDX95956.1|  BnaA07g27750D                                          124   3e-48    
ref|XP_003614114.1|  Fructokinase-2                                     128   3e-48    Medicago truncatula
ref|XP_002312288.2|  hypothetical protein POPTR_0008s09690g             124   4e-48    Populus trichocarpa [western balsam poplar]
ref|XP_004297219.1|  PREDICTED: fructokinase-like 2, chloroplastic      125   4e-48    Fragaria vesca subsp. vesca
ref|XP_006650283.1|  PREDICTED: uncharacterized protein LOC102700038    111   5e-48    Oryza brachyantha
ref|XP_010044389.1|  PREDICTED: uncharacterized protein LOC104433370    123   7e-48    Eucalyptus grandis [rose gum]
ref|XP_010091598.1|  hypothetical protein L484_026446                   120   9e-48    Morus notabilis
ref|XP_006437893.1|  hypothetical protein CICLE_v10031077mg             120   4e-47    Citrus clementina [clementine]
gb|KDO70321.1|  hypothetical protein CISIN_1g0081612mg                  120   6e-47    Citrus sinensis [apfelsine]
ref|XP_006484232.1|  PREDICTED: uncharacterized protein LOC102617588    120   6e-47    Citrus sinensis [apfelsine]
gb|ADI87422.1|  fructokinase-like protein 2                             122   7e-47    Nicotiana benthamiana
ref|XP_007222920.1|  hypothetical protein PRUPE_ppa003690mg             124   8e-47    Prunus persica
ref|XP_008243824.1|  PREDICTED: uncharacterized protein LOC103342040    123   1e-46    Prunus mume [ume]
ref|XP_011018828.1|  PREDICTED: fructokinase-like 2, chloroplastic      119   1e-46    Populus euphratica
ref|XP_008389397.1|  PREDICTED: probable fructokinase-1 isoform X1      120   1e-46    
ref|XP_008389398.1|  PREDICTED: probable fructokinase-1 isoform X2      120   1e-46    
gb|KJB50552.1|  hypothetical protein B456_008G176200                    120   2e-46    Gossypium raimondii
ref|XP_009356434.1|  PREDICTED: probable fructokinase-4 isoform X2      120   2e-46    Pyrus x bretschneideri [bai li]
ref|XP_009356432.1|  PREDICTED: probable fructokinase-4 isoform X1      120   2e-46    Pyrus x bretschneideri [bai li]
ref|XP_009356435.1|  PREDICTED: probable fructokinase-4 isoform X3      120   2e-46    Pyrus x bretschneideri [bai li]
gb|AAF27059.1|AC008262_8  F4N2.16                                       124   2e-46    Arabidopsis thaliana [mouse-ear cress]
sp|F4I0K2.2|SCKL2_ARATH  RecName: Full=Fructokinase-like 2, chlor...    124   3e-46    Arabidopsis thaliana [mouse-ear cress]
ref|NP_177080.2|  fructokinase-like 2                                   124   3e-46    
emb|CDP00452.1|  unnamed protein product                                117   3e-46    Coffea canephora [robusta coffee]
ref|XP_009786224.1|  PREDICTED: uncharacterized protein LOC104234369    120   4e-46    Nicotiana sylvestris
ref|XP_008777340.1|  PREDICTED: putative fructokinase-5                 109   5e-46    Phoenix dactylifera
ref|XP_011075683.1|  PREDICTED: fructokinase-like 2, chloroplastic      120   1e-45    Sesamum indicum [beniseed]
gb|EMS49265.1|  hypothetical protein TRIUR3_05313                       110   1e-45    Triticum urartu
ref|XP_002887225.1|  pfkB-type carbohydrate kinase family protein       119   1e-45    
ref|XP_010511945.1|  PREDICTED: fructokinase-like 2, chloroplastic      119   2e-45    
ref|XP_009628355.1|  PREDICTED: uncharacterized protein LOC104118730    118   2e-45    Nicotiana tomentosiformis
ref|XP_010415548.1|  PREDICTED: fructokinase-like 2, chloroplasti...    119   2e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010415552.1|  PREDICTED: fructokinase-like 2, chloroplasti...    118   2e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010470895.1|  PREDICTED: fructokinase-like 2, chloroplasti...    118   2e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010470894.1|  PREDICTED: fructokinase-like 2, chloroplasti...    118   2e-45    Camelina sativa [gold-of-pleasure]
ref|XP_006348670.1|  PREDICTED: uncharacterized protein LOC102589995    119   3e-45    Solanum tuberosum [potatoes]
gb|EMT14724.1|  hypothetical protein F775_09742                         110   3e-45    
gb|EMS47290.1|  hypothetical protein TRIUR3_20910                       107   4e-45    Triticum urartu
ref|XP_004239035.1|  PREDICTED: fructokinase-like 2, chloroplastic      118   5e-45    Solanum lycopersicum
ref|XP_010680662.1|  PREDICTED: fructokinase-like 2, chloroplastic      120   6e-45    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006301975.1|  hypothetical protein CARUB_v10022455mg             116   7e-45    
gb|KFK41343.1|  hypothetical protein AALP_AA2G117900                    119   2e-44    Arabis alpina [alpine rockcress]
ref|XP_010937787.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    104   6e-44    Elaeis guineensis
gb|KDO58032.1|  hypothetical protein CISIN_1g040065mg                   142   1e-39    Citrus sinensis [apfelsine]
ref|NP_001050625.2|  Os03g0602600                                       101   6e-36    
gb|KDO70322.1|  hypothetical protein CISIN_1g0081612mg                95.5    4e-35    Citrus sinensis [apfelsine]
ref|XP_007222921.1|  hypothetical protein PRUPE_ppa003690mg           91.3    1e-33    
gb|EPS69174.1|  hypothetical protein M569_05592                       92.0    2e-33    Genlisea aurea
ref|XP_006391043.1|  hypothetical protein EUTSA_v100183771mg            121   8e-30    
ref|XP_007153496.1|  hypothetical protein PHAVU_003G040700g             121   6e-28    Phaseolus vulgaris [French bean]
ref|XP_007045823.1|  Fructokinase-like 2 isoform 3                      121   7e-28    
ref|XP_007045821.1|  Fructokinase-like 2 isoform 1                      120   7e-28    
ref|XP_007045822.1|  Fructokinase-like 2 isoform 2                      120   1e-27    
ref|XP_008786156.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase-2   82.0    2e-27    
gb|EEC71816.1|  hypothetical protein OsI_04455                          114   3e-26    Oryza sativa Indica Group [Indian rice]
ref|XP_010313061.1|  PREDICTED: probable fructokinase-5               82.0    3e-26    Solanum lycopersicum
ref|XP_006362721.1|  PREDICTED: putative fructokinase-5-like          82.4    3e-26    Solanum tuberosum [potatoes]
ref|XP_009602080.1|  PREDICTED: putative fructokinase-5               87.4    1e-25    Nicotiana tomentosiformis
gb|EYU28879.1|  hypothetical protein MIMGU_mgv1a003579mg                114   1e-25    Erythranthe guttata [common monkey flower]
gb|AEK21796.1|  fructokinase                                          74.7    2e-25    Dimocarpus longan [longan]
ref|XP_009783705.1|  PREDICTED: putative fructokinase-5               85.5    5e-25    Nicotiana sylvestris
ref|XP_008790605.1|  PREDICTED: fructokinase-1-like                   75.5    8e-25    Phoenix dactylifera
ref|XP_009787481.1|  PREDICTED: fructokinase-2 isoform X2             71.6    2e-24    Nicotiana sylvestris
ref|XP_009787480.1|  PREDICTED: fructokinase-2 isoform X1             71.2    3e-24    Nicotiana sylvestris
ref|XP_009605011.1|  PREDICTED: fructokinase-2                        71.2    3e-24    Nicotiana tomentosiformis
ref|XP_011074982.1|  PREDICTED: probable fructokinase-5               74.7    5e-24    
gb|AIE16180.1|  fructokinase                                          71.6    5e-24    Nicotiana tabacum [American tobacco]
ref|XP_010999528.1|  PREDICTED: probable fructokinase-5               72.4    6e-24    Populus euphratica
gb|AIE16179.1|  fructokinase                                          70.9    7e-24    Nicotiana tabacum [American tobacco]
gb|AIL30508.1|  fructokinase                                          70.5    8e-24    Nicotiana tabacum [American tobacco]
gb|AAQ09999.1|  putative fructokinase 2                               72.8    9e-24    Petunia integrifolia subsp. inflata
gb|AAQ10000.1|  putative fructokinase 2                               72.8    1e-23    Petunia integrifolia subsp. inflata
ref|XP_008460045.1|  PREDICTED: probable fructokinase-4               70.5    1e-23    Cucumis melo [Oriental melon]
ref|XP_010526109.1|  PREDICTED: probable fructokinase-4               72.4    2e-23    Tarenaya hassleriana [spider flower]
gb|AIL30505.1|  fructokinase-2                                        68.2    2e-23    Nicotiana tabacum [American tobacco]
ref|XP_002321869.1|  pfkB-type carbohydrate kinase family protein     68.6    3e-23    
ref|XP_011041646.1|  PREDICTED: probable fructokinase-7 isoform X1    68.6    3e-23    Populus euphratica
ref|XP_011041647.1|  PREDICTED: probable fructokinase-7 isoform X2    68.6    4e-23    Populus euphratica
ref|XP_002318851.2|  pfkB-type carbohydrate kinase family protein     68.2    4e-23    Populus trichocarpa [western balsam poplar]
ref|XP_009618746.1|  PREDICTED: fructokinase-1-like                   69.7    6e-23    Nicotiana tomentosiformis
ref|XP_002521094.1|  fructokinase, putative                           76.6    7e-23    Ricinus communis
ref|XP_006443006.1|  hypothetical protein CICLE_v10021105mg           69.3    7e-23    Citrus clementina [clementine]
emb|CDY06000.1|  BnaA09g37800D                                        69.3    7e-23    
ref|XP_010930218.1|  PREDICTED: fructokinase-1-like                   69.3    7e-23    Elaeis guineensis
gb|ACN40355.1|  unknown                                               72.4    8e-23    Picea sitchensis
ref|XP_009782121.1|  PREDICTED: fructokinase-1-like                   70.5    8e-23    Nicotiana sylvestris
ref|XP_011030018.1|  PREDICTED: probable fructokinase-7 isoform X1    67.4    8e-23    Populus euphratica
ref|XP_007201273.1|  hypothetical protein PRUPE_ppa008482mg           71.6    8e-23    Prunus persica
ref|XP_011016155.1|  PREDICTED: probable fructokinase-7 isoform X1    67.4    9e-23    Populus euphratica
ref|XP_011030019.1|  PREDICTED: probable fructokinase-7 isoform X2    67.4    9e-23    Populus euphratica
ref|XP_011016156.1|  PREDICTED: probable fructokinase-7 isoform X2    67.4    1e-22    Populus euphratica
gb|AAM64445.1|  fructokinase-like protein                             68.2    1e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116612.1|  PREDICTED: probable fructokinase-4               69.7    1e-22    Brassica rapa
ref|XP_003597523.1|  Fructokinase                                     70.1    1e-22    Medicago truncatula
emb|CDX98377.1|  BnaC06g17380D                                        68.2    1e-22    
ref|XP_010252312.1|  PREDICTED: probable fructokinase-5 isoform X1    67.0    1e-22    Nelumbo nucifera [Indian lotus]
ref|XP_004306875.1|  PREDICTED: probable fructokinase-7               74.3    1e-22    Fragaria vesca subsp. vesca
ref|XP_002511766.1|  fructokinase, putative                           68.2    2e-22    
gb|KDP41134.1|  hypothetical protein JCGZ_03625                       74.3    2e-22    Jatropha curcas
ref|XP_008800140.1|  PREDICTED: fructokinase-1-like                   67.4    2e-22    Phoenix dactylifera
emb|CDP08915.1|  unnamed protein product                              71.2    2e-22    Coffea canephora [robusta coffee]
emb|CDX71907.1|  BnaC08g29670D                                        67.4    2e-22    
ref|XP_010252313.1|  PREDICTED: fructokinase-2 isoform X2             67.0    2e-22    Nelumbo nucifera [Indian lotus]
ref|XP_010469311.1|  PREDICTED: probable fructokinase-4               68.6    2e-22    Camelina sativa [gold-of-pleasure]
ref|XP_006341727.1|  PREDICTED: putative fructokinase-5-like          67.0    2e-22    Solanum tuberosum [potatoes]
ref|XP_010907694.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...  69.7    2e-22    Elaeis guineensis
ref|XP_009396809.1|  PREDICTED: fructokinase-1-like                   68.6    3e-22    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004145029.1|  PREDICTED: probable fructokinase-4-like          68.6    3e-22    Cucumis sativus [cucumbers]
ref|XP_010696263.1|  PREDICTED: probable fructokinase-5               66.6    3e-22    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008234319.1|  PREDICTED: fructokinase-1                        67.0    3e-22    Prunus mume [ume]
ref|XP_007033923.1|  PfkB-like carbohydrate kinase family protein     68.6    3e-22    
ref|XP_009370536.1|  PREDICTED: putative fructokinase-5               71.6    3e-22    Pyrus x bretschneideri [bai li]
gb|AFO84081.1|  fructokinase                                          68.2    3e-22    Actinidia chinensis
emb|CDX67798.1|  BnaA07g18380D                                        67.4    3e-22    
gb|AJK93569.1|  fructokinase                                          66.6    4e-22    Manihot esculenta [manioc]
ref|XP_009104208.1|  PREDICTED: probable fructokinase-4               66.6    4e-22    Brassica rapa
ref|XP_007218097.1|  hypothetical protein PRUPE_ppa006628mg           66.6    4e-22    
ref|NP_191507.1|  probable fructokinase-4                             66.2    4e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001762258.1|  predicted protein                                68.2    4e-22    
ref|XP_002876506.1|  pfkB-type carbohydrate kinase family protein     67.4    5e-22    Arabidopsis lyrata subsp. lyrata
ref|XP_007143920.1|  hypothetical protein PHAVU_007G113500g           69.7    5e-22    Phaseolus vulgaris [French bean]
ref|XP_008777085.1|  PREDICTED: fructokinase-2-like                   70.1    5e-22    Phoenix dactylifera
gb|AHE93349.1|  fructokinase                                          66.2    5e-22    Camellia sinensis [black tea]
ref|XP_008376501.1|  PREDICTED: fructokinase-1-like                   68.9    5e-22    Malus domestica [apple tree]
ref|XP_006589570.1|  PREDICTED: putative fructokinase-5-like          72.0    5e-22    Glycine max [soybeans]
ref|XP_009393498.1|  PREDICTED: fructokinase-2                        70.1    5e-22    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073890.1|  PREDICTED: fructokinase-2-like                   70.5    5e-22    
ref|XP_010111956.1|  Putative fructokinase-5                          67.4    5e-22    Morus notabilis
emb|CDP17143.1|  unnamed protein product                              67.0    6e-22    Coffea canephora [robusta coffee]
ref|XP_011091648.1|  PREDICTED: fructokinase-2                        66.2    6e-22    Sesamum indicum [beniseed]
gb|KHN02781.1|  Putative fructokinase-5                               71.6    6e-22    Glycine soja [wild soybean]
ref|XP_009379916.1|  PREDICTED: probable fructokinase-1               71.2    7e-22    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001233888.1|  fructokinase-2                                   66.2    7e-22    Solanum lycopersicum
gb|EMT27421.1|  hypothetical protein F775_08291                       65.9    8e-22    
gb|EYU36729.1|  hypothetical protein MIMGU_mgv1a009780mg              66.2    8e-22    Erythranthe guttata [common monkey flower]
ref|XP_002533363.1|  fructokinase, putative                           68.6    8e-22    Ricinus communis
ref|XP_007038535.1|  PfkB-like carbohydrate kinase family protein...  67.0    8e-22    
gb|KHN30534.1|  Putative fructokinase-5                               69.7    8e-22    Glycine soja [wild soybean]
ref|XP_003555364.2|  PREDICTED: putative fructokinase-5-like          71.2    8e-22    Glycine max [soybeans]
ref|XP_003543564.1|  PREDICTED: fructokinase-2-like                   68.2    8e-22    Glycine max [soybeans]
ref|XP_003535409.1|  PREDICTED: putative fructokinase-5-like          69.7    9e-22    Glycine max [soybeans]
ref|XP_003622348.1|  Fructokinase-2                                   68.2    9e-22    
gb|KJB10970.1|  hypothetical protein B456_001G234200                  71.6    1e-21    Gossypium raimondii
ref|XP_008237799.1|  PREDICTED: putative fructokinase-5               69.3    1e-21    Prunus mume [ume]
ref|XP_003548230.1|  PREDICTED: putative fructokinase-5-like isof...  65.5    1e-21    Glycine max [soybeans]
ref|XP_009371257.1|  PREDICTED: fructokinase-1                        68.6    1e-21    Pyrus x bretschneideri [bai li]
ref|XP_006397085.1|  hypothetical protein EUTSA_v10029371mg           66.6    1e-21    
ref|XP_010512210.1|  PREDICTED: probable fructokinase-4               66.2    1e-21    Camelina sativa [gold-of-pleasure]
ref|XP_004290279.1|  PREDICTED: probable fructokinase-5               70.1    1e-21    Fragaria vesca subsp. vesca
gb|KHN15693.1|  Putative fructokinase-5                               71.2    1e-21    Glycine soja [wild soybean]
ref|XP_003537935.1|  PREDICTED: fructokinase-2-like                   66.2    1e-21    Glycine max [soybeans]
ref|XP_010268185.1|  PREDICTED: probable fructokinase-1               68.6    1e-21    Nelumbo nucifera [Indian lotus]
ref|XP_006371336.1|  pfkB-type carbohydrate kinase family protein     65.5    1e-21    
ref|XP_010456837.1|  PREDICTED: probable fructokinase-5               67.0    1e-21    Camelina sativa [gold-of-pleasure]
gb|KHN31553.1|  Putative fructokinase-5                               65.5    1e-21    Glycine soja [wild soybean]
ref|XP_001770633.1|  predicted protein                                70.9    1e-21    
ref|XP_007131942.1|  hypothetical protein PHAVU_011G053800g           66.6    1e-21    Phaseolus vulgaris [French bean]
ref|XP_006599638.1|  PREDICTED: putative fructokinase-5-like isof...  65.5    1e-21    Glycine max [soybeans]
ref|XP_006402684.1|  hypothetical protein EUTSA_v10006096mg           66.2    2e-21    Eutrema salsugineum [saltwater cress]
ref|XP_007131943.1|  hypothetical protein PHAVU_011G053800g           66.6    2e-21    Phaseolus vulgaris [French bean]
gb|AAS67872.1|  fructokinase                                          67.4    2e-21    Citrus unshiu [satsuma mandarin]
gb|KHN06200.1|  Fructokinase-2                                        66.2    2e-21    Glycine soja [wild soybean]
ref|XP_006421810.1|  hypothetical protein CICLE_v10005308mg           67.4    2e-21    Citrus clementina [clementine]
ref|XP_004495435.1|  PREDICTED: putative fructokinase-5-like isof...  65.5    2e-21    Cicer arietinum [garbanzo]
ref|XP_004309811.1|  PREDICTED: probable fructokinase-4               69.3    2e-21    Fragaria vesca subsp. vesca
gb|KFK32007.1|  hypothetical protein AALP_AA6G187900                  65.1    2e-21    Arabis alpina [alpine rockcress]
ref|XP_010908109.1|  PREDICTED: fructokinase-2-like                   72.0    2e-21    Elaeis guineensis
ref|XP_009382928.1|  PREDICTED: fructokinase-1-like                   69.7    2e-21    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO60165.1|  hypothetical protein CISIN_1g018696mg                 67.4    2e-21    Citrus sinensis [apfelsine]
emb|CAN61782.1|  hypothetical protein VITISV_012349                   68.6    2e-21    Vitis vinifera
gb|KJB37261.1|  hypothetical protein B456_006G196700                  65.1    2e-21    Gossypium raimondii
ref|XP_002272526.2|  PREDICTED: probable fructokinase-7 isoform X1    68.6    2e-21    Vitis vinifera
gb|EYU38801.1|  hypothetical protein MIMGU_mgv1a009756mg              67.0    2e-21    Erythranthe guttata [common monkey flower]
ref|XP_001757300.1|  predicted protein                                73.6    2e-21    
ref|XP_002263733.1|  PREDICTED: probable fructokinase-5               72.8    2e-21    
ref|XP_009138911.1|  PREDICTED: probable fructokinase-4               65.1    2e-21    
emb|CBI16962.3|  unnamed protein product                              72.8    2e-21    
emb|CDY00619.1|  BnaC04g23060D                                        65.1    2e-21    
gb|KJB52887.1|  hypothetical protein B456_008G281900                  65.1    2e-21    
ref|XP_010519220.1|  PREDICTED: probable fructokinase-7               65.9    2e-21    
ref|XP_010661607.1|  PREDICTED: probable fructokinase-7 isoform X2    68.6    2e-21    
gb|KFK40243.1|  hypothetical protein AALP_AA3G348700                  64.7    3e-21    
gb|AFO84082.1|  fructokinase                                          68.2    3e-21    
ref|XP_003534023.1|  PREDICTED: putative fructokinase-5-like isof...  65.5    3e-21    
ref|XP_006587363.1|  PREDICTED: putative fructokinase-5-like isof...  65.5    3e-21    
gb|ABB29956.1|  fructokinase-like                                     66.6    3e-21    
gb|KFK35169.1|  hypothetical protein AALP_AA5G248700                  64.7    3e-21    
ref|XP_010061753.1|  PREDICTED: fructokinase-1-like                   68.6    3e-21    
ref|XP_006347302.1|  PREDICTED: fructokinase-2                        66.2    3e-21    
ref|XP_002994477.1|  hypothetical protein SELMODRAFT_236970           68.6    3e-21    
ref|NP_564875.2|  pfkB-like carbohydrate kinase family protein        65.9    3e-21    
sp|Q7XJ81.1|SCRK2_SOLHA  RecName: Full=Fructokinase-2                 66.2    4e-21    
emb|CDY05089.1|  BnaC03g28870D                                        64.7    4e-21    
gb|AJK93568.1|  fructokinase                                          65.9    4e-21    
gb|AFW90586.1|  fructokinase                                          65.9    4e-21    
ref|XP_010510201.1|  PREDICTED: probable fructokinase-1               67.0    4e-21    
gb|KHG22422.1|  hypothetical protein F383_26791                       64.7    4e-21    
ref|XP_010414131.1|  PREDICTED: probable fructokinase-1               67.0    4e-21    
ref|XP_009404276.1|  PREDICTED: fructokinase-1-like                   71.6    4e-21    
ref|XP_006587362.1|  PREDICTED: putative fructokinase-5-like isof...  65.1    4e-21    
gb|KHN23057.1|  Putative fructokinase-5                               65.1    4e-21    
gb|ACG34312.1|  fructokinase-2                                        67.0    4e-21    
ref|XP_006587364.1|  PREDICTED: putative fructokinase-5-like isof...  65.1    4e-21    
ref|XP_006443007.1|  hypothetical protein CICLE_v10020949mg           64.7    4e-21    
ref|XP_006659056.1|  PREDICTED: fructokinase-2-like                   69.7    5e-21    
ref|XP_009134185.1|  PREDICTED: putative fructokinase-5               64.3    5e-21    
gb|ABC01889.1|  fructokinase-like protein                             64.7    5e-21    
gb|KCW90782.1|  hypothetical protein EUGRSUZ_A02848                   68.2    5e-21    
ref|XP_003555534.1|  PREDICTED: putative fructokinase-5-like          70.5    5e-21    
gb|KJB37262.1|  hypothetical protein B456_006G196700                  65.1    5e-21    
ref|XP_008457065.1|  PREDICTED: probable fructokinase-4               66.6    5e-21    
gb|AES76942.2|  pfkB family carbohydrate kinase                       68.9    5e-21    
gb|AAK44144.2|AF370329_1  putative fructokinase                       65.5    5e-21    
gb|KDP28712.1|  hypothetical protein JCGZ_14483                       68.6    6e-21    
ref|XP_003564826.1|  PREDICTED: fructokinase-1                        66.6    6e-21    
gb|KDO63084.1|  hypothetical protein CISIN_1g015777mg                 70.5    6e-21    
ref|XP_010469704.1|  PREDICTED: probable fructokinase-1               66.2    6e-21    
gb|AAN41289.1|  putative fructokinase                                 65.5    6e-21    
dbj|BAJ53134.1|  JHL05D22.5                                           68.6    6e-21    
ref|XP_010045714.1|  PREDICTED: probable fructokinase-1               70.1    6e-21    
ref|XP_001780342.1|  predicted protein                                67.4    6e-21    
ref|XP_010672224.1|  PREDICTED: probable fructokinase-4               67.4    6e-21    
ref|XP_010927874.1|  PREDICTED: fructokinase-2-like                   67.8    7e-21    
ref|XP_010101617.1|  hypothetical protein L484_003616                 65.5    7e-21    
emb|CBI36689.3|  unnamed protein product                              68.2    7e-21    
ref|XP_006292538.1|  hypothetical protein CARUB_v10018769mg           64.7    7e-21    
gb|KDO63085.1|  hypothetical protein CISIN_1g015777mg                 70.1    7e-21    
ref|XP_006482137.1|  PREDICTED: fructokinase-2-like                   70.1    7e-21    
ref|XP_011002780.1|  PREDICTED: probable fructokinase-6, chloropl...  68.9    7e-21    
gb|KDP37795.1|  hypothetical protein JCGZ_06697                       68.6    7e-21    
gb|AJK93567.1|  fructokinase                                          66.6    7e-21    
gb|AAA80675.1|  fructokinase                                          67.4    7e-21    
ref|XP_010932642.1|  PREDICTED: probable fructokinase-6, chloropl...  68.6    8e-21    
ref|XP_004513694.1|  PREDICTED: putative fructokinase-5-like isof...  65.1    8e-21    
ref|XP_006430625.1|  hypothetical protein CICLE_v10011546mg           70.1    8e-21    
ref|XP_007150435.1|  hypothetical protein PHAVU_005G153300g           68.2    8e-21    
dbj|BAD87551.1|  putative fructokinase                                65.9    8e-21    
ref|XP_008376805.1|  PREDICTED: fructokinase-1-like                   67.0    8e-21    
ref|XP_002889581.1|  pfkB-type carbohydrate kinase family protein     65.1    9e-21    
ref|XP_006294594.1|  hypothetical protein CARUB_v10023630mg           65.5    9e-21    
ref|NP_001060837.1|  Os08g0113100                                     68.6    1e-20    
gb|EAZ05375.1|  hypothetical protein OsI_27579                        68.6    1e-20    
ref|XP_002974772.1|  hypothetical protein SELMODRAFT_102153           66.6    1e-20    
ref|XP_009341299.1|  PREDICTED: fructokinase-1-like                   67.0    1e-20    
ref|NP_001045068.2|  Os01g0894300                                     65.5    1e-20    
ref|XP_004513695.1|  PREDICTED: putative fructokinase-5-like isof...  65.1    1e-20    
dbj|BAK07333.1|  predicted protein                                    64.3    1e-20    
gb|AFK41276.1|  unknown                                               72.4    1e-20    
dbj|BAM13316.1|  fructokinase 1                                       65.5    1e-20    
gb|EPS66213.1|  hypothetical protein M569_08566                       64.3    1e-20    
ref|XP_002963683.1|  hypothetical protein SELMODRAFT_165981           67.0    1e-20    
ref|XP_009383349.1|  PREDICTED: fructokinase-1-like                   72.8    1e-20    
ref|XP_010522182.1|  PREDICTED: probable fructokinase-1               66.6    1e-20    
gb|KJB71773.1|  hypothetical protein B456_011G141600                  68.6    1e-20    
ref|XP_007143353.1|  hypothetical protein PHAVU_007G065200g           66.6    1e-20    
gb|KDP43855.1|  hypothetical protein JCGZ_20865                       64.3    1e-20    
ref|XP_002268097.1|  PREDICTED: probable fructokinase-4               67.8    1e-20    
ref|XP_002305200.1|  pfkB-type carbohydrate kinase family protein     68.6    1e-20    
ref|XP_010437381.1|  PREDICTED: probable fructokinase-5               64.3    1e-20    
ref|XP_007222617.1|  hypothetical protein PRUPE_ppa008494mg           66.6    1e-20    
ref|XP_010529702.1|  PREDICTED: probable fructokinase-5               65.1    1e-20    
dbj|BAM13318.1|  fructokinase 1                                       65.5    1e-20    
ref|XP_006646557.1|  PREDICTED: fructokinase-1-like                   65.9    1e-20    
gb|AHE93348.1|  fructokinase                                          63.9    1e-20    
ref|XP_006478288.1|  PREDICTED: putative fructokinase-5-like          66.6    2e-20    
ref|XP_006441854.1|  hypothetical protein CICLE_v10021154mg           66.2    2e-20    
gb|EPS68794.1|  fructokinase-like protein                             65.1    2e-20    
ref|XP_010455423.1|  PREDICTED: probable fructokinase-5               64.7    2e-20    
ref|XP_002874614.1|  predicted protein                                64.3    2e-20    
gb|AFO84080.1|  fructokinase                                          63.9    2e-20    
ref|XP_010442690.1|  PREDICTED: probable fructokinase-7 isoform X2    63.5    2e-20    
gb|ACC64524.1|  fructokinase                                          68.2    2e-20    
ref|XP_009625375.1|  PREDICTED: probable fructokinase-4               65.9    2e-20    
ref|XP_006289593.1|  hypothetical protein CARUB_v10003144mg           64.7    2e-20    
ref|XP_004490806.1|  PREDICTED: probable fructokinase-4-like          65.9    2e-20    
ref|XP_010421945.1|  PREDICTED: probable fructokinase-5               64.3    2e-20    
ref|XP_004486913.1|  PREDICTED: probable fructokinase-4-like          68.9    2e-20    
ref|XP_009404933.1|  PREDICTED: fructokinase-2-like                   64.3    2e-20    
ref|XP_010557080.1|  PREDICTED: probable fructokinase-1               65.1    2e-20    
ref|XP_008222483.1|  PREDICTED: probable fructokinase-4               67.4    2e-20    
ref|XP_010262186.1|  PREDICTED: probable fructokinase-6, chloropl...  65.5    2e-20    
ref|XP_008788183.1|  PREDICTED: fructokinase-1-like                   68.2    3e-20    
gb|KEH30339.1|  pfkB family carbohydrate kinase                       65.1    3e-20    
gb|KFK31217.1|  hypothetical protein AALP_AA6G083600                  64.3    3e-20    
ref|XP_007152360.1|  hypothetical protein PHAVU_004G123400g           65.5    3e-20    
ref|XP_001756304.1|  predicted protein                                65.1    3e-20    
emb|CDX86540.1|  BnaC08g01630D                                        63.2    3e-20    
gb|EMS57576.1|  hypothetical protein TRIUR3_24487                     63.9    3e-20    
ref|XP_003541157.1|  PREDICTED: fructokinase-2-like                   66.2    3e-20    
ref|XP_009771749.1|  PREDICTED: probable fructokinase-4               64.7    3e-20    
ref|XP_010099603.1|  putative fructokinase-4                          66.6    3e-20    
gb|AAK62446.1|AF387001_1  putative fructokinase                       63.5    3e-20    
gb|KDP22350.1|  hypothetical protein JCGZ_26181                       65.1    3e-20    
ref|XP_006410273.1|  hypothetical protein EUTSA_v10016928mg           63.5    4e-20    
ref|NP_180697.1|  probable fructokinase-1                             63.5    4e-20    
gb|KFK26793.1|  hypothetical protein AALP_AA8G294300                  65.1    4e-20    
ref|XP_004308129.1|  PREDICTED: probable fructokinase-7 isoform X1    66.2    4e-20    
ref|XP_009778352.1|  PREDICTED: fructokinase-1 isoform X2             62.8    4e-20    
ref|NP_192764.1|  probable fructokinase-5                             64.3    4e-20    
ref|XP_011470420.1|  PREDICTED: probable fructokinase-7 isoform X2    66.2    4e-20    
ref|XP_002881172.1|  pfkB-type carbohydrate kinase family protein     63.5    4e-20    
emb|CAD31714.1|  fructokinase-like protein                            65.1    4e-20    
ref|XP_010482526.1|  PREDICTED: probable fructokinase-7               63.5    4e-20    
ref|XP_009778351.1|  PREDICTED: fructokinase-1 isoform X1             62.8    4e-20    
gb|ABK28625.1|  unknown                                               64.3    4e-20    
ref|XP_003620724.1|  Fructokinase                                     65.9    4e-20    
ref|XP_004970880.1|  PREDICTED: fructokinase-1-like                   65.5    4e-20    
gb|KHN33305.1|  Fructokinase-2                                        67.0    4e-20    
ref|XP_004507340.1|  PREDICTED: fructokinase-2-like                   64.7    4e-20    
ref|XP_001759326.1|  predicted protein                                62.8    4e-20    
ref|XP_008343250.1|  PREDICTED: putative fructokinase-5               64.3    5e-20    
ref|XP_003546905.1|  PREDICTED: fructokinase-2-like                   67.0    5e-20    
gb|EEC71945.1|  hypothetical protein OsI_04762                        63.5    5e-20    
ref|XP_010443953.1|  PREDICTED: probable fructokinase-7               64.3    5e-20    
ref|XP_006304792.1|  hypothetical protein CARUB_v10012342mg           63.5    5e-20    
gb|AIE16181.1|  fructokinase                                          62.8    5e-20    
ref|XP_002510869.1|  fructokinase, putative                           65.1    6e-20    
ref|XP_010511466.1|  PREDICTED: probable fructokinase-6, chloropl...  65.1    6e-20    
ref|XP_007141895.1|  hypothetical protein PHAVU_008G234800g           68.6    6e-20    
gb|AII73555.1|  fructokinase                                          68.2    6e-20    
sp|A2WXV8.1|SCRK1_ORYSI  RecName: Full=Fructokinase-1; AltName: F...  63.2    7e-20    
ref|XP_010035062.1|  PREDICTED: probable fructokinase-1               62.4    7e-20    
gb|ABR17236.1|  unknown                                               62.4    7e-20    
ref|XP_009132781.1|  PREDICTED: probable fructokinase-1               63.5    7e-20    
ref|NP_172093.1|  probable fructokinase-2                             64.7    7e-20    
emb|CDY23944.1|  BnaC03g17470D                                        63.5    7e-20    
ref|XP_002263176.1|  PREDICTED: probable fructokinase-7               62.8    7e-20    
ref|XP_001779049.1|  predicted protein                                69.3    8e-20    
ref|XP_009144211.1|  PREDICTED: probable fructokinase-1               62.4    8e-20    
emb|CDY10801.1|  BnaA05g11350D                                        62.4    8e-20    
gb|KCW46326.1|  hypothetical protein EUGRSUZ_K00187                   62.4    8e-20    
gb|EYU37375.1|  hypothetical protein MIMGU_mgv1a010047mg              64.7    8e-20    
emb|CDY56614.1|  BnaCnng30740D                                        62.4    8e-20    
gb|EPS69686.1|  fructokinase 3                                        65.9    8e-20    
emb|CDP05266.1|  unnamed protein product                              63.2    8e-20    
ref|XP_002889582.1|  pfkB-type carbohydrate kinase family protein     66.2    9e-20    
ref|XP_002989626.1|  hypothetical protein SELMODRAFT_428214           63.5    9e-20    
ref|XP_002986057.1|  hypothetical protein SELMODRAFT_425086           63.2    1e-19    
ref|NP_001266534.1|  fructokinase-2                                   68.2    1e-19    
gb|KJB37965.1|  hypothetical protein B456_006G229100                  66.6    1e-19    
ref|XP_010475326.1|  PREDICTED: probable fructokinase-2               63.5    1e-19    
ref|XP_006829109.1|  hypothetical protein AMTR_s00001p00265040        63.9    1e-19    
ref|XP_009111012.1|  PREDICTED: probable fructokinase-2               62.8    1e-19    
gb|ACG33449.1|  fructokinase-2                                        68.2    1e-19    
ref|XP_010415185.1|  PREDICTED: probable fructokinase-6, chloropl...  63.9    1e-19    
ref|XP_010415184.1|  PREDICTED: probable fructokinase-6, chloropl...  63.9    1e-19    
gb|ACL53092.1|  unknown                                               67.8    1e-19    
gb|KHG15213.1|  hypothetical protein F383_03322                       66.6    1e-19    
ref|NP_001105211.1|  fructokinase-2                                   67.8    1e-19    
gb|ACJ11715.1|  fructokinase                                          66.2    1e-19    
gb|ACG36535.1|  fructokinase-2                                        67.8    1e-19    
gb|AFW74311.1|  hypothetical protein ZEAMMB73_056885                  67.8    1e-19    
ref|XP_008378129.1|  PREDICTED: probable fructokinase-4               66.6    1e-19    
gb|AJK93565.1|  fructokinase                                          69.3    1e-19    
ref|XP_010693442.1|  PREDICTED: probable fructokinase-7               65.5    1e-19    
gb|ACG38926.1|  fructokinase-2                                        67.4    1e-19    
emb|CDY15383.1|  BnaC04g42400D                                        64.3    1e-19    
ref|XP_003592351.1|  Fructokinase                                     74.7    1e-19    
ref|XP_006280740.1|  hypothetical protein CARUB_v10026709mg           61.6    2e-19    
ref|XP_002864134.1|  pfkB-type carbohydrate kinase family protein     63.5    2e-19    
ref|XP_003592350.1|  Fructokinase                                     74.7    2e-19    
ref|XP_003616371.1|  Fructokinase-2                                   68.6    2e-19    
ref|XP_010485800.1|  PREDICTED: probable fructokinase-2               62.4    3e-19    
ref|XP_010457717.1|  PREDICTED: probable fructokinase-2 isoform X2    63.5    3e-19    
ref|NP_172092.1|  putative fructokinase-3                             65.1    3e-19    
ref|XP_010501336.1|  PREDICTED: probable fructokinase-3               65.1    3e-19    
emb|CDY19092.1|  BnaA04g18320D                                        63.5    3e-19    
gb|ACG44849.1|  fructokinase-1                                        62.8    3e-19    
gb|ACG39031.1|  fructokinase-2                                        68.6    3e-19    
ref|XP_011026435.1|  PREDICTED: probable fructokinase-1               65.1    3e-19    
ref|XP_010109032.1|  putative fructokinase-2                          66.2    3e-19    
gb|AJK93566.1|  fructokinase                                          64.7    3e-19    
ref|XP_004161610.1|  PREDICTED: putative fructokinase-5-like          70.1    4e-19    
gb|ABK25140.1|  unknown                                               62.0    4e-19    
gb|KGN57838.1|  hypothetical protein Csa_3G345390                     69.7    4e-19    
gb|KHN41078.1|  Putative fructokinase-4                               68.2    4e-19    
ref|NP_001240145.1|  uncharacterized protein LOC100797023             68.2    4e-19    
ref|XP_004149791.1|  PREDICTED: putative fructokinase-5-like          70.1    4e-19    
emb|CDY51025.1|  BnaC09g52860D                                        61.2    4e-19    
ref|XP_010475323.1|  PREDICTED: probable fructokinase-3               65.1    5e-19    
ref|WP_044826812.1|  fructokinase                                     65.9    5e-19    
ref|XP_010528531.1|  PREDICTED: probable fructokinase-6, chloropl...  65.9    5e-19    
emb|CDY10167.1|  BnaC05g04100D                                        62.4    5e-19    
ref|XP_010528532.1|  PREDICTED: probable fructokinase-6, chloropl...  66.2    5e-19    
ref|XP_002310430.1|  hypothetical protein POPTR_0007s01850g           65.1    6e-19    
ref|WP_037991365.1|  fructokinase                                     64.7    6e-19    
gb|EMT08894.1|  hypothetical protein F775_32009                       62.0    6e-19    
gb|KDP33160.1|  hypothetical protein JCGZ_13425                       65.5    6e-19    
ref|XP_008788319.1|  PREDICTED: fructokinase-2-like                   69.7    6e-19    
ref|XP_003623806.1|  Fructokinase                                     62.4    6e-19    
emb|CDY38879.1|  BnaA03g13000D                                        62.0    6e-19    
gb|AFN08698.1|  FRK2                                                  66.6    6e-19    
dbj|BAM13317.1|  fructokinase 1                                       62.8    7e-19    
ref|NP_001183584.1|  uncharacterized protein LOC100502178             61.6    7e-19    
ref|XP_009334417.1|  PREDICTED: probable fructokinase-4               64.3    7e-19    



>gb|KHG25437.1| hypothetical protein F383_06753 [Gossypium arboreum]
Length=480

 Score =   222 bits (566),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+HYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  359  TREEISPLWHDGLKFLFVTDGTLRIHYYTPLFDGVVVGTEDVLITPFTCDRTGSGDAVVA  418

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  419  GIMRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  472


 Score =   199 bits (506),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPLPLW+SRD+T E
Sbjct  244  NLAVLKEARIFHFNSEVLTSPSMRSTLFKAIAWSKKFGGLIFFDLNLPLPLWRSRDKTRE  303

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+K R+YYH
Sbjct  304  VIKKAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKKRRDYYH  357



>gb|KJB36871.1| hypothetical protein B456_006G180000 [Gossypium raimondii]
 gb|KJB36872.1| hypothetical protein B456_006G180000 [Gossypium raimondii]
Length=480

 Score =   222 bits (566),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+HYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  359  TREEISPLWHDGLKFLFVTDGTLRIHYYTPLFDGVVVGTEDVLITPFTCDRTGSGDAVVA  418

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  419  GIMRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  472


 Score =   199 bits (506),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPLPLW+SRD+T E
Sbjct  244  NLAVLKEARIFHFNSEVLTSPSMRSTLFKAITWSKKFGGLIFFDLNLPLPLWRSRDKTRE  303

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+K R+YYH
Sbjct  304  VIKKAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKKRRDYYH  357



>gb|ADI87417.1| fructokinase-like protein 1 [Gossypium hirsutum]
Length=480

 Score =   222 bits (566),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+HYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  359  TREEISPLWHDGLKFLFVTDGTLRIHYYTPLFDGVVVGTEDVLITPFTCDRTGSGDAVVA  418

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  419  GIMRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  472


 Score =   199 bits (506),  Expect(2) = 7e-109, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPLPLW+SRD+T E
Sbjct  244  NLAVLKEARIFHFNSEVLTSPSMRSTLFKAIAWSKKFGGLIFFDLNLPLPLWRSRDKTRE  303

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+K R+YYH
Sbjct  304  VIKKAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKKRRDYYH  357



>ref|XP_011077603.1| PREDICTED: fructokinase-like 1, chloroplastic [Sesamum indicum]
Length=490

 Score =   223 bits (568),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+ PLWHD+LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  369  AREEILPLWHDQLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVA  428

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTTQPEMF+NQD+LERQLRFAI+AGIISQWTIGAVRGFPTESA QNLKE
Sbjct  429  GIMRKLTTQPEMFDNQDLLERQLRFAIAAGIISQWTIGAVRGFPTESAAQNLKE  482


 Score =   191 bits (486),  Expect(2) = 8e-107, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N +VLKEARIFHFNSEVLTS +M STLFKA++WSKKFGGL+FFDLNLPLPLWKSRDET E
Sbjct  254  NLSVLKEARIFHFNSEVLTSTSMRSTLFKALAWSKKFGGLVFFDLNLPLPLWKSRDETRE  313

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AWEQADIIEV++ ELEFLLDE++YE +RNY+PQY+AE ++QT+  R+YYH
Sbjct  314  VIKEAWEQADIIEVTKQELEFLLDEEYYERRRNYRPQYYAESYEQTKNRRDYYH  367



>ref|XP_007026821.1| Fructokinase-like 1 [Theobroma cacao]
 gb|EOY07323.1| Fructokinase-like 1 [Theobroma cacao]
Length=647

 Score =   221 bits (564),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHD LK+LFVTDGTLR+HYYTPSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  528  EEISPLWHDGLKYLFVTDGTLRIHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  587

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFENQD LERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  588  MRKLTTYPEMFENQDTLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  639


 Score =   191 bits (485),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKE RIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPL LW+SRDET E
Sbjct  411  NLAVLKETRIFHFNSEVLTSPSMQSTLFKAIAWSKKFGGLIFFDLNLPLLLWRSRDETRE  470

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+  R+ YH
Sbjct  471  VIKEAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKNRRDCYH  524



>ref|XP_009772599.1| PREDICTED: probable fructokinase-4 [Nicotiana sylvestris]
Length=486

 Score =   219 bits (558),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -2

Query  351  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  172
            E+APLWHD LK LFVTDGTLRLHYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGIM
Sbjct  368  EIAPLWHDGLKLLFVTDGTLRLHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  427

Query  171  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            RKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  428  RKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  478


 Score =   192 bits (489),  Expect(2) = 5e-106, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEARIFHFNSEVLTS +M STLFKAIS SKKFGGL+FFDLNLPLPLW+SRDET  
Sbjct  250  NLDVLKEARIFHFNSEVLTSSSMRSTLFKAISLSKKFGGLVFFDLNLPLPLWRSRDETRN  309

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AWEQA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+F+QT++ R+YYH
Sbjct  310  LIKEAWEQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENFEQTKQRRDYYH  363



>gb|ADI87421.1| fructokinase-like protein 1 [Nicotiana tabacum]
Length=288

 Score =   219 bits (558),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 108/111 (97%), Gaps = 0/111 (0%)
 Frame = -2

Query  351  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  172
            E+APLWHD LK LFVTDGTLRLHYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGIM
Sbjct  170  EIAPLWHDGLKLLFVTDGTLRLHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  229

Query  171  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            RKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  230  RKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  280


 Score =   193 bits (490),  Expect(2) = 6e-106, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEARIFHFNSEVLTS +M STLFKAIS SKKFGGL+FFDLNLPLPLW+SRDET  
Sbjct  52   NLDVLKEARIFHFNSEVLTSSSMRSTLFKAISLSKKFGGLVFFDLNLPLPLWRSRDETRN  111

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AWEQA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+F+QT++ R+YYH
Sbjct  112  LIKEAWEQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENFEQTKQRRDYYH  165



>ref|XP_010256724.1| PREDICTED: fructokinase-like 1, chloroplastic [Nelumbo nucifera]
Length=541

 Score =   218 bits (555),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +R+E++PLWHD +KFLFVTDGT R+HYY+PSF+G VVGTEDVLITP+TCDRTGSGDAVVA
Sbjct  420  TRDEISPLWHDGIKFLFVTDGTFRIHYYSPSFDGAVVGTEDVLITPYTCDRTGSGDAVVA  479

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEMFENQD LERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  480  GIMRKLTTHPEMFENQDALERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  533


 Score =   193 bits (491),  Expect(2) = 8e-106, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -1

Query  697  AVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVI  518
            AVLKEARIFHFNSEVLTSP+MHS LF+AI  +KKFGGL+FFDLNLPLPLW+SRDE+WEVI
Sbjct  307  AVLKEARIFHFNSEVLTSPSMHSALFRAIRLTKKFGGLVFFDLNLPLPLWRSRDESWEVI  366

Query  517  KGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            K AW +A+I+EVS+ ELEFLLDE+HYE KRNY+PQY+AE F+QT+  R+YYH
Sbjct  367  KKAWNEANIVEVSKQELEFLLDEEHYERKRNYRPQYYAESFEQTKNRRDYYH  418



>ref|XP_009629251.1| PREDICTED: fructokinase-1 [Nicotiana tomentosiformis]
Length=487

 Score =   217 bits (552),  Expect(2) = 9e-106, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+APLWHD +K LFVTDGTLR+HYY+P+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  368  EEIAPLWHDGMKLLFVTDGTLRVHYYSPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  427

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTTQPEM+ +QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  428  MRKLTTQPEMYNDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  479


 Score =   194 bits (493),  Expect(2) = 9e-106, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEARIFHFNSEVLTS TM STLFKAIS SKKFGGL+FFDLNLPLPLW+SRDET  
Sbjct  251  NLDVLKEARIFHFNSEVLTSSTMRSTLFKAISLSKKFGGLVFFDLNLPLPLWRSRDETRN  310

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AWEQA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+F+QT++ R+YYH
Sbjct  311  LIKEAWEQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENFEQTKQRRDYYH  364



>gb|KHN26222.1| Fructokinase-2 [Glycine soja]
Length=292

 Score =   219 bits (559),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 115/129 (89%), Gaps = 4/129 (3%)
 Frame = -2

Query  384  GR*ETITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRT  205
             R E    + EEV+PLWHDRLKFLFVTDGTLR+HYYTPSF+G VVGTEDVLITP+TCDRT
Sbjct  163  NRQEYYHYTAEEVSPLWHDRLKFLFVTDGTLRIHYYTPSFDGSVVGTEDVLITPYTCDRT  222

Query  204  GSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            GSGDAVVA I+RKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNL
Sbjct  223  GSGDAVVAAILRKLTTCPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNL  282

Query  24   KE----PSL  10
            KE    PSL
Sbjct  283  KEQVYVPSL  291


 Score =   191 bits (486),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSE+LT P+M STLF+AI W+KKFGGL+FFDLNLPLPLW+SRDET E
Sbjct  56   NLAVLKEARIFHFNSEILTCPSMESTLFRAIKWTKKFGGLVFFDLNLPLPLWRSRDETRE  115

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +ADIIEVSRSELEFLLDE++YE  RNY+PQYFAE ++QT+  + YYH
Sbjct  116  IIKKAWNEADIIEVSRSELEFLLDEEYYERNRNYRPQYFAESYEQTKNRQEYYH  169



>ref|NP_001275447.1| fructokinase-like protein 1 [Solanum tuberosum]
 gb|ADI87416.1| fructokinase-like protein 1 [Solanum tuberosum]
Length=479

 Score =   219 bits (557),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+APLWHD LK LFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  360  EEIAPLWHDGLKLLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  419

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  420  MRKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  471


 Score =   191 bits (486),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVLTS +M STLFKAI+ SKKFGGLIFFDLNLPLPLW+SRDET +
Sbjct  243  NLDVLKEARMFHFNSEVLTSSSMRSTLFKAITLSKKFGGLIFFDLNLPLPLWRSRDETRD  302

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW+QA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+++QT++ RNYYH
Sbjct  303  LIKKAWQQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENYEQTKQRRNYYH  356



>ref|XP_004246362.1| PREDICTED: fructokinase-like 1, chloroplastic [Solanum lycopersicum]
Length=478

 Score =   219 bits (559),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 102/112 (91%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+APLWHD LK LFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  359  EEIAPLWHDGLKLLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  418

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  419  MRKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  470


 Score =   191 bits (484),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVLTS +M STLFKAI+ SKKFGGL+FFDLNLPLPLW+SRDET +
Sbjct  242  NLDVLKEARMFHFNSEVLTSSSMRSTLFKAITLSKKFGGLVFFDLNLPLPLWRSRDETRD  301

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW+QA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+++QT++ RNYYH
Sbjct  302  LIKEAWQQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENYEQTKQRRNYYH  355



>gb|EYU26634.1| hypothetical protein MIMGU_mgv1a005440mg [Erythranthe guttata]
Length=483

 Score =   221 bits (564),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHDRLKFLFVTDGTLRLHYY+PSF+GVV+GTEDVLITPFTCDRTGSGDAVVA
Sbjct  362  TREEISPLWHDRLKFLFVTDGTLRLHYYSPSFDGVVIGTEDVLITPFTCDRTGSGDAVVA  421

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             IMRKLTTQP+M+ENQD L RQLRFAISAGII+QWTIGAVRGFPTESATQNLKE
Sbjct  422  AIMRKLTTQPDMYENQDTLVRQLRFAISAGIIAQWTIGAVRGFPTESATQNLKE  475


 Score =   188 bits (477),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -1

Query  688  KEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGA  509
            KEARIFHFNSEVLTS  M STLFKAI  SKKFGGL+FFDLNLPLPLWKSRDET EVIK A
Sbjct  252  KEARIFHFNSEVLTSTAMRSTLFKAIKLSKKFGGLVFFDLNLPLPLWKSRDETREVIKEA  311

Query  508  WEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            WEQADIIEV++ ELEFLLDEDHYE +RNY+PQY+AE ++QT+K R+YYH
Sbjct  312  WEQADIIEVTKQELEFLLDEDHYEKRRNYRPQYYAESYEQTKKRRDYYH  360



>ref|XP_004506641.1| PREDICTED: fructokinase-2-like [Cicer arietinum]
Length=458

 Score =   217 bits (552),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  384  GR*ETITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRT  205
             R E    + EE++PLWHD+LKFLFVTDGT+R+HYYTPSF+GVVVGTEDVLITP+TCDRT
Sbjct  329  NRREYYHYTAEEISPLWHDKLKFLFVTDGTIRIHYYTPSFDGVVVGTEDVLITPYTCDRT  388

Query  204  GSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            GSGDAVVA IMRKLTT PEMFENQDVLE+QLRFA++AGIISQWTIG VRGFPTESATQNL
Sbjct  389  GSGDAVVAAIMRKLTTCPEMFENQDVLEKQLRFAVAAGIISQWTIGGVRGFPTESATQNL  448

Query  24   KE  19
            KE
Sbjct  449  KE  450


 Score =   192 bits (489),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTS +M STLFKAI WSKKFGGL+FFDLNLPLPLW+SRDET E
Sbjct  222  NLAVLKEARIFHFNSEVLTSSSMESTLFKAIKWSKKFGGLVFFDLNLPLPLWRSRDETRE  281

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +I+ AW +ADIIEVSR+ELEFLLDE+HYE KRNY+PQY+AED++ T+  R YYH
Sbjct  282  IIRKAWHEADIIEVSRTELEFLLDEEHYERKRNYEPQYYAEDYEHTKNRREYYH  335



>emb|CDP06530.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   217 bits (553),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+HYY PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  382  TREEISPLWHDGLKFLFVTDGTLRIHYYAPSFDGVVVGTEDVLITPFTCDRTGSGDAVVA  441

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             IMRKLTT  EMFENQD+LERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  442  AIMRKLTTVSEMFENQDILERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  495


 Score =   192 bits (487),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEAR+FHFNSEVLT P+MHS LF+AISWSKKFG L+FFD N PLPLW+SRD T E
Sbjct  267  NLAVLKEARMFHFNSEVLTCPSMHSALFRAISWSKKFGALVFFDPNFPLPLWESRDMTRE  326

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            V+K AWEQADIIEVS+ ELEFLLDE+HYE +RNY PQY+AE+F+QT K+R+YYH
Sbjct  327  VLKKAWEQADIIEVSKQELEFLLDEEHYERRRNYTPQYYAENFEQTSKLRDYYH  380



>ref|XP_010515923.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score =   212 bits (540),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  356  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  415

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESA QNLKE
Sbjct  416  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESAAQNLKE  467


 Score =   197 bits (500),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  239  NLAVLKEARIFHFNSEVLTSPTMESTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  298

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW++ADIIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYH
Sbjct  299  LIKKAWDEADIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYH  352



>ref|XP_010686350.1| PREDICTED: fructokinase-like 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   221 bits (562),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+ PLWHD LKFLFVTDGT R+HYYTPSF+GVVVGTEDVLITPFTCDRTGSGDA+VA
Sbjct  360  TREEITPLWHDGLKFLFVTDGTFRIHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAIVA  419

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLT+ PEM+E+QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  420  GIMRKLTSHPEMYEDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  473


 Score =   189 bits (479),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            + AVLKEARIFHFNSEVLTSP MH +LFKAI  SK FGGL+FFD NLPLPLWKSRDET E
Sbjct  245  DLAVLKEARIFHFNSEVLTSPCMHLSLFKAIKISKFFGGLVFFDPNLPLPLWKSRDETRE  304

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AWE+A+IIEVSR ELEFLLDEDHYE +RNY+PQY+AED++Q++  R+YYH
Sbjct  305  VIKEAWEEANIIEVSRQELEFLLDEDHYEKRRNYRPQYYAEDYEQSKNRRDYYH  358



>ref|XP_003516930.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=467

 Score =   218 bits (555),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 115/129 (89%), Gaps = 4/129 (3%)
 Frame = -2

Query  384  GR*ETITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRT  205
             R E    + EEV+PLWHDRLKFLFVTDGTLR+HYYTPSF+G VVGTEDVLITP+TCDRT
Sbjct  338  NRQEYYHYTAEEVSPLWHDRLKFLFVTDGTLRIHYYTPSFDGSVVGTEDVLITPYTCDRT  397

Query  204  GSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            GSGDAVVA I+RKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNL
Sbjct  398  GSGDAVVAAILRKLTTCPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNL  457

Query  24   KE----PSL  10
            KE    PSL
Sbjct  458  KEQVYVPSL  466


 Score =   191 bits (484),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSE+LT P+M STLF+AI W+KKFGGL+FFDLNLPLPLW+SRDET E
Sbjct  231  NLAVLKEARIFHFNSEILTCPSMESTLFRAIKWTKKFGGLVFFDLNLPLPLWRSRDETRE  290

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +ADIIEVSRSELEFLLDE++YE  RNY+PQYFAE ++QT+  + YYH
Sbjct  291  IIKKAWNEADIIEVSRSELEFLLDEEYYERNRNYRPQYFAESYEQTKNRQEYYH  344



>gb|KHM98942.1| Fructokinase-2 [Glycine soja]
Length=293

 Score =   219 bits (559),  Expect(2) = 7e-105, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 115/129 (89%), Gaps = 4/129 (3%)
 Frame = -2

Query  384  GR*ETITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRT  205
             R E    + EEV+PLWHDRLKFLFVTDGTLR+HYYTPSF+G V+GTEDVLITP+TCDRT
Sbjct  164  NRQEYYHYTAEEVSPLWHDRLKFLFVTDGTLRIHYYTPSFDGSVMGTEDVLITPYTCDRT  223

Query  204  GSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            GSGDAVVA I+RKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNL
Sbjct  224  GSGDAVVAAILRKLTTCPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNL  283

Query  24   KE----PSL  10
            KE    PSL
Sbjct  284  KEQVYVPSL  292


 Score =   189 bits (479),  Expect(2) = 7e-105, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLT P+M STLF+AI W+KKF GL+FFDLNLPLPLW+S DET E
Sbjct  57   NLAVLKEARIFHFNSEVLTCPSMESTLFRAIKWTKKFDGLVFFDLNLPLPLWRSHDETRE  116

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +ADIIEVSRSELEFLLDE++YE KRNY+PQYFAE+++QT+  + YYH
Sbjct  117  IIKKAWNEADIIEVSRSELEFLLDEEYYERKRNYRPQYFAENYEQTKNRQEYYH  170



>ref|XP_010504200.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=471

 Score =   212 bits (540),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  352  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  411

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESA QNLKE
Sbjct  412  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESAAQNLKE  463


 Score =   195 bits (496),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLF+AI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  235  NLAVLKEARIFHFNSEVLTSPTMQSTLFRAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  294

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +ADIIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYH
Sbjct  295  LIKKAWNEADIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYH  348



>gb|ADI87414.1| fructokinase-like protein 1 [Nicotiana benthamiana]
Length=486

 Score =   222 bits (565),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+APLWHD LK LFVTDGTLRLHYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  367  EEIAPLWHDGLKLLFVTDGTLRLHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  426

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTTQPEM+++QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  427  MRKLTTQPEMYDDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  478


 Score =   186 bits (471),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEARIFHFNSEV TS +M STL KAIS SKKFGGL+FFDLNLPLPLW+SRDET  
Sbjct  250  NLDVLKEARIFHFNSEVSTSSSMRSTLLKAISLSKKFGGLVFFDLNLPLPLWRSRDETRN  309

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AWEQA+IIEVSR ELEFLL E+HYE KRNY+PQYFAE+F+QT++ R+YYH
Sbjct  310  LIKEAWEQANIIEVSRQELEFLLGEEHYERKRNYRPQYFAENFEQTKQRRDYYH  363



>gb|ADI87420.1| fructokinase-like protein 1 [Vigna unguiculata]
Length=468

 Score =   216 bits (549),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EEVAPLWHDRLKFLFVTDGT+R+HYYTPSF G VVGTEDVLITPFTCDRTGSGDA+VA I
Sbjct  349  EEVAPLWHDRLKFLFVTDGTIRIHYYTPSFHGSVVGTEDVLITPFTCDRTGSGDAIVAAI  408

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLTT PEMFENQDVLERQLRFA++AGII+QWTIGA+RGFPTESATQNLKE
Sbjct  409  LRKLTTCPEMFENQDVLERQLRFAVAAGIIAQWTIGAIRGFPTESATQNLKE  460


 Score =   191 bits (486),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLT PTM STLF+AI W++KFGGL+FFDLNLPL LW+SRDET E
Sbjct  232  NLAVLKEARIFHFNSEVLTCPTMESTLFRAIKWTRKFGGLVFFDLNLPLSLWRSRDETRE  291

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +ADIIEVSRSELEFLLDE++YE KRNY+PQYFAE ++QT+ ++ YYH
Sbjct  292  IIKKAWNEADIIEVSRSELEFLLDEEYYERKRNYRPQYFAESYEQTKNLQEYYH  345



>ref|XP_009116097.1| PREDICTED: fructokinase-2 [Brassica rapa]
Length=463

 Score =   214 bits (544),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWHD LK L VTDGTLRLHYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  344  EEIKPLWHDNLKLLVVTDGTLRLHYYTPKFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  403

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  404  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  455


 Score =   193 bits (491),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  227  NLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  286

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW++A+I+EVS+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYH
Sbjct  287  LIKKAWDEANIVEVSQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYH  340



>ref|XP_010528657.1| PREDICTED: fructokinase-like 1, chloroplastic [Tarenaya hassleriana]
Length=654

 Score =   213 bits (541),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+ PLWHD LKFLFVTDGTLR+HYY PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  533  TREEIEPLWHDGLKFLFVTDGTLRIHYYAPSFDGVVVGTEDVLITPFTCDRTGSGDAVVA  592

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEMFE+ DV ERQLRFAI+AGII+QWTIGAVRGFPTESA QNLKE
Sbjct  593  GIMRKLTTCPEMFEDGDVTERQLRFAIAAGIIAQWTIGAVRGFPTESAAQNLKE  646


 Score =   194 bits (493),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -1

Query  697  AVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVI  518
            AVLKEARIFHFNSEVLTSPTM STLFKAI WS KFGGLIFFDLNLPLPLWKSRDET E+I
Sbjct  420  AVLKEARIFHFNSEVLTSPTMRSTLFKAIQWSVKFGGLIFFDLNLPLPLWKSRDETRELI  479

Query  517  KGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            K AW +A+IIEVSR ELEFLLDED YE KRNY PQY+AE F+QT+  R+YYH
Sbjct  480  KKAWNKANIIEVSRQELEFLLDEDDYERKRNYTPQYYAEKFEQTKNRRDYYH  531



>ref|XP_006291033.1| hypothetical protein CARUB_v10017145mg [Capsella rubella]
 gb|EOA23931.1| hypothetical protein CARUB_v10017145mg [Capsella rubella]
Length=475

 Score =   212 bits (540),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  356  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  415

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QD+LERQLRFA++AGIISQWTIGAVRGFPTESA QNLKE
Sbjct  416  MRKLTTCPEMFEDQDMLERQLRFAVAAGIISQWTIGAVRGFPTESAAQNLKE  467


 Score =   195 bits (495),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  239  NLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  298

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +A+IIEVS+ ELEFLLDED+YE +RNY PQYFAEDF+QT+  R+YYH
Sbjct  299  LIKKAWNEANIIEVSQQELEFLLDEDYYEKRRNYTPQYFAEDFEQTKNRRDYYH  352



>emb|CDX73510.1| BnaC08g24930D [Brassica napus]
Length=463

 Score =   214 bits (545),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWHD LK L VTDGTLRLHYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  344  EEIKPLWHDNLKLLVVTDGTLRLHYYTPKFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  403

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  404  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  455


 Score =   192 bits (488),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  227  NLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  286

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW++A+IIE S+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYH
Sbjct  287  LIKKAWDEANIIEASQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYH  340



>ref|XP_010427076.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score =   210 bits (535),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  356  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAAI  415

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE QDVLERQLRFA++AGII+QWTIGAVRGFPTESA QNLKE
Sbjct  416  MRKLTTCPEMFEEQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESAAQNLKE  467


 Score =   196 bits (497),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLF+A+ WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  239  NLAVLKEARIFHFNSEVLTSPTMQSTLFRAVQWSKKFGGLIFFDLNLPLPLWRSRNETRK  298

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +ADIIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYH
Sbjct  299  LIKKAWNEADIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYH  352



>emb|CDX78206.1| BnaA09g34010D [Brassica napus]
Length=378

 Score =   213 bits (542),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWHD LK L VTDGTLRLHYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  259  EEIKPLWHDNLKLLVVTDGTLRLHYYTPKFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  318

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  319  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  370


 Score =   192 bits (489),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  142  NLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  201

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW+ A+IIEVS+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYH
Sbjct  202  LIKKAWDTANIIEVSQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYH  255



>gb|KDP24506.1| hypothetical protein JCGZ_25070 [Jatropha curcas]
Length=504

 Score =   217 bits (552),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LK L VTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDA+VA
Sbjct  383  TREEISPLWHDGLKLLVVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAIVA  442

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             IMRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  443  AIMRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  496


 Score =   189 bits (479),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N +VLKEARIFHF SEVLTSP+M STLF+AI  SKKFGGLIFFDLNLPLPLW+SRDET E
Sbjct  268  NLSVLKEARIFHFTSEVLTSPSMQSTLFRAIKLSKKFGGLIFFDLNLPLPLWRSRDETRE  327

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AW +A+IIEVSR ELEFLLDED YE KRNY+PQY+AE+F+QT+  R+YYH
Sbjct  328  VIKKAWNEANIIEVSRRELEFLLDEDFYERKRNYRPQYYAENFEQTKNWRDYYH  381



>ref|XP_007133958.1| hypothetical protein PHAVU_010G006700g [Phaseolus vulgaris]
 gb|ESW05952.1| hypothetical protein PHAVU_010G006700g [Phaseolus vulgaris]
Length=470

 Score =   216 bits (550),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+APLWHDRLKFLFVTDGT+R+HYYTPSF+G VVGTEDVLITPFTCDRTGSGDA+VA I
Sbjct  351  EEIAPLWHDRLKFLFVTDGTIRIHYYTPSFDGSVVGTEDVLITPFTCDRTGSGDAIVAAI  410

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLTT PEMFENQDVLERQLRFA++AGII+QWTIGA+RGFPTESATQNLKE
Sbjct  411  LRKLTTCPEMFENQDVLERQLRFAVAAGIIAQWTIGAIRGFPTESATQNLKE  462


 Score =   189 bits (481),  Expect(2) = 4e-104, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLT PTM STLF+AI W++KFGGL+FFDLNLPL LW+SRDET E
Sbjct  234  NLAVLKEARIFHFNSEVLTCPTMESTLFRAIKWTRKFGGLVFFDLNLPLSLWRSRDETRE  293

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             IK AW +ADIIEVSRSELEFLLDE++YE KRNY+PQYFAE ++QT+ ++ YYH
Sbjct  294  RIKKAWNEADIIEVSRSELEFLLDEEYYERKRNYRPQYFAESYEQTKNLQEYYH  347



>ref|XP_006429264.1| hypothetical protein CICLE_v10011551mg [Citrus clementina]
 gb|ESR42504.1| hypothetical protein CICLE_v10011551mg [Citrus clementina]
Length=496

 Score =   217 bits (553),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  375  TREEISPLWHDGLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVA  434

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             I+RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAVRGFPTESATQNLKE
Sbjct  435  AILRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKE  488


 Score =   187 bits (476),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA+IFHFNSEVL SPTM STL KAI WSKKFGGLIFFDLNLPLPLWKSRDET E
Sbjct  260  NVPVLKEAKIFHFNSEVLMSPTMGSTLLKAIEWSKKFGGLIFFDLNLPLPLWKSRDETRE  319

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +AD+IEVSR ELEFLLDE+ YE KRNY PQY+AE ++QT+  R+YYH
Sbjct  320  LIKKAWNEADVIEVSRQELEFLLDEECYERKRNYVPQYYAESYEQTKNRRDYYH  373



>ref|XP_010039172.1| PREDICTED: fructokinase-1 [Eucalyptus grandis]
 gb|KCW49483.1| hypothetical protein EUGRSUZ_K03004 [Eucalyptus grandis]
Length=503

 Score =   213 bits (541),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD+LKF+FVTDGTLR+HYY P F+GVVVGTED LITPFTCDRTGSGDAVVA
Sbjct  382  TREEISPLWHDKLKFIFVTDGTLRIHYYAPEFDGVVVGTEDALITPFTCDRTGSGDAVVA  441

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             I+RKLTT PEMF NQDVLERQLRFA++AGIISQWTIGA+RGFPTESA QNLKE
Sbjct  442  AILRKLTTCPEMFNNQDVLERQLRFAVAAGIISQWTIGAIRGFPTESAAQNLKE  495


 Score =   192 bits (488),  Expect(2) = 8e-104, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHF SEVLTSP M+ TLF+AI WSKKFG LIFFDLN+PLPLW+SRDET E
Sbjct  267  NLAVLKEARIFHFTSEVLTSPLMNVTLFRAIKWSKKFGSLIFFDLNMPLPLWRSRDETRE  326

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW++A+IIEVSR ELEFLLDEDHYE KRNY+PQYFAE+F+QT+  R+YYH
Sbjct  327  MIKRAWDEAEIIEVSRQELEFLLDEDHYERKRNYRPQYFAENFEQTKDRRDYYH  380



>ref|XP_002876240.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52499.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=477

 Score =   212 bits (539),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EEV  LWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  358  EEVKSLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  417

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESATQNLKE
Sbjct  418  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKE  469


 Score =   193 bits (490),  Expect(2) = 9e-104, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLF AI WSKKFGGLIFFDLNLPLPLW+SR+ET  
Sbjct  241  NLAVLKEARIFHFNSEVLTSPTMQSTLFTAIQWSKKFGGLIFFDLNLPLPLWRSRNETRR  300

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +A+IIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYH
Sbjct  301  LIKKAWNEANIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYH  354



>ref|XP_006403618.1| hypothetical protein EUTSA_v10010328mg [Eutrema salsugineum]
 gb|ESQ45071.1| hypothetical protein EUTSA_v10010328mg [Eutrema salsugineum]
Length=481

 Score =   213 bits (542),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+ PLWH+ LK L VTDGTLRLHYYTPSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  362  EEIKPLWHEGLKLLVVTDGTLRLHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  421

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  422  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  473


 Score =   191 bits (485),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLF AI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  245  NLAVLKEARIFHFNSEVLTSPTMQSTLFMAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  304

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +A+IIEVS+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYH
Sbjct  305  LIKKAWNEANIIEVSQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYH  358



>ref|XP_008388106.1| PREDICTED: probable fructokinase-4 [Malus domestica]
 ref|XP_008350508.1| PREDICTED: probable fructokinase-4 [Malus domestica]
Length=499

 Score =   216 bits (550),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  380  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  439

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEM+E+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  440  MRKLTTHPEMYEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  491


 Score =   188 bits (477),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEAR+FHF SEVLTSP+M  TLF+A+S+SKKFGGL+FFDLNLPLPLWKSRDET +
Sbjct  263  NLAVLKEARMFHFTSEVLTSPSMRPTLFRAMSYSKKFGGLVFFDLNLPLPLWKSRDETRK  322

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             I+ AW QADIIEVSR ELEFLLDED+Y  KRNY+PQY+AE+F+QT+K R+YYH
Sbjct  323  YIERAWNQADIIEVSRQELEFLLDEDYYVRKRNYRPQYYAEEFEQTKKRRDYYH  376



>ref|NP_190977.1| fructokinase-like 1 [Arabidopsis thaliana]
 sp|Q9M394.1|SCKL1_ARATH RecName: Full=Fructokinase-like 1, chloroplastic; AltName: Full=PEP-associated 
protein 6; AltName: Full=pfkB-type carbohydrate 
kinase family protein 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB70983.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AAM13160.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AAM91217.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AEE79187.1| fructokinase-like 1 [Arabidopsis thaliana]
Length=471

 Score =   210 bits (534),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+  LWHD+LK L VTDGTLRLHYYTP+F+GVV+GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  352  EEIKSLWHDKLKLLVVTDGTLRLHYYTPTFDGVVIGTEDVLITPFTCDRTGSGDAVVAGI  411

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDV+ERQLRFA++AGII+QWTIGAVRGFPTESATQNLKE
Sbjct  412  MRKLTTCPEMFEDQDVMERQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKE  463


 Score =   192 bits (489),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSPTM STLF AI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  235  NLAVLKEARIFHFNSEVLTSPTMQSTLFTAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  294

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +A+IIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYH
Sbjct  295  LIKKAWNEANIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYH  348



>ref|XP_006480938.1| PREDICTED: probable fructokinase-4-like [Citrus sinensis]
Length=496

 Score =   217 bits (553),  Expect(2) = 7e-103, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  375  TREEISPLWHDGLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVA  434

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             I+RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAVRGFPTESATQNLKE
Sbjct  435  AILRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKE  488


 Score =   184 bits (467),  Expect(2) = 7e-103, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA+IFHFNSEVL SPTM STL KAI WSKKFGGLIFFDLNLPLPLWKSR ET E
Sbjct  260  NVPVLKEAKIFHFNSEVLMSPTMGSTLLKAIEWSKKFGGLIFFDLNLPLPLWKSRVETRE  319

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +AD+IEVSR ELEFLLDE+ YE KRNY PQY+AE ++QT+  R+YYH
Sbjct  320  LIKKAWNEADVIEVSRQELEFLLDEECYERKRNYVPQYYAESYEQTKNRRDYYH  373



>gb|KEH28950.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=462

 Score =   210 bits (535),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E+++PLWHD LKFLFVTDGT+R+HYYTPSF+GVVVGTEDVLITP+TCDRTGSGDA+VA I
Sbjct  343  EDISPLWHDGLKFLFVTDGTIRIHYYTPSFDGVVVGTEDVLITPYTCDRTGSGDAIVAAI  402

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIG VRGFPTESA QNLKE
Sbjct  403  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGGVRGFPTESAAQNLKE  454


 Score =   190 bits (483),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTS +M STLFKAI W KKFGGL+FFD+NLPLPLW+SRDET E
Sbjct  226  NLAVLKEARIFHFNSEVLTSLSMESTLFKAIKWFKKFGGLVFFDINLPLPLWRSRDETRE  285

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW++ADIIEVSR+ELEFLLDE+HYE KRNYKPQY+AE+++QT+  + YYH
Sbjct  286  IIKKAWQEADIIEVSRTELEFLLDEEHYERKRNYKPQYYAEEYEQTKNHQEYYH  339



>ref|XP_002527877.1| fructokinase, putative [Ricinus communis]
 gb|EEF34508.1| fructokinase, putative [Ricinus communis]
Length=500

 Score =   209 bits (533),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHD LK L VTDGTLR+HYYTPSF+G VVGTEDVLITPFTCDRTGSGDAVVA +
Sbjct  381  EEISPLWHDGLKLLAVTDGTLRIHYYTPSFDGAVVGTEDVLITPFTCDRTGSGDAVVAAM  440

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  441  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  492


 Score =   190 bits (483),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVLTSP+M  TLFKAI  SKK GGLIFFD NLPLP+W+SRDETWE
Sbjct  264  NLPVLKEARMFHFNSEVLTSPSMQPTLFKAIKLSKKSGGLIFFDPNLPLPMWRSRDETWE  323

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AW +ADIIEVSR ELEFLLDED+YE KRNYKPQY+AE ++QT+K R+YYH
Sbjct  324  VIKKAWNEADIIEVSRRELEFLLDEDYYEKKRNYKPQYYAESYEQTKKWRDYYH  377



>gb|ADI87415.1| fructokinase-like protein 1 [Citrus clementina]
Length=479

 Score =   217 bits (553),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  358  TREEISPLWHDGLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVA  417

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             I+RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAVRGFPTESATQNLKE
Sbjct  418  AILRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKE  471


 Score =   182 bits (462),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VL EA+IFHFNSEVL SPTM STL KAI WSKKFGGLIFFDLNLPLPLWKSR ET E
Sbjct  243  NVPVLXEAKIFHFNSEVLMSPTMGSTLLKAIEWSKKFGGLIFFDLNLPLPLWKSRVETRE  302

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +AD+IEVSR ELEFLLDE+ YE KRNY PQY+AE ++QT+  R+YYH
Sbjct  303  LIKKAWNEADVIEVSRQELEFLLDEECYERKRNYVPQYYAESYEQTKNRRDYYH  356



>ref|XP_007205056.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
 gb|EMJ06255.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
Length=510

 Score =   216 bits (551),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  391  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  450

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEM+ENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  451  MRKLTTCPEMYENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  502


 Score =   182 bits (461),  Expect(2) = 6e-102, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHF+SEVLTSP+M  TL +A+S+SKKFGGL+FFD+NLPLPLWKSRDET +
Sbjct  274  NLAVLKEARIFHFSSEVLTSPSMQLTLLRAMSYSKKFGGLVFFDVNLPLPLWKSRDETRK  333

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             ++ AW +ADIIEVSR ELEFLLDED+Y  KRNY+PQY+AE+F QT+K R+YYH
Sbjct  334  YMERAWNEADIIEVSRQELEFLLDEDYYVRKRNYRPQYYAEEFGQTKKRRDYYH  387



>ref|XP_009358825.1| PREDICTED: uncharacterized protein LOC103949435 [Pyrus x bretschneideri]
Length=655

 Score =   214 bits (545),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 108/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWH+ LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  536  EEISPLWHEGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  595

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEM+E+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  596  MRKLTTHPEMYEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  647


 Score =   183 bits (465),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEAR+FHF SEVLTSP+M  TLF+A+S+S+KFGGL+FFDLNLPLPLWKSRDET +
Sbjct  419  NLAVLKEARMFHFTSEVLTSPSMRPTLFRAMSYSQKFGGLVFFDLNLPLPLWKSRDETRK  478

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             I  AW QADIIEVSR ELEFLLDED+Y  KRN +PQY+AE+F+QT+K R+YYH
Sbjct  479  YIDRAWNQADIIEVSRQELEFLLDEDYYVRKRNSRPQYYAEEFEQTKKHRDYYH  532



>ref|XP_002273576.2| PREDICTED: fructokinase-like 1, chloroplastic [Vitis vinifera]
Length=485

 Score =   214 bits (544),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +R+E++PLWH+ LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDA+VA
Sbjct  364  TRDEISPLWHEGLKFLFVTDGTLRVHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAIVA  423

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEM+ENQD LERQLRFAI+AGIISQWTIG VRGFPTESA QNLKE
Sbjct  424  GIMRKLTTFPEMYENQDTLERQLRFAIAAGIISQWTIGGVRGFPTESAAQNLKE  477


 Score =   183 bits (464),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSP+MHS+LF AI  SKK GGL+FFDLNLPLPLW+SRDET +
Sbjct  249  NIAVLKEARIFHFNSEVLTSPSMHSSLFGAIELSKKHGGLVFFDLNLPLPLWRSRDETRK  308

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +I+ AW QADIIEVS+ ELEFLLDED+YE +RNY+PQY+++ ++QT+  R+YYH
Sbjct  309  LIEKAWNQADIIEVSKQELEFLLDEDYYEMRRNYRPQYYSDSYEQTKNRRDYYH  362



>ref|XP_004302649.2| PREDICTED: LOW QUALITY PROTEIN: fructokinase-like 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=647

 Score =   219 bits (557),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+APLWHD+LKFLFVTDGTLR+HYY+PSF+GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  528  EEIAPLWHDKLKFLFVTDGTLRIHYYSPSFDGVVIGTEDVLITPFTCDRTGSGDAVVAAI  587

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEM+ENQDV ERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  588  MRKLTTFPEMYENQDVCERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  639


 Score =   178 bits (451),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEAR+FHF SEVLTS  M   L++AI+++KKFGGL+FFDLNLPLPLWKSRDET E
Sbjct  411  NLAVLKEARMFHFTSEVLTSAPMQPALYRAIAYAKKFGGLVFFDLNLPLPLWKSRDETRE  470

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             IK AW +AD+IEVSR ELEFLLDE++Y  KRNY+PQY+A++++QT+K R+YYH
Sbjct  471  FIKKAWYEADVIEVSRQELEFLLDEEYYVRKRNYRPQYYAQEYEQTKKRRDYYH  524



>gb|KFK34655.1| hypothetical protein AALP_AA5G174200 [Arabis alpina]
Length=460

 Score =   209 bits (531),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+  LWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITP TCDRTGSGDAVVAGI
Sbjct  341  EEIKSLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPMTCDRTGSGDAVVAGI  400

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESATQNLKE
Sbjct  401  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKE  452


 Score =   185 bits (470),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNS VL SPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+ET +
Sbjct  224  NLAVLKEARIFHFNSAVLISPTMESTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNETRK  283

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +IK AW +A+IIE S+ ELEFLLDE++YE +RNY P+YFAEDF+QT+  R+YYH
Sbjct  284  LIKKAWNEANIIEASQQELEFLLDEEYYERRRNYTPEYFAEDFEQTKNRRDYYH  337



>ref|XP_008239829.1| PREDICTED: uncharacterized protein LOC103338406 [Prunus mume]
Length=661

 Score =   207 bits (526),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 106/119 (89%), Gaps = 4/119 (3%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  542  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  601

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE----PSL  10
            MRKLTT PEM+ENQDVLERQLRFA++A     WTIGAVRGFPTESATQNLKE    PSL
Sbjct  602  MRKLTTYPEMYENQDVLERQLRFAVAAXXXXXWTIGAVRGFPTESATQNLKEQVYVPSL  660


 Score =   186 bits (473),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHF+SEVLTSP+M STL +A+S+SKKFGGL+FFD+NLPLPLWKSRDET +
Sbjct  425  NLAVLKEARIFHFSSEVLTSPSMQSTLLRAMSYSKKFGGLVFFDVNLPLPLWKSRDETRK  484

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             ++ AW +ADIIEVSR ELEFLLDED+Y  KRNY+PQY+AE+F+QT+K R+YYH
Sbjct  485  YMERAWNEADIIEVSRQELEFLLDEDYYVRKRNYRPQYYAEEFEQTKKRRDYYH  538



>ref|XP_004137741.1| PREDICTED: fructokinase-2-like [Cucumis sativus]
 gb|KGN58805.1| hypothetical protein Csa_3G732620 [Cucumis sativus]
Length=511

 Score =   217 bits (553),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHDRLK LFVTDGTLR+HYY+PSF GV +GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  392  EELSPLWHDRLKLLFVTDGTLRIHYYSPSFHGVAIGTEDVLITPFTCDRTGSGDAVVAGI  451

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEM ENQDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  452  MRKLTTFPEMLENQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  503


 Score =   175 bits (443),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSE L S  +  TLFKAI  SKKFGGLIFFDLNLPLPLWKSRDET E
Sbjct  275  NLAVLKEARIFHFNSESLLSTAIEPTLFKAIQLSKKFGGLIFFDLNLPLPLWKSRDETRE  334

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             IK AW++ADIIEVSR ELEFLLDE++YE KRNY+PQY+A+  +QT+  R++YH
Sbjct  335  YIKKAWKEADIIEVSRQELEFLLDEEYYEKKRNYRPQYYAQTIEQTKNRRDHYH  388



>ref|XP_008442480.1| PREDICTED: uncharacterized protein LOC103486334 [Cucumis melo]
Length=662

 Score =   217 bits (552),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHD LK LFVTDGTLR+HYY+PSF GV +GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  543  EEISPLWHDHLKLLFVTDGTLRIHYYSPSFHGVAIGTEDVLITPFTCDRTGSGDAVVAGI  602

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEM ENQDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  603  MRKLTTFPEMLENQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  654


 Score =   175 bits (444),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSE L S  +  TLFKAI  SKKFGGLIFFDLNLPLPLWKSR+ET E
Sbjct  426  NLAVLKEARIFHFNSEALLSTVIEPTLFKAIQLSKKFGGLIFFDLNLPLPLWKSREETRE  485

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             IK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+A+  +QT+  R++YH
Sbjct  486  YIKKAWNEADIIEVSRQELEFLLDEEYYEKKRNYRPQYYAQTIEQTKNRRDHYH  539



>ref|XP_010101836.1| hypothetical protein L484_023626 [Morus notabilis]
 gb|EXB89973.1| hypothetical protein L484_023626 [Morus notabilis]
Length=519

 Score =   212 bits (539),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGTLR+H+Y+P+F+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  398  TREEISPLWHDGLKFLFVTDGTLRIHFYSPTFDGVVVGTEDVLITPFTCDRTGSGDAVVA  457

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             IMRKLTT PEM+E+ DVLERQLRFAI+AGIISQWTIG VRGFPTESATQNLKE
Sbjct  458  AIMRKLTTCPEMYEDVDVLERQLRFAIAAGIISQWTIGGVRGFPTESATQNLKE  511


 Score =   179 bits (455),  Expect(2) = 8e-100, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEAR+F+F SEVLTSP+M  TLFKAI++SKKFGGL+FFD NLPLPLWKSRDET E
Sbjct  283  NLAVLKEARMFYFTSEVLTSPSMKRTLFKAIAYSKKFGGLLFFDPNLPLPLWKSRDETRE  342

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             IK AW +A+IIEV+R ELEFLLDE++YE KRNY+PQY+A++++QT+  R+YYH
Sbjct  343  FIKRAWNEANIIEVTRQELEFLLDEEYYERKRNYRPQYYAQNYEQTKNRRDYYH  396



>ref|XP_004156589.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-2-like [Cucumis 
sativus]
Length=511

 Score =   217 bits (552),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHDRLK LFVTDGTLR+HYY+PSF GV +GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  392  EELSPLWHDRLKLLFVTDGTLRIHYYSPSFHGVAIGTEDVLITPFTCDRTGSGDAVVAGI  451

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKLTT PEM ENQDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  452  MRKLTTFPEMLENQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  503


 Score =   173 bits (438),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSE L S  +  TLFKAI  SKKFGGLIFFDLNLPLPLWKSRDET E
Sbjct  275  NLAVLKEARIFHFNSESLLSTAIEPTLFKAIQLSKKFGGLIFFDLNLPLPLWKSRDETRE  334

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             IK AW++ADIIEVSR ELEFLLDE++YE  RNY+PQY+A+  +QT+  R++YH
Sbjct  335  YIKKAWKEADIIEVSRQELEFLLDEEYYEKXRNYRPQYYAQTIEQTKNRRDHYH  388



>gb|ADI87419.1| fructokinase-like protein 1 [Euphorbia esula]
Length=427

 Score =   197 bits (500),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++PLWHD LK L VTDGT+R+HYYTPSF+GVVVGTEDVLITPFTCDRTGSGDAVVA +
Sbjct  321  EEISPLWHDGLKLLIVTDGTIRIHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAAV  380

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESAT  34
            MRKLT  PEMF++QD+LERQLRFA++AGII+QWTIGAVRGFPTESAT
Sbjct  381  MRKLTICPEMFDDQDILERQLRFAVAAGIIAQWTIGAVRGFPTESAT  427


 Score =   189 bits (479),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTS +M STLF+AI  SKKFGGL FFDLNLPLPLW SRDETW+
Sbjct  204  NLAVLKEARIFHFNSEVLTSLSMQSTLFRAIKLSKKFGGLTFFDLNLPLPLWISRDETWK  263

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VI+ AW+ AD+IEVSR ELEFL+DEDHYE +RNY+PQY+AE +++T+K RNYYH
Sbjct  264  VIRKAWDVADVIEVSRRELEFLIDEDHYERQRNYRPQYYAESYEKTKKWRNYYH  317



>gb|ADI87418.1| fructokinase-like protein 1 [Lactuca sativa]
Length=469

 Score =   211 bits (538),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +++E+APLWHD+LKFLFVTDGTLRLHYY P F+GVVVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  348  TKDEIAPLWHDKLKFLFVTDGTLRLHYYAPDFDGVVVGTEDVLITPFTCDRTGSGDAVVA  407

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GI+RKLT+ PEM+ NQDVL RQLRFAI+AGIISQWTIG VRGFPTESATQNLKE
Sbjct  408  GILRKLTSFPEMYWNQDVLGRQLRFAIAAGIISQWTIGDVRGFPTESATQNLKE  461


 Score =   169 bits (429),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N +VLKEAR+FHFNSEVL S +M S+LFKAISWSKKFG LIFFD+NLPLPLWKSR ET +
Sbjct  232  NLSVLKEARMFHFNSEVLLSESMKSSLFKAISWSKKFGSLIFFDMNLPLPLWKSRHETRK  291

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTR-KIRNYYH  362
            VIK +WEQADIIEVS+ ELEFLLDE ++E +RNY+PQY+AE  Q+T+   +++YH
Sbjct  292  VIKDSWEQADIIEVSKQELEFLLDEHYHEQRRNYQPQYYAESHQETKDNTKDFYH  346



>ref|XP_010928949.1| PREDICTED: fructokinase-like 1, chloroplastic [Elaeis guineensis]
Length=519

 Score =   208 bits (529),  Expect(2) = 4e-95, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+APLWHD +K LFVTDGTLR+HYYT  F+G VVGTEDVLITP+TCDRTGSGDAVVA
Sbjct  398  TREEIAPLWHDGIKILFVTDGTLRIHYYTSKFDGAVVGTEDVLITPYTCDRTGSGDAVVA  457

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             IMRKLT  PEM+E+QD+LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  458  AIMRKLTIHPEMYEDQDLLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  511


 Score =   167 bits (424),  Expect(2) = 4e-95, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHF+S VL +P MHS LF+AI+ SKK+   +FFDLNLPLPLWKSR+ET E
Sbjct  283  NVAVLKEARIFHFSSGVLLAPNMHSALFRAIALSKKYHSNVFFDLNLPLPLWKSREETRE  342

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VIK AW +AD IEVSR ELEFLLDE++YE KR+Y+PQY++E ++QT+  R+YYH
Sbjct  343  VIKKAWSKADFIEVSRQELEFLLDEEYYEKKRSYRPQYYSESYEQTKNRRDYYH  396



>ref|XP_011009152.1| PREDICTED: fructokinase-like 1, chloroplastic [Populus euphratica]
Length=485

 Score =   209 bits (531),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+APLWHD LKFLFVTDGTL +HYY P+F+G V GTEDVLITPFTCDRTGSGDA+VA
Sbjct  364  TREEIAPLWHDGLKFLFVTDGTLEIHYYGPNFDGKVTGTEDVLITPFTCDRTGSGDAIVA  423

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             +MRKLTT PEMFE+QDV ERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  424  ALMRKLTTCPEMFEDQDVCERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  477


 Score =   165 bits (418),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  688  KEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGA  509
            KEAR+FHFNSE LTSP++ STL KAI  SKK GGLIF+DLNLPLPLWKSR+ET EVIK A
Sbjct  254  KEARMFHFNSEALTSPSLQSTLLKAIRLSKKSGGLIFYDLNLPLPLWKSRNETREVIKKA  313

Query  508  WEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             ++A+ IEVSR+ELEFLLDE++YE KRNY+PQY+AE ++QT+  R+ YH
Sbjct  314  MKEANFIEVSRTELEFLLDEEYYERKRNYRPQYYAESYEQTKNWRDCYH  362



>ref|XP_008798949.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713712 
[Phoenix dactylifera]
Length=665

 Score =   204 bits (519),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+APLWHD +K LFVTDGTLR+HYYTP F+G VVGTEDVLITP+TCDRTGSGDAVVA
Sbjct  544  TREEIAPLWHDGIKILFVTDGTLRIHYYTPKFDGAVVGTEDVLITPYTCDRTGSGDAVVA  603

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             IMRKL    EM E+QD+LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  604  AIMRKLAIHLEMCEDQDLLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  657


 Score =   170 bits (430),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            + AVLKEARIFHF+S VL +PTMHS LF+AI+ SKK+   +FFDLNLPLPLW SR+ETWE
Sbjct  429  DVAVLKEARIFHFSSGVLLTPTMHSALFRAIALSKKYSSNVFFDLNLPLPLWSSREETWE  488

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VI  AW +AD+IEVSR ELEFLLDE++YE KRNY+PQY+ E ++QT+  R+ +H
Sbjct  489  VINKAWSKADLIEVSRQELEFLLDEEYYEKKRNYRPQYYCESYEQTKNRRDCHH  542



>gb|EPS61748.1| fructokinase-like protein 1, partial [Genlisea aurea]
Length=407

 Score =   204 bits (520),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +R+E+APLWHD LK +FVTDGTLR+HYY+P+F+GVVVGTEDVLITP+TCDRTGSGDA+VA
Sbjct  286  TRDEIAPLWHDGLKLMFVTDGTLRVHYYSPAFDGVVVGTEDVLITPYTCDRTGSGDALVA  345

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKL   PEMFE++DVL+RQ+RFAI+AGIISQWTIG VRGFP+ESA QNLKE
Sbjct  346  GIMRKLADHPEMFEDEDVLQRQVRFAIAAGIISQWTIGGVRGFPSESAAQNLKE  399


 Score =   167 bits (423),  Expect(2) = 6e-94, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVL-TSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETW  527
            N AVLKEA+IFHFNSEVL TSP+M   LFKAI+ SK FGGL+FFD NLPLPLWKSRDET 
Sbjct  170  NLAVLKEAKIFHFNSEVLLTSPSMLRCLFKAIAASKHFGGLVFFDPNLPLPLWKSRDETR  229

Query  526  EVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            E IK AW +A+I+EVSR ELEFLLDE+ YE  R+++PQY+AE + QTRK RN +H
Sbjct  230  EAIKRAWREANIVEVSRPELEFLLDEERYERMRSHRPQYYAESYDQTRKRRNCHH  284



>ref|XP_002322950.1| hypothetical protein POPTR_0016s11690g [Populus trichocarpa]
 gb|EEF04711.1| hypothetical protein POPTR_0016s11690g [Populus trichocarpa]
Length=485

 Score =   208 bits (530),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+APLWHD LKFLFVTDGTL +HYY P F+G V GTEDVLITPFTCDRTGSGDA+VA
Sbjct  364  TREEIAPLWHDGLKFLFVTDGTLEIHYYGPKFDGKVTGTEDVLITPFTCDRTGSGDAIVA  423

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             +MRKLTT PEMFE+QDV ERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  424  ALMRKLTTCPEMFEDQDVCERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  477


 Score =   163 bits (412),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -1

Query  688  KEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGA  509
            KEAR+FHFNSE LTSP++ STLF+AI  SKK GGLIF+DLNLPLPLWKSR+ET EVIK A
Sbjct  254  KEARMFHFNSEALTSPSLQSTLFEAIRLSKKSGGLIFYDLNLPLPLWKSRNETREVIKKA  313

Query  508  WEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             ++AD IEVSR+ELEFLLDE+ YE KRN  PQY+AE ++QT+  R+ YH
Sbjct  314  MKEADFIEVSRTELEFLLDEECYERKRNCSPQYYAESYEQTKNWRDCYH  362



>ref|XP_009421323.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   211 bits (536),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +R+E+APLWHD LK LFVTDGTLR+HYYTP F+G VVGTEDVLITPFTCDRTGSGDAVVA
Sbjct  407  TRKEIAPLWHDGLKILFVTDGTLRIHYYTPKFDGAVVGTEDVLITPFTCDRTGSGDAVVA  466

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
             IMRKLT  PEM+E+QD+LER LRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  467  AIMRKLTIHPEMYEDQDMLERHLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  520


 Score =   159 bits (402),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            + AVLKEARIFHFNSEVL SP M   LF AI  SKK+   +FFDLNLPL LW+SRDET E
Sbjct  292  DVAVLKEARIFHFNSEVLLSPAMQPALFWAIKLSKKYNSNVFFDLNLPLSLWRSRDETRE  351

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VI  AW  +D+IEVSR E+EFLLDE++YE KRNY+PQY++E ++QT+  R+Y+H
Sbjct  352  VINKAWSNSDLIEVSRQEMEFLLDEEYYERKRNYRPQYYSESYEQTKNRRDYHH  405



>ref|XP_006848050.1| hypothetical protein AMTR_s00029p00193780 [Amborella trichopoda]
 gb|ERN09631.1| hypothetical protein AMTR_s00029p00193780 [Amborella trichopoda]
Length=215

 Score =   220 bits (560),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE+APLWHD +K LFVTDGT R+HYYTPSF+G V+GTEDVL+TPFTCDRTGSGDAVVA
Sbjct  94   TREEIAPLWHDNIKILFVTDGTFRIHYYTPSFDGAVIGTEDVLLTPFTCDRTGSGDAVVA  153

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEM+ENQD+LERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  154  GIMRKLTTHPEMYENQDILERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKE  207


 Score =   147 bits (371),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  637  MHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGAWEQADIIEVSRSELEFL  458
            MHS LF+AI  SKK+GGLIFFDLNLPLPLW+SRDET + I+ AW QA+IIE+++ ELEFL
Sbjct  1    MHSALFRAIQLSKKYGGLIFFDLNLPLPLWRSRDETRKAIQEAWNQANIIELTKQELEFL  60

Query  457  LDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            LDED+YE KR YKPQY+AE +QQTRK RN+YH
Sbjct  61   LDEDYYERKREYKPQYYAESYQQTRKQRNHYH  92



>emb|CBI30446.3| unnamed protein product [Vitis vinifera]
Length=674

 Score =   214 bits (545),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +R+E++PLWH+ LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDA+VA
Sbjct  552  TRDEISPLWHEGLKFLFVTDGTLRVHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAIVA  611

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            GIMRKLTT PEM+ENQD LERQLRFAI+AGIISQWTIG VRGFPTESA QNLKE
Sbjct  612  GIMRKLTTFPEMYENQDTLERQLRFAIAAGIISQWTIGGVRGFPTESAAQNLKE  665


 Score =   148 bits (374),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 87/114 (76%), Gaps = 16/114 (14%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEARIFHFNSEVLTSP+MHS+LF AI  SKK GGL+FFDLNLPLPLW+SRDET +
Sbjct  453  NIAVLKEARIFHFNSEVLTSPSMHSSLFGAIELSKKHGGLVFFDLNLPLPLWRSRDETRK  512

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +I+ AW QADIIE+                +RNY+PQY+++ ++QT+  R+YYH
Sbjct  513  LIEKAWNQADIIEM----------------RRNYRPQYYSDSYEQTKNRRDYYH  550



>ref|NP_001147575.1| protein kinase [Zea mays]
 gb|ACG27971.1| protein kinase [Zea mays]
Length=521

 Score =   192 bits (487),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDA+VA
Sbjct  400  SPEEIAPIWHDGIKILLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAIVA  459

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
              +RKLTT PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  460  AAIRKLTTCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  513


 Score =   158 bits (400),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW S+D+T E
Sbjct  285  NVDVLKEARMFHFNSEVLLNPSMHDTLFRAIELSKKFGSKVFFDLNLPLPLWTSKDKTKE  344

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VI  AW++A+IIEVSR ELEFLLD ++YE+KRN  PQY+ E F  TR    YYH
Sbjct  345  VINRAWKEAEIIEVSRDELEFLLDHEYYEYKRNTPPQYYLEGFHFTRNWPQYYH  398



>tpg|DAA56815.1| TPA: protein kinase [Zea mays]
Length=521

 Score =   192 bits (487),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDA+VA
Sbjct  400  SPEEIAPIWHDGIKILLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAIVA  459

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
              +RKLTT PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  460  AAIRKLTTCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKE  513


 Score =   158 bits (400),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW S+D+T E
Sbjct  285  NVDVLKEARMFHFNSEVLLNPSMHDTLFRAIELSKKFGSKVFFDLNLPLPLWTSKDKTKE  344

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VI  AW++A+IIEVSR ELEFLLD ++YE+KRN  PQY+ E F  TR    YYH
Sbjct  345  VINRAWKEAEIIEVSRDELEFLLDHEYYEYKRNTPPQYYLEGFHFTRNWPQYYH  398



>ref|XP_002456644.1| hypothetical protein SORBIDRAFT_03g040010 [Sorghum bicolor]
 gb|EES01764.1| hypothetical protein SORBIDRAFT_03g040010 [Sorghum bicolor]
Length=524

 Score =   190 bits (483),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDA+VA
Sbjct  403  SPEEIAPIWHDGIKILLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAIVA  462

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
              +RKLTT PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESA QNLKE
Sbjct  463  AAIRKLTTCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESAAQNLKE  516


 Score =   159 bits (403),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHF+SEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW SRD+T E
Sbjct  288  NVDVLKEARMFHFSSEVLLNPSMHDTLFRAIELSKKFGSKVFFDLNLPLPLWTSRDKTKE  347

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VI  AW++ADIIEVSR ELEFLLD ++YE+KRN  PQY+ E F  TR    YYH
Sbjct  348  VINRAWKEADIIEVSRDELEFLLDHEYYEYKRNTPPQYYLEGFHFTRNWPQYYH  401



>gb|EMS45106.1| hypothetical protein TRIUR3_04898 [Triticum urartu]
Length=295

 Score =   188 bits (477),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  
Sbjct  176  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAA  235

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  236  IRKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKE  287


 Score =   157 bits (397),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+ HFNSEVL +P+MH TLF+AI+ SKKFG  IFFDLNLPLPLW+SRDET E
Sbjct  59   NADVLKEARMLHFNSEVLLTPSMHDTLFRAIALSKKFGSKIFFDLNLPLPLWRSRDETKE  118

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             I  AW++ADIIEVSR ELEFLLD  +YE+KR   PQY+ + F  TR    YYH
Sbjct  119  FINRAWKEADIIEVSRDELEFLLDHKYYEYKRATPPQYYLDGFHLTRNWPQYYH  172



>ref|XP_004970597.1| PREDICTED: fructokinase-2-like [Setaria italica]
Length=528

 Score =   187 bits (476),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDAVVA
Sbjct  407  SPEEIAPIWHDGIKVLLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAVVA  466

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
              +RKL T PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESA QNLKE
Sbjct  467  AAIRKLITCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESAAQNLKE  520


 Score =   157 bits (397),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHF+SEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW SRDET E
Sbjct  292  NVDVLKEARMFHFSSEVLLNPSMHDTLFRAIEMSKKFGSKVFFDLNLPLPLWTSRDETKE  351

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            VI  AW++ADIIE+SR ELEFLLD ++YE+KR   PQY+ E F  TR    YYH
Sbjct  352  VINRAWKEADIIELSRDELEFLLDHEYYEYKRRTPPQYYLEGFHFTRNWPQYYH  405



>ref|NP_001044818.1| Os01g0851000 [Oryza sativa Japonica Group]
 dbj|BAD82650.1| putative fructokinase [Oryza sativa Japonica Group]
 dbj|BAF06732.1| Os01g0851000 [Oryza sativa Japonica Group]
 dbj|BAG89476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score =   186 bits (473),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+AP+WHD +K L VT GTLR+HYYTP F G V+GTED LITP+T DRTGSGDAVVA  
Sbjct  412  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVIGTEDALITPYTTDRTGSGDAVVAAA  471

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLT+ PEM+E+QD LER LRFA++AGIISQWTIGAVRGFPTESA QNLKE
Sbjct  472  IRKLTSCPEMYEDQDTLERNLRFAVAAGIISQWTIGAVRGFPTESAAQNLKE  523


 Score =   158 bits (400),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVL +P+M STLF+AI  SKKFG  IFFDLNLPLPLW+SRDET E
Sbjct  295  NVDVLKEARVFHFNSEVLLTPSMESTLFRAIELSKKFGSKIFFDLNLPLPLWRSRDETKE  354

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +I  AW +ADIIEVSR ELEFLLD ++Y++KR   PQY+ + F  TR    YYH
Sbjct  355  LINKAWNEADIIEVSRDELEFLLDHEYYQYKRANPPQYYLDGFHLTRNWPQYYH  408



>emb|CBH32521.1| protein kinase, putative, expressed [Triticum aestivum]
 emb|CDM85037.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  
Sbjct  405  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAA  464

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  465  IRKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKE  516


 Score =   156 bits (395),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++ HFNSEVL +P+MH TLF+ I  SKKFG  IFFDLNLPLPLW+SRDET E
Sbjct  288  NADVLKEAKMLHFNSEVLLTPSMHGTLFRTIELSKKFGSKIFFDLNLPLPLWRSRDETKE  347

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             I  AW +ADIIEVSR ELEFLLD  +YEHKR   PQY+ + F  TR    YYH
Sbjct  348  FINRAWREADIIEVSRDELEFLLDHKYYEHKRATPPQYYLDGFHLTRNWPQYYH  401



>gb|EEE55679.1| hypothetical protein OsJ_04093 [Oryza sativa Japonica Group]
Length=590

 Score =   186 bits (471),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+AP+WHD +K L VT GTLR+HYYTP F G V+GTED LITP+T DRTGSGDAVVA  
Sbjct  410  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVIGTEDALITPYTTDRTGSGDAVVAAA  469

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLT+ PEM+E+QD LER LRFA++AGIISQWTIGAVRGFPTESA QNLKE
Sbjct  470  IRKLTSCPEMYEDQDTLERNLRFAVAAGIISQWTIGAVRGFPTESAAQNLKE  521


 Score =   158 bits (399),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVL +P+M STLF+AI  SKKFG  IFFDLNLPLPLW+SRDET E
Sbjct  293  NVDVLKEARVFHFNSEVLLTPSMESTLFRAIELSKKFGSKIFFDLNLPLPLWRSRDETKE  352

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
            +I  AW +ADIIEVSR ELEFLLD ++Y++KR   PQY+ + F  TR    YYH
Sbjct  353  LINKAWNEADIIEVSRDELEFLLDHEYYQYKRANPPQYYLDGFHLTRNWPQYYH  406



>gb|EMT01230.1| hypothetical protein F775_26429 [Aegilops tauschii]
Length=295

 Score =   187 bits (476),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  
Sbjct  176  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAA  235

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  236  IRKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKE  287


 Score =   153 bits (387),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++ HFNSEVL +P+MH TLF+ I  SKKFG  IFFDLNLPLPLW+SRDET E
Sbjct  59   NADVLKEAKMLHFNSEVLLTPSMHDTLFRTIELSKKFGSKIFFDLNLPLPLWRSRDETKE  118

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             I  AW++ADIIEVSR ELEFLLD  +YE+KR   PQY+ + F  TR    YYH
Sbjct  119  FINRAWKEADIIEVSRDELEFLLDHKYYEYKRATPPQYYLDGFHLTRNWPQYYH  172



>ref|XP_003564619.1| PREDICTED: fructokinase-like 1, chloroplastic [Brachypodium distachyon]
Length=526

 Score =   184 bits (468),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+AP+WHDR+K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  
Sbjct  407  EEIAPIWHDRIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAA  466

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKL   PEMFE+QD LER LRFA++AGIISQWTIGAVRGFPTESA QNLKE
Sbjct  467  IRKLIACPEMFEDQDTLERGLRFAVAAGIISQWTIGAVRGFPTESAAQNLKE  518


 Score =   156 bits (394),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+ HFNSEVL +P+MH+TLF+ I  SKKFG  IFFDLNLPLPLW+SRDET E
Sbjct  290  NADVLKEARMLHFNSEVLLTPSMHNTLFRTIELSKKFGSKIFFDLNLPLPLWRSRDETKE  349

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             I  AW +ADIIEVSR ELEFLLD+ +YE+KR   PQY+ + F  TR    YYH
Sbjct  350  FINRAWNEADIIEVSRDELEFLLDQKYYEYKRATPPQYYLDGFHLTRNWPQYYH  403



>dbj|BAJ87729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   187 bits (476),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  
Sbjct  401  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAA  460

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKE
Sbjct  461  IRKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKE  512


 Score =   151 bits (381),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            VLKEA++ HFNSEVL +PTM  TLF++I  SKKFG  IFFDLNLPLPLW+SRDET E I 
Sbjct  287  VLKEAKMLHFNSEVLLTPTMQDTLFRSIELSKKFGSKIFFDLNLPLPLWRSRDETKEFIN  346

Query  514  GAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  362
             AW++ADIIE+SR ELEFLLD ++YE+KR   PQY+ + F  TR    YYH
Sbjct  347  RAWKEADIIELSRDELEFLLDHEYYEYKRATPPQYYLDGFHLTRNWPQYYH  397



>ref|XP_002973268.1| hypothetical protein SELMODRAFT_54157, partial [Selaginella moellendorffii]
 gb|EFJ25642.1| hypothetical protein SELMODRAFT_54157, partial [Selaginella moellendorffii]
Length=382

 Score =   175 bits (444),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E++AP+W D +K LFVTDGT R+HYYTP F G VVGTEDV+++ F+CDRTGSGD + A I
Sbjct  268  EQIAPIWRDNIKILFVTDGTYRIHYYTPKFHGDVVGTEDVIVSAFSCDRTGSGDTISAAI  327

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKL  QP++FE+QD LER LRF ++AG+ISQWTIGAVRG PTESA QNL E
Sbjct  328  IRKLVAQPDIFEDQDRLERALRFVVAAGVISQWTIGAVRGLPTESAAQNLTE  379


 Score =   106 bits (265),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +LKEA++FHF+S  LT+  M STL  AI  ++ FG LIFFD+N PLP W SRD TWE
Sbjct  149  NMDILKEAKLFHFSSISLTTEKMCSTLMSAIDAARGFGSLIFFDVNFPLPFWISRDATWE  208

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFA--EDFQQTRKIRNYYH  362
             I+ AW  +DII++++ ELEFL++++    +   K    +  E+FQ  +  R  YH
Sbjct  209  AIEKAWTSSDIIKINKVELEFLIEDEGLAMRLLAKDSIASSWEEFQARKNQRFEYH  264



>ref|XP_002986741.1| hypothetical protein SELMODRAFT_44136, partial [Selaginella moellendorffii]
 gb|EFJ12304.1| hypothetical protein SELMODRAFT_44136, partial [Selaginella moellendorffii]
Length=382

 Score =   175 bits (444),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E++AP+W D +K LFVTDGT R+HYYTP F G VVGTEDV+++ F+CDRTGSGD + A I
Sbjct  268  EQIAPIWRDNIKILFVTDGTYRIHYYTPKFHGDVVGTEDVIVSAFSCDRTGSGDTISAAI  327

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKL  QP++FE+QD LER LRF ++AG+ISQWTIGAVRG PTESA QNL E
Sbjct  328  IRKLVAQPDIFEDQDRLERALRFVVAAGVISQWTIGAVRGLPTESAAQNLTE  379


 Score =   104 bits (260),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 75/116 (65%), Gaps = 2/116 (2%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +LKEA++FHF+S  LT+  M STL  AI  ++ FG LIFFD+N PLP W SR+ TWE
Sbjct  149  NMDILKEAKLFHFSSISLTTEKMCSTLMSAIDAARGFGSLIFFDVNFPLPFWISREATWE  208

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFA--EDFQQTRKIRNYYH  362
             I+ AW  +DII++++ ELEFL++++    +   K    +  E+FQ  +  R  YH
Sbjct  209  AIEKAWTSSDIIKINKVELEFLIEDEGLAMRLLAKDSIASSWEEFQARKNQRFEYH  264



>ref|XP_010675364.1| PREDICTED: cytochrome P450 81D1-like [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            +REE++PLWHD LKFLFVTDGT R+HYYT SF+GVVVGTEDVLITPFTCDRTGSGDA+VA
Sbjct  52   TREEISPLWHDGLKFLFVTDGTFRIHYYTSSFDGVVVGTEDVLITPFTCDRTGSGDAIVA  111

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPS  13
            GIMRKLT+ PEM+E++DVLERQLRFAI+AGIISQW IGAVRGFPTESATQNLKE +
Sbjct  112  GIMRKLTSHPEMYEDRDVLERQLRFAIAAGIISQWAIGAVRGFPTESATQNLKEQT  167



>ref|XP_001774794.1| predicted protein [Physcomitrella patens]
 gb|EDQ60335.1| predicted protein, partial [Physcomitrella patens]
Length=390

 Score =   167 bits (422),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 94/115 (82%), Gaps = 3/115 (3%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++ LWH  +K LFVTDGT R+HYYTP F G + GTEDVL+TPFTCDRTGSGDA+VA I
Sbjct  264  EELSHLWHKDMKILFVTDGTWRIHYYTPLFHGSIHGTEDVLLTPFTCDRTGSGDAIVAAI  323

Query  174  MRKLTTQPEMFE---NQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RKLTTQP++ E   ++D L++ LRFA+ AGIISQWT GA+ GFP+ESA QNL E
Sbjct  324  IRKLTTQPQLLEGNLDEDKLQKALRFAVCAGIISQWTKGAIDGFPSESAAQNLTE  378


 Score =   105 bits (263),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 74/116 (64%), Gaps = 2/116 (2%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +LKEAR+F F S  L    + STL  +I  +++ G  IFFD+NLPLP WK R+ TW 
Sbjct  145  NLDILKEARMFQFTSISLMQQPISSTLMTSIDTAREGGAEIFFDVNLPLPYWKDRETTWS  204

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKI--RNYYH  362
             I+ AW+++ I+EV++ ELEFLL E  YE KR  K  YF++   + +++  R  YH
Sbjct  205  TIQNAWKKSTIVEVTKQELEFLLGEALYEKKRARKSVYFSKSVDEMKQLTGREEYH  260



>ref|XP_009358994.1| PREDICTED: fructokinase-2-like [Pyrus x bretschneideri]
Length=245

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            EE++ LWH  LKFLFVTDGTL +HYY+PSF GVV+GTE VLITPFTCDR GS D  VA I
Sbjct  128  EEISSLWHKGLKFLFVTDGTLPIHYYSPSFHGVVIGTEAVLITPFTCDRAGSRD--VAAI  185

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            MRKL T PEM+E+QDVLER+LRFA++AGIISQW IGAVRGFPTESATQNLKE
Sbjct  186  MRKLRTHPEMYEDQDVLERELRFAVAAGIISQWRIGAVRGFPTESATQNLKE  237


 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (74%), Gaps = 4/136 (3%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
             L +AR+FHF SEVLT P+M  TLF A+S+SKKFGGL+FFD+NL L LWKSRDET + I 
Sbjct  16   ALMQARVFHFTSEVLTPPSMRPTLFTAMSYSKKFGGLVFFDVNLSLHLWKSRDETRKYID  75

Query  514  GAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-H*PGRSSSI  338
             AW +ADII+ SR ELEFLLDE++Y  KRNY   Y+AE+F+QT+K R+YY + P   SS+
Sbjct  76   RAWNEADIIKFSRQELEFLLDEENYARKRNY--YYYAEEFEQTKKRRDYYLYTPEEISSL  133

Query  337  MA*SFE-VFVRDGWNP  293
                 + +FV DG  P
Sbjct  134  WHKGLKFLFVTDGTLP  149



>gb|KHN44929.1| Fructokinase-2 [Glycine soja]
Length=557

 Score =   131 bits (330),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V+PLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFTCD + +GD +VA +
Sbjct  423  EVVSPLWHENLKVLFVTNGTSKIHYYTKELDGAVLGMEDAPITPFTCDMSATGDGIVAAL  482

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            MR LT QP++  ++  LE  +++AI  G+I QW +G VRGFP
Sbjct  483  MRMLTVQPDLLTDKGYLEHSIKYAIDCGVIDQWILGRVRGFP  524


 Score = 98.6 bits (244),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  SK FGG+IF+DLNLP+PLW S +ET  
Sbjct  317  NFDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVIFYDLNLPIPLWHSSEETMM  376

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+ AW  ADIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  377  FIQQAWNLADIIEVTKQELEFLCGITPSEEFDTKNNARSKFV  418



>ref|XP_006573158.1| PREDICTED: putative fructokinase-5-like [Glycine max]
Length=573

 Score =   131 bits (329),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V+PLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFTCD + +GD +VA +
Sbjct  439  EVVSPLWHENLKVLFVTNGTSKIHYYTKELDGAVLGMEDAPITPFTCDMSATGDGIVAAL  498

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            MR LT QP++  ++  LE  +++AI  G+I QW +G VRGFP
Sbjct  499  MRMLTVQPDLLTDKGYLEHSIKYAIDCGVIDQWILGRVRGFP  540


 Score = 98.2 bits (243),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 67/101 (66%), Gaps = 3/101 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  SK FGG+IF+DLNLP+PLW S +ET  
Sbjct  333  NFDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVIFYDLNLPIPLWHSSEETMM  392

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQY  410
             I+ AW  ADIIEV++ ELEFL      + ++ K N + ++
Sbjct  393  FIQQAWNLADIIEVTKQELEFLCGITPSEEFDTKNNARSKF  433



>ref|XP_004490214.1| PREDICTED: uncharacterized protein LOC101493906 [Cicer arietinum]
Length=577

 Score =   135 bits (339),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT   +G V G ED  ITPFTCD + SGD +VA I
Sbjct  445  EVIAPLWHENLKVLFVTNGTSKIHYYTAELDGAVSGMEDPPITPFTCDMSASGDGIVAAI  504

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR LT QP++  ++  LE  +++AI  G+I QW +G VRGFP +  T+++
Sbjct  505  MRMLTVQPDLITDKGYLEHSIKYAIDCGVIDQWILGRVRGFPPQEDTEDI  554


 Score = 92.8 bits (229),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  +K FG ++F+D+NLP+PLW S++ET  
Sbjct  339  NIDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKIAKHFGAVVFYDVNLPMPLWHSQEETKM  398

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W  ADIIEV++ ELEFL      + ++ K N K ++ 
Sbjct  399  FIQQVWNLADIIEVTKQELEFLCGITPSEEFDTKNNAKSKFV  440



>ref|XP_004982464.1| PREDICTED: putative fructokinase-5-like [Setaria italica]
Length=581

 Score =   115 bits (287),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  PT  S+L KA+  SKKFGG+IFFDLNLPLPLW S   T  
Sbjct  331  NPAVLKEAKMFYYNSSALLEPTTQSSLLKAVDVSKKFGGIIFFDLNLPLPLWSSSKVTKS  390

Query  523  VIKGAWEQADIIEVSRSELEFLLD  452
            +IK AWE ADIIEV++ ELEFL D
Sbjct  391  LIKEAWEAADIIEVTKQELEFLCD  414


 Score =   110 bits (276),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E +  LWHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGDA+VA
Sbjct  435  SPEAIKKLWHDNLKVLFVTNGTSKIHYYTEKHSGWVRGTEDAPITPFTSEMSQSGDAIVA  494

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +MR L   P +  ++  L + +++AI  G++ QW +   RGF P E A
Sbjct  495  ALMRMLAINPHLVTDKVYLHKAVKYAIKCGVLDQWVLARERGFLPKERA  543



>ref|XP_004160828.1| PREDICTED: putative fructokinase-5-like [Cucumis sativus]
Length=568

 Score =   122 bits (306),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E + PLWH+ LK LFVT+GT ++H+YT   +G ++G ED  +TPFT D + SGD +VA +
Sbjct  437  EVIKPLWHENLKVLFVTNGTSKIHFYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAAL  496

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  497  MRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDDTEEV  546


 Score =   102 bits (254),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L  P M ST  KAI  +KK G +IF+DLNLPLPLW SRDET E
Sbjct  331  NIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIAKKLGSVIFYDLNLPLPLWHSRDETIE  390

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEFL 
Sbjct  391  FIQQVWNLADIIEVTKQELEFLC  413



>gb|KGN54881.1| hypothetical protein Csa_4G571770 [Cucumis sativus]
Length=588

 Score =   122 bits (306),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E + PLWH+ LK LFVT+GT ++H+YT   +G ++G ED  +TPFT D + SGD +VA +
Sbjct  457  EVIKPLWHENLKVLFVTNGTSKIHFYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAAL  516

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  517  MRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDDTEEV  566


 Score =   102 bits (254),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L  P M ST  KAI  +KK G +IF+DLNLPLPLW SRDET E
Sbjct  351  NIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIAKKLGSVIFYDLNLPLPLWHSRDETIE  410

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEFL 
Sbjct  411  FIQQVWNLADIIEVTKQELEFLC  433



>ref|XP_004144690.1| PREDICTED: fructokinase-2-like, partial [Cucumis sativus]
Length=447

 Score =   122 bits (306),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E + PLWH+ LK LFVT+GT ++H+YT   +G ++G ED  +TPFT D + SGD +VA +
Sbjct  316  EVIKPLWHENLKVLFVTNGTSKIHFYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAAL  375

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  376  MRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDDTEEV  425


 Score =   102 bits (254),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L  P M ST  KAI  +KK G +IF+DLNLPLPLW SRDET E
Sbjct  210  NIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIAKKLGSVIFYDLNLPLPLWHSRDETIE  269

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEFL 
Sbjct  270  FIQQVWNLADIIEVTKQELEFLC  292



>ref|XP_002273674.2| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Vitis 
vinifera]
 emb|CBI27307.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   124 bits (311),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V PLWH+ LK LFVT+GT ++H+YT    G V G ED  ITPFTCD + SGD +VAG+MR
Sbjct  435  VGPLWHENLKVLFVTNGTSKIHFYTKEENGAVHGMEDAPITPFTCDMSASGDGIVAGLMR  494

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
             LT QP +  ++  LE  +R+AI  G+I QW +   RG+P
Sbjct  495  MLTVQPHLITDKGYLEHSIRYAIDCGVIDQWLLARQRGYP  534


 Score =   100 bits (249),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VL+EA++F+FN+  L    M ST F+AI  SKK GG+IF+DLNLPLPLW+S  ET +
Sbjct  327  NIDVLREAKMFYFNTSSLLDQNMASTTFRAIKISKKLGGVIFYDLNLPLPLWQSGQETKK  386

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW  ADIIEV++ ELEF+ 
Sbjct  387  FIQQAWNLADIIEVTKQELEFIC  409



>ref|XP_008442238.1| PREDICTED: uncharacterized protein LOC103486152 [Cucumis melo]
Length=588

 Score =   123 bits (308),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E + PLWH  LK LFVT+GT ++HYYT   +G ++G ED  +TPFT D + SGD +VA +
Sbjct  457  EVIKPLWHRNLKVLFVTNGTSKIHYYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAAL  516

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  517  MRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDETEEV  566


 Score =   101 bits (251),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L  P M ST  KAI  ++K G +IF+DLNLPLPLW SRDET E
Sbjct  351  NIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIARKLGSVIFYDLNLPLPLWHSRDETKE  410

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEFL 
Sbjct  411  FIQQVWNLADIIEVTKQELEFLC  433



>ref|XP_010649953.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Vitis 
vinifera]
Length=627

 Score =   124 bits (311),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V PLWH+ LK LFVT+GT ++H+YT    G V G ED  ITPFTCD + SGD +VAG+MR
Sbjct  497  VGPLWHENLKVLFVTNGTSKIHFYTKEENGAVHGMEDAPITPFTCDMSASGDGIVAGLMR  556

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
             LT QP +  ++  LE  +R+AI  G+I QW +   RG+P
Sbjct  557  MLTVQPHLITDKGYLEHSIRYAIDCGVIDQWLLARQRGYP  596


 Score = 99.8 bits (247),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VL+EA++F+FN+  L    M ST F+AI  SKK GG+IF+DLNLPLPLW+S  ET +
Sbjct  389  NIDVLREAKMFYFNTSSLLDQNMASTTFRAIKISKKLGGVIFYDLNLPLPLWQSGQETKK  448

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW  ADIIEV++ ELEF+ 
Sbjct  449  FIQQAWNLADIIEVTKQELEFIC  471



>ref|XP_010257983.1| PREDICTED: fructokinase-like 2, chloroplastic [Nelumbo nucifera]
Length=709

 Score =   120 bits (302),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E + PLWH  LK LFVT+GT ++HYYT    G V G ED  ITPFTCD + SGD +VA +
Sbjct  558  EVIRPLWHQNLKVLFVTNGTSKIHYYTEQHNGSVRGMEDPPITPFTCDMSASGDGIVAAL  617

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  31
            +R LT QP +  ++  LE  +++AI+ G+I QW +G  RGFP +   +
Sbjct  618  LRMLTVQPHLITDKGYLEHTIKYAINCGVIDQWLVGRTRGFPPKEGME  665


 Score =   102 bits (254),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FNS  L  P M ST  +AI  SKK GG+IFFDLNLPLPLW+S +ET  
Sbjct  452  NIDVLKEAKMFYFNSFSLLDPNMRSTTLQAIKISKKLGGIIFFDLNLPLPLWQSGEETNM  511

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             ++ AW  AD+IEV++ ELEFL      + ++ K N K ++ 
Sbjct  512  FVQEAWTLADVIEVTKQELEFLCGIKPSESFDTKDNDKSKFI  553



>ref|XP_006856418.1| hypothetical protein AMTR_s00047p00218860 [Amborella trichopoda]
 gb|ERN17885.1| hypothetical protein AMTR_s00047p00218860 [Amborella trichopoda]
Length=611

 Score =   119 bits (298),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            I   RE ++PLWH+ LK LFVT+GT ++HYY    +G   G ED  I+PFTCD + SGDA
Sbjct  440  IHHKREVISPLWHESLKVLFVTNGTSKIHYYMEKTDGAENGMEDAPISPFTCDMSTSGDA  499

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA +MR L  QP++  ++  L   +++AI+ G+  QW IG +RGFP
Sbjct  500  IVAALMRMLVLQPDLCTDRGYLRHAVKYAINCGVHHQWLIGRIRGFP  546


 Score =   103 bits (258),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FNS  L    M ST  +AI   KK GG++FFDLNLPLPLWKS++ET  
Sbjct  339  NVDVLKEAKMFYFNSSSLVDQEMRSTTMEAIDLLKKLGGVVFFDLNLPLPLWKSKEETRT  398

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
            +I+ AW+QAD +EV++ ELEFL      + ++ K N K ++ 
Sbjct  399  LIEQAWKQADFVEVTKQELEFLCGIEPSEKFDTKDNDKSKFI  440



>ref|XP_002512061.1| fructokinase, putative [Ricinus communis]
 gb|EEF50730.1| fructokinase, putative [Ricinus communis]
Length=575

 Score =   133 bits (334),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ LK LFVT+GT ++HYYT  F G V G ED  ITPFTCD + SGD +VA I
Sbjct  440  EVVAPLWHENLKVLFVTNGTSKIHYYTEEFNGSVHGMEDPAITPFTCDMSASGDGIVAAI  499

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPSLCAI  1
            MR L+ QP +  ++  LE+ +++AI  G+I QW +G +RGFP +   ++  EP    I
Sbjct  500  MRMLSVQPHLIADKGYLEKTIKYAIDCGVIDQWLLGRMRGFPPKEDMEDEVEPDPNGI  557


 Score = 90.1 bits (222),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++ +FN+  L    M S   +AI  SKK GG+IF+D+NLPLPLW S +ET  
Sbjct  334  NIDVLKEAKMLYFNTHSLIDRNMRSATMRAIRISKKLGGVIFYDVNLPLPLWHSSEETKL  393

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  A+IIEV++ ELEFL 
Sbjct  394  FIQEVWNHANIIEVTKQELEFLC  416



>ref|XP_003518781.1| PREDICTED: probable fructokinase-2-like [Glycine max]
Length=573

 Score =   124 bits (312),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ LK LFVT+GT ++HYYT    G V+G ED  ITPFT D + +GD +VA +
Sbjct  439  EVVAPLWHENLKVLFVTNGTSKIHYYTKELNGAVLGMEDAPITPFTRDMSATGDGIVAAL  498

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            MR LT QP++  ++  LE  +++ I  G+I QW  G VRGFP
Sbjct  499  MRMLTVQPDLLTDKGYLEHSIKYGIDCGVIDQWIFGRVRGFP  540


 Score = 98.2 bits (243),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  SK FGG++F+DLNLP+PLW SR+ET  
Sbjct  333  NIDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVVFYDLNLPMPLWHSREETMM  392

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEFL 
Sbjct  393  FIQRVWNLADIIEVTKQELEFLC  415



>gb|KHN29971.1| Fructokinase-2 [Glycine soja]
Length=557

 Score =   124 bits (312),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ LK LFVT+GT ++HYYT    G V+G ED  ITPFT D + +GD +VA +
Sbjct  423  EVVAPLWHENLKVLFVTNGTSKIHYYTKELNGAVLGMEDAPITPFTRDMSATGDGIVAAL  482

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            MR LT QP++  ++  LE  +++ I  G+I QW  G VRGFP
Sbjct  483  MRMLTVQPDLLTDKGYLEHSIKYGIDCGVIDQWIFGRVRGFP  524


 Score = 97.8 bits (242),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  SK FGG++F+DLNLP+PLW SR+ET  
Sbjct  317  NIDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVVFYDLNLPMPLWHSREETMM  376

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEFL 
Sbjct  377  FIQRVWNLADIIEVTKQELEFLC  399



>gb|AAT81682.1| putative kinase [Oryza sativa Japonica Group]
Length=589

 Score =   111 bits (278),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  ET  
Sbjct  339  NPAVLKEAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKETKS  398

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            ++K AWE ADIIE+++ ELEFL 
Sbjct  399  LVKEAWEAADIIEITKQELEFLC  421


 Score =   110 bits (276),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  443  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  502

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  503  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  551



>gb|EEE59468.1| hypothetical protein OsJ_11670 [Oryza sativa Japonica Group]
Length=586

 Score =   111 bits (278),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  ET  
Sbjct  336  NPAVLKEAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKETKS  395

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            ++K AWE ADIIE+++ ELEFL 
Sbjct  396  LVKEAWEAADIIEITKQELEFLC  418


 Score =   110 bits (276),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  440  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  499

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  500  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  548



>gb|ABF97502.1| pfkB-type carbohydrate kinase family protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=575

 Score =   111 bits (277),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  ET  
Sbjct  325  NPAVLKEAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKETKS  384

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            ++K AWE ADIIE+++ ELEFL 
Sbjct  385  LVKEAWEAADIIEITKQELEFLC  407


 Score =   110 bits (276),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  429  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  488

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  489  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  537



>ref|XP_002466840.1| hypothetical protein SORBIDRAFT_01g015030 [Sorghum bicolor]
 gb|EER93838.1| hypothetical protein SORBIDRAFT_01g015030 [Sorghum bicolor]
Length=583

 Score =   113 bits (282),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG IFFDLNLPLPLW S  ET  
Sbjct  333  NPAVLKEAKMFYYNSSALLEPTTESSLLKAIDVSKKFGGTIFFDLNLPLPLWSSSKETKL  392

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +IK AWE ADIIEV++ ELEFL 
Sbjct  393  LIKEAWEAADIIEVTKQELEFLC  415


 Score =   108 bits (270),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E +  LWH+ LK LFVT+GT ++HYYT    G V GTED  ITPFT D + SGDA+VA
Sbjct  437  SPEVIMKLWHNNLKVLFVTNGTSKIHYYTEKHNGWVRGTEDAPITPFTSDMSQSGDAIVA  496

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +MR L   P +  ++  L + ++ AI  G+I QW +   RGF P E A
Sbjct  497  ALMRMLIINPHLVTDKVYLHKAVKHAIKCGVIDQWMLARERGFLPKERA  545



>tpg|DAA50254.1| TPA: hypothetical protein ZEAMMB73_178722 [Zea mays]
Length=656

 Score =   112 bits (281),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG IFFDLNLPLPLW S  ET  
Sbjct  406  NPAVLKEAKMFYYNSSALLEPTTESSLLKAIDVSKKFGGTIFFDLNLPLPLWSSSKETKS  465

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +IK AWE A+IIEV++ ELEFL 
Sbjct  466  LIKEAWEAANIIEVTKQELEFLC  488


 Score =   108 bits (271),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E +  LWH  LK LFVT+GT ++HYYT +  G V GTED  ITPFT D + SGDA+VA
Sbjct  510  SSEVIMKLWHSNLKVLFVTNGTSKIHYYTETHNGWVRGTEDAPITPFTGDMSQSGDAIVA  569

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +MR L   P +  ++  L + ++ AI  G+I QW +   RGF P E A
Sbjct  570  ALMRMLVINPHLITDKVYLHKAVKHAIKCGVIDQWVLARERGFLPKERA  618



>ref|XP_008665080.1| PREDICTED: uncharacterized protein LOC103643674 [Zea mays]
Length=730

 Score =   112 bits (281),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG IFFDLNLPLPLW S  ET  
Sbjct  480  NPAVLKEAKMFYYNSSALLEPTTESSLLKAIDVSKKFGGTIFFDLNLPLPLWSSSKETKS  539

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +IK AWE A+IIEV++ ELEFL 
Sbjct  540  LIKEAWEAANIIEVTKQELEFLC  562


 Score =   108 bits (270),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E +  LWH  LK LFVT+GT ++HYYT +  G V GTED  ITPFT D + SGDA+VA
Sbjct  584  SSEVIMKLWHSNLKVLFVTNGTSKIHYYTETHNGWVRGTEDAPITPFTGDMSQSGDAIVA  643

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +MR L   P +  ++  L + ++ AI  G+I QW +   RGF P E A
Sbjct  644  ALMRMLVINPHLITDKVYLHKAVKHAIKCGVIDQWVLARERGFLPKERA  692



>gb|KDP41324.1| hypothetical protein JCGZ_15731 [Jatropha curcas]
Length=580

 Score =   129 bits (325),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFTCD + SGD +VA I
Sbjct  438  EVVAPLWHENLKVLFVTNGTSKIHYYTEEHNGSVHGMEDAPITPFTCDMSASGDGIVAAI  497

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPSLCAI  1
            +R  + QP +  ++  LE  +++AI  G+I QW +G VRGFP +   +   EP +  I
Sbjct  498  LRMFSVQPHLITDKGYLEHTIKYAIDCGVIDQWLLGRVRGFPPKEDMEEEVEPDMNGI  555


 Score = 91.3 bits (225),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L   +M     +AI  SKK GG+IF+DLNLPLPLW+S +ET  
Sbjct  332  NIDVLKEAKMFYFTTHSLLVRSMRLATLQAIKISKKLGGVIFYDLNLPLPLWQSSEETKL  391

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W  A+IIEV++ ELEFL      D ++ K N + ++ 
Sbjct  392  FIQEVWNHANIIEVTKQELEFLCGIKPADEFDTKNNARSKFV  433



>gb|KHG26530.1| Fructokinase-2 [Gossypium arboreum]
Length=585

 Score =   124 bits (312),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            I    E VAPLWH+ LK LFVT+GT ++HYYT    G V G ED  +TPF+CD + SGD 
Sbjct  420  IHYDHEVVAPLWHENLKTLFVTNGTSKIHYYTKEQNGAVNGMEDAPLTPFSCDMSASGDG  479

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  31
            +VAG++R L+ QP++  ++  LE  +++AI  G+I QW +   RGFP +   Q
Sbjct  480  IVAGLLRMLSVQPDLITDKGYLEHTIKYAIDCGVIDQWIVSRTRGFPPKEGIQ  532


 Score = 96.3 bits (238),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  319  NIDVLKEAKMFYFNTHSLLDRNMRSTTLRAIKMSKKLGGVIFYDVNLPLPLWQSDEETKM  378

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW  AD IEV++ ELEFL 
Sbjct  379  FIQEAWNLADFIEVTKQELEFLC  401



>emb|CDY40900.1| BnaC06g30380D [Brassica napus]
Length=616

 Score =   124 bits (312),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +VAG+
Sbjct  444  ETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIVAGL  503

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  504  IRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  545


 Score = 95.9 bits (237),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+ET  
Sbjct  338  NVDVLKEAKMFYFTTHSLQDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREETKS  397

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +I+  W+ AD+IEV++ ELEFL 
Sbjct  398  LIQEVWDLADVIEVTKQELEFLC  420



>gb|EEC75710.1| hypothetical protein OsI_12536 [Oryza sativa Indica Group]
Length=586

 Score =   110 bits (276),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  440  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  499

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  500  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  548


 Score =   109 bits (273),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N AVLKEA++F++NS  L  P   S+L KAI  SKKFGG+ FFDLNLPLPLW S  ET  
Sbjct  336  NPAVLKEAKMFYYNSSALLEPATRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKETKS  395

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            ++K AWE ADIIE+++ ELEFL 
Sbjct  396  LVKEAWEAADIIEITKQELEFLC  418



>ref|XP_010551378.1| PREDICTED: fructokinase-like 2, chloroplastic [Tarenaya hassleriana]
Length=604

 Score =   128 bits (322),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V PLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFT D + SGD +VAG+
Sbjct  434  EIVEPLWHENLKVLFVTNGTSKIHYYTKDHDGAVLGMEDAPITPFTGDMSASGDGIVAGL  493

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTE  43
            MR LT QP++  ++  LER LR+AI  G++ QW +   RGFP +
Sbjct  494  MRMLTVQPDLITDKGYLERMLRYAIECGVVDQWLLAQTRGFPAK  537


 Score = 92.0 bits (227),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SKK G +IF+D+NLPLPLW+S +ET  
Sbjct  328  NIDVLKEAKMFYFSTHSLLDRKMRSTTLQAIKISKKLGSVIFYDVNLPLPLWQSHEETKA  387

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W+ ADIIE+++ ELEFL 
Sbjct  388  FIQEVWDLADIIEITKQELEFLC  410



>emb|CDY54150.1| BnaCnng26300D [Brassica napus]
Length=472

 Score =   125 bits (313),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +VAG+
Sbjct  309  ETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIVAGL  368

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  369  IRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  410


 Score = 95.5 bits (236),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+ET  
Sbjct  203  NVDVLKEAKMFYFTTHSLLDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREETKS  262

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +I+  W+ AD+IEV++ ELEFL 
Sbjct  263  LIQEVWDLADVIEVTKQELEFLC  285



>ref|XP_003562305.1| PREDICTED: fructokinase-like 2, chloroplastic [Brachypodium distachyon]
Length=578

 Score =   111 bits (278),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F++NS  L  PT  S+L KAI  SKKFGG+IFFDLNLP+PLW S  ET  
Sbjct  327  NPDVLKEAKMFYYNSSALLEPTTRSSLLKAIEISKKFGGIIFFDLNLPMPLWSSSKETKS  386

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +IK AWE ADIIEV++ E+EFL 
Sbjct  387  LIKEAWEAADIIEVTKQEIEFLC  409


 Score =   108 bits (270),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWH  LK LFVT+GT ++HYYT    G V GTED  ITPFTC+ + SGDA+VA
Sbjct  431  SPEVVMKLWHANLKVLFVTNGTSKIHYYTEKHNGWVRGTEDAPITPFTCEMSQSGDAIVA  490

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +M  L+  P +  ++  L + ++ AI  G+I QW +   RGF P E A
Sbjct  491  ALMNMLSINPHLVTDKVYLHKTVKHAIKCGVIDQWLVARERGFLPRERA  539



>ref|XP_009105465.1| PREDICTED: uncharacterized protein LOC103831320 [Brassica rapa]
Length=617

 Score =   124 bits (311),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +VAG+
Sbjct  445  ETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIVAGL  504

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  505  IRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  546


 Score = 95.1 bits (235),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+ET  
Sbjct  339  NVDVLKEAKMFYFTTHSLLDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREETKS  398

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +I+  W+ AD+IEV++ ELEFL 
Sbjct  399  LIQEVWDLADVIEVTKQELEFLC  421



>emb|CDX95956.1| BnaA07g27750D [Brassica napus]
Length=608

 Score =   124 bits (311),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +VAG+
Sbjct  445  ETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIVAGL  504

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  505  IRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  546


 Score = 95.1 bits (235),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+ET  
Sbjct  339  NVDVLKEAKMFYFTTHSLLDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREETKS  398

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +I+  W+ AD+IEV++ ELEFL 
Sbjct  399  LIQEVWDLADVIEVTKQELEFLC  421



>ref|XP_003614114.1| Fructokinase-2 [Medicago truncatula]
 gb|AES97072.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=578

 Score =   128 bits (321),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ LK LFVT+GT ++HYYT   +G V G ED  ITPFT D + SGD +VA +
Sbjct  446  EVVAPLWHENLKVLFVTNGTSKIHYYTTELDGAVSGMEDAPITPFTRDMSASGDGIVAAL  505

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR LT QP++  ++  L+  +++AI  G+I QW +G VRGFP +  T+++
Sbjct  506  MRMLTVQPDLITDKGYLQHSIQYAIDCGVIDQWILGRVRGFPPQEDTEDI  555


 Score = 91.3 bits (225),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  +K FG ++F+D+NLP+PLW S++ET  
Sbjct  340  NIDVLKEAKMFYFNTHSLLDRHMRSTTLRAIKIAKHFGAVVFYDVNLPMPLWHSQEETKT  399

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W  ADIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  400  FIQQVWNLADIIEVTKQELEFLCGITPSEEFDTKNNARSKFV  441



>ref|XP_002312288.2| hypothetical protein POPTR_0008s09690g [Populus trichocarpa]
 gb|EEE89655.2| hypothetical protein POPTR_0008s09690g [Populus trichocarpa]
Length=607

 Score =   124 bits (312),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ L+ LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD + AG+
Sbjct  437  EVVAPLWHENLEVLFVTNGTSKIHYYTREHNGAVHGMEDPPITPFTSDMSASGDGITAGL  496

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPSLCAI  1
            +R LT QP++F +++ LE  +++AI  G+I QW +G  RGFP      +  EP    I
Sbjct  497  LRMLTVQPDLFTDKEYLESTIKYAIDCGVIDQWLLGRTRGFPPREEMGDEVEPDENGI  554


 Score = 94.7 bits (234),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 69/101 (68%), Gaps = 3/101 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLK+A++F+FN+  L   +M ST  +AI  SKK G ++F+D+NLPLPLW+S +ET  
Sbjct  331  NIDVLKQAKMFYFNTHSLLDRSMRSTALRAIKVSKKLGAVVFYDVNLPLPLWRSSEETKL  390

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQY  410
             I+ AW  AD+IEV++ ELEFL     ++ ++ + N K ++
Sbjct  391  FIQEAWNLADVIEVTKQELEFLCGIEPDEEFDTRNNAKSKF  431



>ref|XP_004297219.1| PREDICTED: fructokinase-like 2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=554

 Score =   125 bits (313),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = -2

Query  357  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  178
            RE +APLWH+ LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD +VA 
Sbjct  420  REMIAPLWHENLKVLFVTNGTSKIHYYTKEHDGAVNGMEDPPISPFTSDMSASGDGIVAA  479

Query  177  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +MR LT QP +  +++ LE  +++AI  G+I QW +G  RGFP
Sbjct  480  LMRMLTVQPHLVTDREYLEHSIKYAIDCGVIDQWLLGRSRGFP  522


 Score = 94.0 bits (232),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  +K+ GG++F+D+NLPLPLW+S +ET  
Sbjct  315  NMDVLKEAKMFYFNTHSLLDQNMRSTTLQAIKIAKQLGGVVFYDVNLPLPLWQSSEETKL  374

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W  ADIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  375  FIQQVWNIADIIEVTKQELEFLCGVQPSEEFDTKDNARSKFV  416



>ref|XP_006650283.1| PREDICTED: uncharacterized protein LOC102700038 [Oryza brachyantha]
Length=584

 Score =   111 bits (278),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 70/101 (69%), Gaps = 3/101 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  ET  
Sbjct  334  NPTVLKEAKMFYYNSSALLEPTTQSSLLKAIEVSKKFGGVTFFDLNLPLPLWSSSKETKS  393

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQY  410
            ++K AWE ADIIE+++ ELEFL      + ++ K N K ++
Sbjct  394  LVKEAWEAADIIEITKQELEFLCGIKPSEKFDTKDNDKSKF  434


 Score =   107 bits (267),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWH+ L+ LFVT+GT ++HYYT    G V GTED  ITPFT D + SGDA+VA
Sbjct  438  SPEVVMKLWHENLQVLFVTNGTSKIHYYTKEHNGWVRGTEDAPITPFTSDMSQSGDAIVA  497

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  37
             +M+ LT  P +  ++  L   ++ AI+ G+I QW +   RGF P E A
Sbjct  498  ALMKMLTINPHLVTDKVYLHDAIKHAITCGVIDQWLLARERGFLPREQA  546



>ref|XP_010044389.1| PREDICTED: uncharacterized protein LOC104433370 [Eucalyptus grandis]
 gb|KCW86476.1| hypothetical protein EUGRSUZ_B03142 [Eucalyptus grandis]
Length=564

 Score =   123 bits (309),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 73/116 (63%), Gaps = 0/116 (0%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            +APLWHD LK LFVT+GT ++HYYT    G V G ED  ITPF+ D + SGD +VAG++R
Sbjct  435  IAPLWHDNLKVLFVTNGTSKIHYYTKEHNGAVHGMEDPPITPFSRDMSASGDGIVAGLVR  494

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPSLCAI  1
             LT QP++  ++D LE  +++AI  G+I QW +    GFP     +    P +  I
Sbjct  495  MLTVQPDLHTDRDYLEHSIKYAIDCGVIDQWAVSRTHGFPPREDEEEEVSPDINGI  550


 Score = 95.1 bits (235),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++ + N+  L    M ST  +AI  SK+FGGLIF+D+NLPLPLW S +ET  
Sbjct  327  NVDVLKEAKMLYINTHSLLERNMRSTALQAIKISKRFGGLIFYDVNLPLPLWHSAEETKA  386

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  WE AD IEV++ ELEFL      + ++ K N K ++ 
Sbjct  387  FIQQVWELADFIEVTKQELEFLCGIVPSEEFDTKNNSKSKFI  428



>ref|XP_010091598.1| hypothetical protein L484_026446 [Morus notabilis]
 gb|EXB44864.1| hypothetical protein L484_026446 [Morus notabilis]
Length=569

 Score =   120 bits (301),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V PLWH+ LK LFVT+GT ++HYYT   +G V G ED  +TPFT D + SGD ++A +
Sbjct  437  EVVEPLWHENLKVLFVTNGTSKIHYYTREHDGAVRGMEDPHLTPFTRDMSASGDGIIAAL  496

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP +  ++  LE  +++AI  G+I QW +G VRGFP
Sbjct  497  LRMLTVQPHLITDKGYLEHSIKYAIDCGVIDQWALGRVRGFP  538


 Score = 97.8 bits (242),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA+IF+F++  L  P M ST  +AI  SKK GG+IF+D+NLPLPLW S +E   
Sbjct  331  NIDVLKEAKIFYFSTHSLLDPNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWLSSEEAKS  390

Query  523  VIKGAWEQADIIEVSRSELEFL---LDEDHYEHKRNYKPQYF  407
             I+  W  ADIIEV++ ELEFL   +  + ++ K N K ++ 
Sbjct  391  FIQQVWNLADIIEVTKQELEFLCGIMPSEEFDTKNNDKVKFI  432



>ref|XP_006437893.1| hypothetical protein CICLE_v10031077mg [Citrus clementina]
 gb|ESR51133.1| hypothetical protein CICLE_v10031077mg [Citrus clementina]
Length=575

 Score =   120 bits (300),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VAGI
Sbjct  443  EVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVAGI  502

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEP  16
            MR LT QP +  ++  L R +++AI  G+  QW+     G+P +   +   EP
Sbjct  503  MRMLTVQPHLITDKGYLVRTIKYAIDCGVRDQWSQARTLGYPPKEGMEEEVEP  555


 Score = 95.5 bits (236),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +ET  
Sbjct  337  NIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEETKM  396

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+ AW  AD+IEV++ ELEFL      + ++ K N + ++ 
Sbjct  397  FIQQAWNLADVIEVTKQELEFLCGIKPTEEFDTKNNARSKFV  438



>gb|KDO70321.1| hypothetical protein CISIN_1g0081612mg [Citrus sinensis]
Length=575

 Score =   120 bits (300),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VAGI
Sbjct  443  EVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVAGI  502

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEP  16
            MR LT QP +  ++  L R +++AI  G+  QW+     G+P +   +   EP
Sbjct  503  MRMLTVQPHLITDKGYLVRTIKYAIDCGVRDQWSQARTLGYPPKGGMEEEVEP  555


 Score = 95.5 bits (236),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +ET  
Sbjct  337  NIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEETKM  396

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+ AW  AD+IEV++ ELEFL      + ++ K N + ++ 
Sbjct  397  FIQQAWTLADVIEVTKQELEFLCGIKPTEEFDTKNNARSKFV  438



>ref|XP_006484232.1| PREDICTED: uncharacterized protein LOC102617588 [Citrus sinensis]
Length=575

 Score =   120 bits (300),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VAGI
Sbjct  443  EVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVAGI  502

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEP  16
            MR LT QP +  ++  L R +++AI  G+  QW+     G+P +   +   EP
Sbjct  503  MRMLTVQPHLITDKGYLVRTIKYAIDCGVRDQWSQARTLGYPPKEGMEEEVEP  555


 Score = 95.1 bits (235),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 71/110 (65%), Gaps = 10/110 (9%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +ET  
Sbjct  337  NIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEETKM  396

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRN-------YKPQYFA  404
             I+ AW  AD+IEV++ ELEFL      + ++ K N       Y+P+  A
Sbjct  397  FIQQAWTLADVIEVTKQELEFLCGIKPTEEFDTKNNAQSKFVHYEPEVIA  446



>gb|ADI87422.1| fructokinase-like protein 2 [Nicotiana benthamiana]
Length=624

 Score =   122 bits (307),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 76/109 (70%), Gaps = 0/109 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT    G V+G EDV +TP+T D + SG+ ++AGI
Sbjct  492  EVIAPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGLEDVPLTPYTSDMSASGEGIIAGI  551

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  28
            +R LT QP +  ++  LER L++AIS G++ QW +    G+PT+   ++
Sbjct  552  IRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLLARRLGYPTKEGMED  600


 Score = 92.4 bits (228),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  +  P M  T  +A   SKK GG++F+D+NLP PLW+S D+   
Sbjct  386  NINVLKEAKMFYFNTFSMLDPNMRLTTLRATKISKKLGGVVFYDVNLPFPLWESGDKAKT  445

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW+ ADIIEV++ ELEFL 
Sbjct  446  FIQQAWDLADIIEVTKQELEFLC  468



>ref|XP_007222920.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
 gb|EMJ24119.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
Length=555

 Score =   124 bits (310),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 74/110 (67%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAP+WH+ LK LFVT+GT ++HYYT    G + G ED  ITPFT D + SGD +VA +
Sbjct  424  EVVAPVWHENLKVLFVTNGTSKIHYYTKEHHGAINGMEDPPITPFTSDMSASGDGIVAAL  483

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR LT QP +  +++ LE  +++AI  G+I QW +G  RGFP +  T+ +
Sbjct  484  MRMLTVQPHLITDKEYLEHTIKYAIDCGVIDQWLLGRERGFPPKEDTEEV  533


 Score = 91.3 bits (225),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  +    M ST  +AI  SKK GG+IF+D+NLPLPLW S +ET  
Sbjct  318  NIDVLKEAKMFYFSTHSMLDQNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWHSCEETKL  377

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEF+ 
Sbjct  378  FIQQVWNLADIIEVTKQELEFIC  400



>ref|XP_008243824.1| PREDICTED: uncharacterized protein LOC103342040 [Prunus mume]
Length=555

 Score =   123 bits (308),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ L  LFVT+GT ++HYYT    G + G ED  ITPFT D + SGD +VA +
Sbjct  424  EVVAPLWHENLNVLFVTNGTSKIHYYTKEHHGAINGMEDPPITPFTSDMSASGDGIVAAL  483

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR LT QP +  +++ LE  +++AI  G+I QW +G  RGFP +  T+ +
Sbjct  484  MRMLTVQPHLITDKEYLEHTIKYAIDCGVIDQWLLGRERGFPPKEDTEEV  533


 Score = 91.3 bits (225),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  +    M ST  +AI  SKK GG+IF+D+NLPLPLW S +ET  
Sbjct  318  NIDVLKEAKMFYFSTHSMLDQNMRSTTLQAIKLSKKLGGVIFYDVNLPLPLWHSCEETKL  377

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIEV++ ELEF+ 
Sbjct  378  FIQQVWNLADIIEVTKQELEFIC  400



>ref|XP_011018828.1| PREDICTED: fructokinase-like 2, chloroplastic [Populus euphratica]
Length=607

 Score =   119 bits (299),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ L+ LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD + AG+
Sbjct  437  EVVAPLWHENLEVLFVTNGTSKIHYYTREHNGAVHGMEDPPITPFTRDMSASGDGITAGL  496

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPSLCAI  1
            +R LT QP +  +++ LE  +++AI  G+I QW +G  RGFP      +  EP    I
Sbjct  497  LRMLTVQPALVTDKEYLESTIKYAIDCGVIDQWLLGRTRGFPPREEMGDEVEPDENGI  554


 Score = 94.7 bits (234),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 68/102 (67%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLK+A++F+FN+  L   +M ST  +AI  SKK G ++F+D+NLPLPLW+S +ET  
Sbjct  331  NIDVLKQAKMFYFNTHSLLDRSMRSTALRAIKVSKKLGAVVFYDVNLPLPLWQSSEETKL  390

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+ AW  AD++EV++ ELEFL     ++ Y  + N K ++ 
Sbjct  391  FIQEAWNLADVVEVTKQELEFLCGIEPDEEYNTRNNAKSKFV  432



>ref|XP_008389397.1| PREDICTED: probable fructokinase-1 isoform X1 [Malus domestica]
Length=559

 Score =   120 bits (301),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            +  S E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD 
Sbjct  421  VHHSPEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDG  480

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  481  IVAALMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  527


 Score = 93.6 bits (231),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  320  NVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEETKL  379

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             ++  W  ADIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  380  FVQQVWNLADIIEVTKQELEFLCGIQPSEEFDTKNNDRSKFV  421



>ref|XP_008389398.1| PREDICTED: probable fructokinase-1 isoform X2 [Malus domestica]
Length=556

 Score =   120 bits (301),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            +  S E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD 
Sbjct  418  VHHSPEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDG  477

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  478  IVAALMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  524


 Score = 93.6 bits (231),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  317  NVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEETKL  376

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             ++  W  ADIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  377  FVQQVWNLADIIEVTKQELEFLCGIQPSEEFDTKNNDRSKFV  418



>gb|KJB50552.1| hypothetical protein B456_008G176200 [Gossypium raimondii]
Length=587

 Score =   120 bits (301),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 0/113 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            I    E VAPLWH+ LK LFVT+GT ++HYYT    G V G ED  +TPF+ D + SGD 
Sbjct  420  IHYDHEVVAPLWHENLKTLFVTNGTSKIHYYTKEQNGAVNGMEDAPLTPFSRDMSASGDG  479

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  31
            +VAG++R L+ QP++  +   LE  +++AI  G+I QW +   RGFP +   Q
Sbjct  480  IVAGLLRMLSVQPDLISDTGYLEHTIKYAIDCGVIDQWIVSRTRGFPPKEGIQ  532


 Score = 93.2 bits (230),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M  T  +AI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  319  NIDVLKEAKMFYFNTHSLLDRNMRLTTLRAIKMSKKLGGVIFYDVNLPLPLWQSDEETKM  378

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW  AD IEV++ ELEFL 
Sbjct  379  FIQEAWNLADFIEVTKQELEFLC  401



>ref|XP_009356434.1| PREDICTED: probable fructokinase-4 isoform X2 [Pyrus x bretschneideri]
Length=559

 Score =   120 bits (301),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            +  S E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD 
Sbjct  421  VHHSPEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDG  480

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  481  IVAALMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  527


 Score = 92.8 bits (229),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  320  NVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEETKL  379

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W   DIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  380  FIQQVWNLGDIIEVTKQELEFLCGIQPSEEFDTKNNDRSKFV  421



>ref|XP_009356432.1| PREDICTED: probable fructokinase-4 isoform X1 [Pyrus x bretschneideri]
Length=561

 Score =   120 bits (301),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            +  S E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD 
Sbjct  423  VHHSPEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDG  482

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  483  IVAALMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  529


 Score = 92.8 bits (229),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  322  NVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEETKL  381

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W   DIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  382  FIQQVWNLGDIIEVTKQELEFLCGIQPSEEFDTKNNDRSKFV  423



>ref|XP_009356435.1| PREDICTED: probable fructokinase-4 isoform X3 [Pyrus x bretschneideri]
Length=558

 Score =   120 bits (301),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            +  S E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD 
Sbjct  420  VHHSPEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDG  479

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  480  IVAALMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  526


 Score = 92.8 bits (229),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  319  NVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEETKL  378

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W   DIIEV++ ELEFL      + ++ K N + ++ 
Sbjct  379  FIQQVWNLGDIIEVTKQELEFLCGIQPSEEFDTKNNDRSKFV  420



>gb|AAF27059.1|AC008262_8 F4N2.16 [Arabidopsis thaliana]
Length=568

 Score =   124 bits (310),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G EDV ITPFT D + SGD +VAG+
Sbjct  397  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDVPITPFTRDMSASGDGIVAGL  456

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  GII QW +   RG+P
Sbjct  457  IRMLTVQPDLMNNKGYLERTARYAIECGIIDQWLLAQTRGYP  498


 Score = 89.4 bits (220),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW S +ET  
Sbjct  291  NVDVLKEAKMFYFSTHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWHSSEETKS  350

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  AD+IE+++ ELEFL 
Sbjct  351  FIQEVWNLADVIEITKQELEFLC  373



>sp|F4I0K2.2|SCKL2_ARATH RecName: Full=Fructokinase-like 2, chloroplastic; AltName: Full=pfkB-type 
carbohydrate kinase family protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52502.1|AC018364_20 putative fructokinase; 80884-78543 [Arabidopsis thaliana]
Length=614

 Score =   124 bits (310),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G EDV ITPFT D + SGD +VAG+
Sbjct  443  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDVPITPFTRDMSASGDGIVAGL  502

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  GII QW +   RG+P
Sbjct  503  IRMLTVQPDLMNNKGYLERTARYAIECGIIDQWLLAQTRGYP  544


 Score = 89.0 bits (219),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW S +ET  
Sbjct  337  NVDVLKEAKMFYFSTHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWHSSEETKS  396

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  AD+IE+++ ELEFL 
Sbjct  397  FIQEVWNLADVIEITKQELEFLC  419



>ref|NP_177080.2| fructokinase-like 2 [Arabidopsis thaliana]
 gb|AEE34893.1| fructokinase-like 2 [Arabidopsis thaliana]
Length=616

 Score =   124 bits (310),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G EDV ITPFT D + SGD +VAG+
Sbjct  445  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDVPITPFTRDMSASGDGIVAGL  504

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  GII QW +   RG+P
Sbjct  505  IRMLTVQPDLMNNKGYLERTARYAIECGIIDQWLLAQTRGYP  546


 Score = 89.0 bits (219),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW S +ET  
Sbjct  339  NVDVLKEAKMFYFSTHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWHSSEETKS  398

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  AD+IE+++ ELEFL 
Sbjct  399  FIQEVWNLADVIEITKQELEFLC  421



>emb|CDP00452.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   117 bits (294),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 72/109 (66%), Gaps = 0/109 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ LK LFVT+GT ++HYYT    G V+G ED  +TP+T D + SGD +VAGI
Sbjct  440  EVVAPLWHENLKVLFVTNGTSKIHYYTKEHNGSVLGMEDGPLTPYTSDMSASGDGIVAGI  499

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  28
            +R LT QP +  ++  LE  +++AIS G+I QW      G+P +   ++
Sbjct  500  LRMLTVQPHLLTDKGYLEHTIKYAISCGVIDQWLQARKLGYPAKEGMED  548


 Score = 95.1 bits (235),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 3/101 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  SKK GG++F+DLNLPLPLW+S +ET  
Sbjct  334  NIDVLKEAKMFYFNTFSLLDWKMRSTALQAIKISKKLGGIVFYDLNLPLPLWQSGEETKT  393

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQY  410
             I+ AW  AD+IEV++ ELEFL      + ++ K N + ++
Sbjct  394  FIQKAWALADVIEVTKEELEFLCGIKASEEFDTKNNDRSKF  434



>ref|XP_009786224.1| PREDICTED: uncharacterized protein LOC104234369 [Nicotiana sylvestris]
Length=648

 Score =   120 bits (302),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT    G V+G EDV +TP+T D + SGD ++AGI
Sbjct  516  EVIAPLWHENLKVLFVTNGTSKIHYYTKEHHGAVLGLEDVPLTPYTSDMSASGDGIIAGI  575

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  28
            +R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  576  IRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  624


 Score = 92.0 bits (227),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L  P M  T  +A   SKK GG++F+D+NLP PLW+S D+   
Sbjct  410  NIDVLKEAKMFYFNTFSLLDPHMRLTTLRATKISKKLGGVVFYDVNLPFPLWESGDKAKT  469

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW+ ADIIEV++ ELEFL 
Sbjct  470  FIQQAWDLADIIEVTKQELEFLC  492



>ref|XP_008777340.1| PREDICTED: putative fructokinase-5 [Phoenix dactylifera]
Length=559

 Score =   109 bits (272),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 0/104 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT   +G V G ED  ITPFT D + SGDA+VA +
Sbjct  433  EVVMQLWHENLKVLFVTNGTSKIHYYTKKDDGCVHGMEDPPITPFTGDMSISGDAIVAAL  492

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTE  43
            +R LT QP +  ++  LE  +++AI+ G+I QW    V GFP +
Sbjct  493  IRMLTVQPHLATDKGYLEHMIKYAINCGVIDQWLHARVCGFPAK  536


 Score =   103 bits (256),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 70/102 (69%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FNS  L +  + ST  +AI  SKKFGG+IFFDLNLPLPLWKS +ET  
Sbjct  327  NIDVLKEAKMFYFNSSSLLNQNLRSTAMQAIKISKKFGGVIFFDLNLPLPLWKSSEETKT  386

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+ AW  A+IIEV++ ELEFL      + ++ K N K ++ 
Sbjct  387  FIQEAWNIANIIEVTKQELEFLCGIEPSEKFDTKDNDKSKFI  428



>ref|XP_011075683.1| PREDICTED: fructokinase-like 2, chloroplastic [Sesamum indicum]
Length=570

 Score =   120 bits (300),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 0/110 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V+ LWHD LK LFVT+GT ++HYYT    G V G ED  +TP+T D + SGD +VAGI
Sbjct  439  EVVSQLWHDDLKVLFVTNGTSKIHYYTKEHNGAVHGMEDAALTPYTSDMSASGDGIVAGI  498

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            MR LT QP +  ++  LER +++AIS G+I QW      GFP +   +++
Sbjct  499  MRMLTLQPHLISDKGYLERTVKYAISCGVIDQWLQARSLGFPAKEGMEDV  548


 Score = 91.3 bits (225),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +A+  +K+ G ++F+DLNLPLPLW+S +ET  
Sbjct  333  NIDVLKEAKMFYFNTFSLLDRNMRSTTLQAVKIAKRLGNVVFYDLNLPLPLWQSSEETKM  392

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW  +DIIEV++ ELEFL 
Sbjct  393  FIQKAWNLSDIIEVTKQELEFLC  415



>gb|EMS49265.1| hypothetical protein TRIUR3_05313 [Triticum urartu]
Length=507

 Score =   110 bits (274),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F++NS  L  PT  ++L KAI  SKKFGG+ FFDLNLP+PLW S  ET  
Sbjct  258  NPDVLKEAKMFYYNSSALLEPTTRTSLLKAIEVSKKFGGITFFDLNLPMPLWSSSKETKS  317

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +IK AWE ADIIEV++ ELEFL 
Sbjct  318  LIKEAWEAADIIEVTKQELEFLC  340


 Score =   100 bits (250),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  +WHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGD + A
Sbjct  361  SPEVVMKIWHDNLKVLFVTNGTSKIHYYTEKHNGSVRGTEDAPITPFTSEMSQSGDTIAA  420

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF  52
             +M  L+  P +  ++  L +  + AI  G+I QW     RGF
Sbjct  421  ALMNMLSINPHLVTDKVYLHKTAKHAIKCGVIDQWLAARERGF  463



>ref|XP_002887225.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63484.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=612

 Score =   119 bits (299),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG+
Sbjct  442  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDAPITPFTRDMSASGDGIVAGL  501

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  502  IRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  543


 Score = 91.3 bits (225),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +ET  
Sbjct  336  NVDVLKEAKLFYFSTHSLLDKKMMSTTIQAIKISKQLGTVIFYDLNLPLPLWQSSEETKS  395

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W+ ADIIE+++ ELEFL 
Sbjct  396  FIQEVWDLADIIEITKQELEFLC  418



>ref|XP_010511945.1| PREDICTED: fructokinase-like 2, chloroplastic [Camelina sativa]
Length=621

 Score =   119 bits (297),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG+
Sbjct  450  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTGDMSASGDGIVAGL  509

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  510  IRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  551


 Score = 91.7 bits (226),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +ET  
Sbjct  344  NVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEETKS  403

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIE+++ ELEFL 
Sbjct  404  FIQEVWNLADIIEITKQELEFLC  426



>ref|XP_009628355.1| PREDICTED: uncharacterized protein LOC104118730 [Nicotiana tomentosiformis]
Length=648

 Score =   118 bits (296),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT      V+G EDV +TP+T D + SGD ++AGI
Sbjct  516  EVIAPLWHENLKVLFVTNGTSKIHYYTKEHNSAVLGLEDVPLTPYTSDMSASGDGIIAGI  575

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  28
            +R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  576  IRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  624


 Score = 92.0 bits (227),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  +  P M  T  +A   SKK GG++F+D+NLP PLW+S D+   
Sbjct  410  NIDVLKEAKMFYFNTFSMLDPNMRLTTLRATKISKKLGGVVFYDVNLPFPLWESGDKAKT  469

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW+ ADIIEV++ ELEFL 
Sbjct  470  FIQQAWDLADIIEVTKQELEFLC  492



>ref|XP_010415548.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010415551.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Camelina 
sativa]
Length=624

 Score =   119 bits (297),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG+
Sbjct  453  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAGL  512

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  513  IRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  554


 Score = 91.7 bits (226),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +ET  
Sbjct  347  NVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEETKS  406

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIE+++ ELEFL 
Sbjct  407  FIQEVWNLADIIEITKQELEFLC  429



>ref|XP_010415552.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X3 [Camelina 
sativa]
Length=620

 Score =   118 bits (296),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG+
Sbjct  449  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAGL  508

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  509  IRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  550


 Score = 91.7 bits (226),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +ET  
Sbjct  343  NVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEETKS  402

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIE+++ ELEFL 
Sbjct  403  FIQEVWNLADIIEITKQELEFLC  425



>ref|XP_010470895.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Camelina 
sativa]
Length=619

 Score =   118 bits (296),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG+
Sbjct  448  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAGL  507

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  508  IRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  549


 Score = 91.7 bits (226),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +ET  
Sbjct  342  NVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEETKS  401

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIE+++ ELEFL 
Sbjct  402  FIQEVWNLADIIEITKQELEFLC  424



>ref|XP_010470894.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Camelina 
sativa]
Length=623

 Score =   118 bits (296),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG+
Sbjct  452  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAGL  511

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  512  IRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  553


 Score = 91.7 bits (226),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +ET  
Sbjct  346  NVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEETKS  405

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  ADIIE+++ ELEFL 
Sbjct  406  FIQEVWNLADIIEITKQELEFLC  428



>ref|XP_006348670.1| PREDICTED: uncharacterized protein LOC102589995 [Solanum tuberosum]
Length=650

 Score =   119 bits (298),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LFVT+GT ++HYYT    G V+G EDV ++P+T D + SGD ++AGI
Sbjct  518  EVIAPLWHENLKILFVTNGTSKIHYYTKEHNGSVLGLEDVPLSPYTSDMSASGDGIIAGI  577

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  28
            +R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  578  IRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  626


 Score = 90.5 bits (223),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L  P M  T  +A   SKK GG++F+DLNLP PLW+S ++   
Sbjct  412  NIDVLKEAKMFYFNTFSLLDPNMRLTTLRATKISKKLGGVVFYDLNLPSPLWESGEKAKT  471

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW  ADIIEV++ ELEFL 
Sbjct  472  FIQKAWNLADIIEVTKQELEFLC  494



>gb|EMT14724.1| hypothetical protein F775_09742 [Aegilops tauschii]
Length=774

 Score =   110 bits (275),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLP+PLW S  ET  
Sbjct  525  NPDVLKEAKMFYYNSSALLEPTTRSSLLKAIEVSKKFGGITFFDLNLPMPLWSSSKETKS  584

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +IK AWE ADIIEV++ ELEFL 
Sbjct  585  LIKDAWEAADIIEVTKQELEFLC  607


 Score = 99.0 bits (245),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  +WHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGD + A
Sbjct  628  SPEVVMKVWHDNLKVLFVTNGTSKIHYYTEKQNGSVRGTEDAPITPFTSEMSQSGDTIAA  687

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF  52
             +M  L+  P +  ++  L +  + AI  G+I QW     RGF
Sbjct  688  ALMNMLSINPHLVTDKVYLHKTAKHAIKCGVIDQWLAARERGF  730



>gb|EMS47290.1| hypothetical protein TRIUR3_20910 [Triticum urartu]
Length=540

 Score =   107 bits (267),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F++NS  L  PT  ++L KAI  SKKF G+ FFDLNLP+PLW S  ET  
Sbjct  291  NPDVLKEAKMFYYNSSALLEPTTRTSLLKAIEVSKKFSGITFFDLNLPMPLWSSSKETKS  350

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
            +IK AWE ADIIEV++ ELEFL 
Sbjct  351  LIKEAWEAADIIEVTKQELEFLC  373


 Score =   102 bits (253),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGD + A
Sbjct  394  SPEVVMKLWHDNLKVLFVTNGTSKIHYYTEKHNGSVRGTEDAPITPFTSEMSQSGDTIAA  453

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF  52
             +M  L+  P +  ++  L +  + AI  G+I QW     RGF
Sbjct  454  ALMNMLSINPHLVTDKVYLHKTAKHAIKCGVIDQWLAARERGF  496



>ref|XP_004239035.1| PREDICTED: fructokinase-like 2, chloroplastic [Solanum lycopersicum]
Length=645

 Score =   118 bits (295),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 74/109 (68%), Gaps = 0/109 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +APLWH+ LK LF+T+GT ++HYYT    G V+G EDV ++P+T D + SGD ++AGI
Sbjct  513  EVIAPLWHENLKILFMTNGTSKIHYYTKEHNGSVLGLEDVPLSPYTSDMSASGDGIIAGI  572

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  28
            +R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  573  IRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  621


 Score = 90.5 bits (223),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L  P M  T  +A   SKK GG++F+DLNLP PLW+S ++   
Sbjct  407  NIDVLKEAKMFYFNTFSLLDPNMRLTTLRATKISKKLGGVVFYDLNLPSPLWESGEKAKT  466

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+ AW  ADIIEV++ ELEFL 
Sbjct  467  FIQKAWNLADIIEVTKQELEFLC  489



>ref|XP_010680662.1| PREDICTED: fructokinase-like 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=577

 Score =   120 bits (301),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            +APLWH+ LK LFVT+GT ++HYYT    G V+G ED  ++PFT D + SGD +VA +MR
Sbjct  442  IAPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGVEDAPMSPFTQDMSASGDGIVAALMR  501

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTE  43
             LT QP +  +++ LER +++AI+ G+I QW +    GFP +
Sbjct  502  MLTVQPHLITDKEYLERAVKYAINCGVIDQWIVTRQNGFPAK  543


 Score = 88.2 bits (217),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 68/110 (62%), Gaps = 10/110 (9%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+ N+  L   +M     +A+  SKK GG+IF+DLNLPL LW+S +ET  
Sbjct  334  NIDVLKEAKMFYLNTSSLLDASMRRATLRALKISKKLGGVIFYDLNLPLSLWQSDEETKS  393

Query  523  VIKGAWEQADIIEVSRSELEFL-----LDE-DHYEHKRN----YKPQYFA  404
             I+  W  AD+IEV++ ELEF+     L+E D   +KR+    Y+P   A
Sbjct  394  FIEQVWSLADVIEVTKQELEFICGIKPLEEFDTKNNKRSKFEHYEPDIIA  443



>ref|XP_006301975.1| hypothetical protein CARUB_v10022455mg [Capsella rubella]
 gb|EOA34873.1| hypothetical protein CARUB_v10022455mg [Capsella rubella]
Length=618

 Score =   116 bits (291),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 67/102 (66%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG+
Sbjct  448  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAGL  507

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  ++  LER  R+AI  G++ QW     RG+P
Sbjct  508  IRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLQAQTRGYP  549


 Score = 92.0 bits (227),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F+S  L    M ST  +AI  SK+ G ++FFDLNLPLPLW+S +ET  
Sbjct  342  NVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNIVFFDLNLPLPLWQSSEETKS  401

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+  W  AD+IE+++ ELEFL 
Sbjct  402  FIQEVWNLADVIEITKQELEFLC  424



>gb|KFK41343.1| hypothetical protein AALP_AA2G117900 [Arabis alpina]
Length=615

 Score =   119 bits (298),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +VAG+
Sbjct  443  ETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIVAGL  502

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  ++  LE   R+AI  G++ QW +   RG+P
Sbjct  503  IRMLTVQPDLINDKGYLEHTARYAIECGVVDQWLLAQTRGYP  544


 Score = 87.8 bits (216),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  +AI  SKK G ++F+D+NLPLPLW+S +ET  
Sbjct  337  NVDVLKEAKMFYFSTHSLLDKKMMSTTLQAIKISKKLGNVVFYDVNLPLPLWQSGEETKS  396

Query  523  VIKGAWEQADIIEVSRSELEFLL  455
             I+   + AD+IEV++ ELEFL 
Sbjct  397  FIQEVCDLADVIEVTKQELEFLC  419



>ref|XP_010937787.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-like 2, chloroplastic 
[Elaeis guineensis]
Length=559

 Score =   104 bits (259),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGDA++A +
Sbjct  433  EVVMQLWHENLKVLFVTNGTSKIHYYTQKDNGWVHGMEDPPITPFTGDMSISGDAIIAAL  492

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP +  ++  LE  +++AI+ G+I QW      GFP
Sbjct  493  IRMLTVQPHLATDKGYLEHMIKYAINCGVIDQWLHARECGFP  534


 Score =   101 bits (251),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FNS  L + ++ ST  +AI  SKK GG+IFFDLNLPLPLWKS +ET  
Sbjct  327  NIDVLKEAKMFYFNSSSLLNQSLRSTAMQAIKISKKLGGVIFFDLNLPLPLWKSSEETKA  386

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W  ADIIEV++ ELEFL      + ++ K N K ++ 
Sbjct  387  FIQEVWNIADIIEVTKQELEFLCGMEPSEKFDTKDNDKSKFI  428



>gb|KDO58032.1| hypothetical protein CISIN_1g040065mg, partial [Citrus sinensis]
Length=82

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = -2

Query  240  DVLITPFTCDRTGSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAV  61
            DVLITPFTCDRTGSGDAVVA I+RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAV
Sbjct  1    DVLITPFTCDRTGSGDAVVAAILRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAV  60

Query  60   RGFPTESATQNLKE  19
            RGFPTESATQNLKE
Sbjct  61   RGFPTESATQNLKE  74



>ref|NP_001050625.2| Os03g0602600 [Oryza sativa Japonica Group]
 dbj|BAF12539.2| Os03g0602600 [Oryza sativa Japonica Group]
Length=216

 Score =   101 bits (252),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  697  AVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVI  518
             +L +A++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  ET  ++
Sbjct  36   CLLMQAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKETKSLV  95

Query  517  KGAWEQADIIEVSRSELEFLL  455
            K AWE ADIIE+++ ELEFL 
Sbjct  96   KEAWEAADIIEITKQELEFLC  116


 Score = 77.0 bits (188),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  138  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  197

Query  180  G  178
            G
Sbjct  198  G  198



>gb|KDO70322.1| hypothetical protein CISIN_1g0081612mg, partial [Citrus sinensis]
Length=500

 Score = 95.5 bits (236),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +ET  
Sbjct  337  NIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEETKM  396

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+ AW  AD+IEV++ ELEFL      + ++ K N + ++ 
Sbjct  397  FIQQAWTLADVIEVTKQELEFLCGIKPTEEFDTKNNARSKFV  438


 Score = 80.5 bits (197),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VA
Sbjct  443  EVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVA  500



>ref|XP_007222921.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
 gb|EMJ24120.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
Length=485

 Score = 91.3 bits (225),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  +    M ST  +AI  SKK GG+IF+D+NLPLPLW S +ET  
Sbjct  318  NIDVLKEAKMFYFSTHSMLDQNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWHSCEETKL  377

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYF  407
             I+  W  ADIIEV++ ELEF+      + ++ K N + ++ 
Sbjct  378  FIQQVWNLADIIEVTKQELEFICGIQPSEEFDTKNNDRSKFV  419


 Score = 79.3 bits (194),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAP+WH+ LK LFVT+GT ++HYYT    G + G ED  ITPFT D + SGD +VAG 
Sbjct  424  EVVAPVWHENLKVLFVTNGTSKIHYYTKEHHGAINGMEDPPITPFTSDMSASGDGIVAGT  483

Query  174  M  172
            +
Sbjct  484  L  484



>gb|EPS69174.1| hypothetical protein M569_05592, partial [Genlisea aurea]
Length=374

 Score = 92.0 bits (227),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA +F+FNS  L   TM STLF+AI  +KK G LIF+D N+PLPLW S +E   
Sbjct  210  NIDVLKEAEMFYFNSCCLLDRTMRSTLFRAIRIAKKLGNLIFYDPNIPLPLWLSSEEAKM  269

Query  523  VIKGAWEQADIIEVSRSELEFL  458
             ++ AW  +D+IEV++ ELE L
Sbjct  270  FVRTAWRLSDVIEVTKQELELL  291


 Score = 78.2 bits (191),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  178
            E V+ LWHD LK LFVT+GT ++HYYT  F G V G+ED L+TP+T   + SGD +VAG
Sbjct  316  ELVSQLWHDDLKVLFVTNGTSKVHYYTKEFNGFVHGSEDALLTPYTAQMSASGDGMVAG  374



>ref|XP_006391043.1| hypothetical protein EUTSA_v100183771mg, partial [Eutrema salsugineum]
 gb|ESQ28329.1| hypothetical protein EUTSA_v100183771mg, partial [Eutrema salsugineum]
Length=225

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V PLWH+ LK LFVT+GT ++HYYT    G V+G ED  ITPFT D + SGD +VAG+
Sbjct  54   ETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGSVLGMEDAPITPFTRDMSASGDGIVAGL  113

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  114  IRMLTVQPDLISDKGYLERTARYAIECGVVDQWLLAQTRGYP  155



>ref|XP_007153496.1| hypothetical protein PHAVU_003G040700g [Phaseolus vulgaris]
 gb|ESW25490.1| hypothetical protein PHAVU_003G040700g [Phaseolus vulgaris]
Length=578

 Score =   121 bits (303),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E VAPLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFT D + +GD +VA +
Sbjct  446  EVVAPLWHENLKVLFVTNGTSKIHYYTKELDGAVLGMEDAPITPFTSDMSATGDGIVAAL  505

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +RKL+ + ++  ++  LE  +++AI+ G+I QW  G VRGFP
Sbjct  506  LRKLSVELDLITDKGYLEHSIKYAINCGVIDQWIQGRVRGFP  547


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 72/119 (61%), Gaps = 10/119 (8%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+FN+  L    M ST  +AI  SK FGG++F+DLNLP+PLW SR+E   
Sbjct  340  NIDVLKEAKLFYFNTHSLLDRNMRSTTLQAIKISKHFGGVVFYDLNLPMPLWHSREEAIL  399

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRN-------YKPQYFAEDFQQTRKI  377
             I+  W  ADIIEV++ ELEFL      + ++ K N       Y+P+  A  + +  K+
Sbjct  400  FIQRFWNLADIIEVTKQELEFLCGITPSEEFDTKNNDSSKFVHYEPEVVAPLWHENLKV  458



>ref|XP_007045823.1| Fructokinase-like 2 isoform 3, partial [Theobroma cacao]
 gb|EOY01655.1| Fructokinase-like 2 isoform 3, partial [Theobroma cacao]
Length=585

 Score =   121 bits (303),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            I    E V PLWH+ LK LFVT+GT ++HYYT    G   G ED  ITPFTCD + SGD 
Sbjct  429  IHYDHEVVKPLWHENLKVLFVTNGTSKIHYYTKEQNGAAHGMEDAPITPFTCDMSASGDG  488

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA ++R LT QP++  ++  LE  +++AI  G+I QW +   RGFP
Sbjct  489  IVAALLRMLTVQPDLITDKGYLECTIKYAIDCGVIDQWLVARTRGFP  535


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 3/112 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  KAI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  328  NIDVLKEAKMFYFSTHSLLDRNMRSTTLKAIKMSKKLGGVIFYDVNLPLPLWQSDEETKI  387

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKI  377
             I+ AW  AD+IEV++ ELEFL      + ++ K N + ++   D +  + +
Sbjct  388  FIQEAWNLADVIEVTKQELEFLCGIKPTEEFDTKNNARSKFIHYDHEVVKPL  439



>ref|XP_007045821.1| Fructokinase-like 2 isoform 1 [Theobroma cacao]
 gb|EOY01653.1| Fructokinase-like 2 isoform 1 [Theobroma cacao]
Length=577

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            I    E V PLWH+ LK LFVT+GT ++HYYT    G   G ED  ITPFTCD + SGD 
Sbjct  429  IHYDHEVVKPLWHENLKVLFVTNGTSKIHYYTKEQNGAAHGMEDAPITPFTCDMSASGDG  488

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA ++R LT QP++  ++  LE  +++AI  G+I QW +   RGFP
Sbjct  489  IVAALLRMLTVQPDLITDKGYLECTIKYAIDCGVIDQWLVARTRGFP  535


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 3/112 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  KAI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  328  NIDVLKEAKMFYFSTHSLLDRNMRSTTLKAIKMSKKLGGVIFYDVNLPLPLWQSDEETKI  387

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKI  377
             I+ AW  AD+IEV++ ELEFL      + ++ K N + ++   D +  + +
Sbjct  388  FIQEAWNLADVIEVTKQELEFLCGIKPTEEFDTKNNARSKFIHYDHEVVKPL  439



>ref|XP_007045822.1| Fructokinase-like 2 isoform 2 [Theobroma cacao]
 gb|EOY01654.1| Fructokinase-like 2 isoform 2 [Theobroma cacao]
Length=594

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = -2

Query  369  ITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDA  190
            I    E V PLWH+ LK LFVT+GT ++HYYT    G   G ED  ITPFTCD + SGD 
Sbjct  429  IHYDHEVVKPLWHENLKVLFVTNGTSKIHYYTKEQNGAAHGMEDAPITPFTCDMSASGDG  488

Query  189  VVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  49
            +VA ++R LT QP++  ++  LE  +++AI  G+I QW +   RGFP
Sbjct  489  IVAALLRMLTVQPDLITDKGYLECTIKYAIDCGVIDQWLVARTRGFP  535


 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 3/112 (3%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEA++F+F++  L    M ST  KAI  SKK GG+IF+D+NLPLPLW+S +ET  
Sbjct  328  NIDVLKEAKMFYFSTHSLLDRNMRSTTLKAIKMSKKLGGVIFYDVNLPLPLWQSDEETKI  387

Query  523  VIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKI  377
             I+ AW  AD+IEV++ ELEFL      + ++ K N + ++   D +  + +
Sbjct  388  FIQEAWNLADVIEVTKQELEFLCGIKPTEEFDTKNNARSKFIHYDHEVVKPL  439



>ref|XP_008786156.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-2 [Phoenix dactylifera]
Length=215

 Score = 82.0 bits (201),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 12/119 (10%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            +  V   A++F+FNS      +M     +A+  SKKFGG IFFDLNLPLPLWKS +E   
Sbjct  33   DNGVWNMAKMFYFNSS--XDQSMRLRTMQAVKISKKFGGAIFFDLNLPLPLWKSSEEPKT  90

Query  523  VIKGAWEQADIIEVSRSELEFLL--------DEDHYEHKR--NYKPQYFAEDFQQTRKI  377
             I  AW  ADIIEV++ ELEFL         D   Y+  +  +YKP+   +   +  K+
Sbjct  91   FIWEAWNAADIIEVTKQELEFLCGIEPLEKFDTKDYDKSKFIHYKPKVLMQLXHENLKV  149


 Score = 68.6 bits (166),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L H+ LK LFVT+GT ++HYYT    G +   ED  ITPFT D + SGD ++A ++R LT
Sbjct  142  LXHENLKVLFVTNGTSKVHYYTEKDNGCLHEMEDXRITPFTGDMSVSGDFIIAALLRMLT  201

Query  159  TQPEM  145
             QP +
Sbjct  202  VQPHL  206



>gb|EEC71816.1| hypothetical protein OsI_04455 [Oryza sativa Indica Group]
Length=398

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VLKEAR+FHFNSEVL +P+M  TLF+AI  SKKFG  IFFDLNLPLPLW+SRDET E
Sbjct  295  NVDVLKEARVFHFNSEVLLTPSMEITLFRAIELSKKFGSKIFFDLNLPLPLWRSRDETKE  354

Query  523  VIKGAWEQADIIEVS  479
            +I  AW +ADIIEVS
Sbjct  355  LINKAWNEADIIEVS  369



>ref|XP_010313061.1| PREDICTED: probable fructokinase-5 [Solanum lycopersicum]
Length=325

 Score = 82.0 bits (201),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +  LWHDRLK L VTDG     Y+T SF+G V G      +  T D TG+GDA V  +
Sbjct  214  ETIMSLWHDRLKLLVVTDGEKGCRYFTKSFKGKVSG-----FSVKTVDTTGAGDAFVGSL  268

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +  +   P +F++++ L++ L+F+ + G IS    GA+   P+ +  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALKFSNACGAISTTQKGAIPALPSTADAQGL  318


 Score = 63.9 bits (154),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L +  + S    A+  +K  G L+ +D N+ LPLW S +   E
Sbjct  124  NLGLIKQAKIFHYGSISLITEPVRSAHMVAMKSAKDAGVLLSYDPNVRLPLWPSPEAARE  183

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W +AD I+VS  E+ FL  +D
Sbjct  184  GIKSIWNEADFIKVSDDEVNFLTQKD  209



>ref|XP_006362721.1| PREDICTED: putative fructokinase-5-like [Solanum tuberosum]
Length=325

 Score = 82.4 bits (202),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 61/110 (55%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWHDRLK L VTDG     Y+T SF+G V G         T D TG+GDA V  +
Sbjct  214  ETVMSLWHDRLKLLIVTDGEKGCRYFTKSFKGKVSG-----FPVKTVDTTGAGDAFVGSL  268

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +  +   P +F++++ L++ L+FA + G IS    GA+   P+ +  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALKFANACGAISTTQKGAIPALPSTADAQGL  318


 Score = 63.2 bits (152),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L +  + S    A+  +K  G L+ +D N+ LPLW S +   E
Sbjct  124  NLGLIKQAKIFHYGSISLITEPVRSAHMVAMKAAKDAGVLLSYDPNVRLPLWPSPEAARE  183

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             I+  W +AD I+VS  E+ FL  +D
Sbjct  184  GIRSIWNEADFIKVSDDEVNFLTQKD  209



>ref|XP_009602080.1| PREDICTED: putative fructokinase-5 [Nicotiana tomentosiformis]
Length=325

 Score = 87.4 bits (215),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWHDRLK L VTDG     YYT SF+G V G      +  T D TG+GDA V  +
Sbjct  214  ETVLSLWHDRLKLLVVTDGEKGCRYYTKSFKGKVSG-----FSVKTVDTTGAGDAFVGSL  268

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +  +   P +F++++ L++ LRFA + G IS    GA+   P+ S  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALRFANACGAISTTQKGAIPALPSTSDAQRL  318


 Score = 57.0 bits (136),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L +    S    A+  +K+ G L+ +D N+ LPLW S +   +
Sbjct  124  NLGLIKQAKIFHYGSISLITEPCRSAHMAAMKAAKEAGVLLSYDPNVRLPLWPSPEAARD  183

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W +AD I+VS  E+ FL  +D
Sbjct  184  NIKTIWNEADFIKVSDDEVNFLTQKD  209



>gb|EYU28879.1| hypothetical protein MIMGU_mgv1a003579mg [Erythranthe guttata]
Length=576

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            S E V+ LWH+ LK LFVT+GT ++HYYT  ++G V G ED  +TP+T D + +GD VVA
Sbjct  442  SPEIVSQLWHENLKILFVTNGTSKIHYYTKEYDGSVYGMEDAPLTPYTSDMSATGDGVVA  501

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            GIM+ LT QP +  ++  LER +++AI+ G+  QW      G+P +   +++
Sbjct  502  GIMKMLTVQPHLLLDKGYLERTIKYAINCGVTDQWLQARKLGYPPKEGMEDV  553


 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 74/119 (62%), Gaps = 10/119 (8%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  VL+EA++F+FN+  L      ST  +A+  SKK G L+F+DLNLPLPLW+S +ET +
Sbjct  338  NVDVLREAQMFYFNTFSLLDRNTRSTALQAVKISKKLGNLVFYDLNLPLPLWQSSEETKK  397

Query  523  VIKGAWEQADIIEVSRSELEFLL------DEDHYEHKRN----YKPQYFAEDFQQTRKI  377
             I+ AW  +DIIEV++ ELEFL       + D  ++ RN    Y P+  ++ + +  KI
Sbjct  398  FIQSAWNLSDIIEVTKQELEFLCGIIPSEEFDTRDNNRNKFTHYSPEIVSQLWHENLKI  456



>gb|AEK21796.1| fructokinase [Dimocarpus longan]
Length=336

 Score = 74.7 bits (182),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+ARIFH+ S  L +    ST   A+S +K+ GG++ +D NL LPLW S     + I 
Sbjct  136  IIKQARIFHYGSISLIAEPCKSTHLAAMSMAKRSGGILSYDPNLRLPLWPSEQAARDGIM  195

Query  514  GAWEQADIIEVSRSELEFLLDEDHY  440
              W+QADII++S  E+ FL   D +
Sbjct  196  SIWDQADIIKISEDEITFLTGGDDH  220


 Score = 68.2 bits (165),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G     +   + D TG+GDA V+GI+  L 
Sbjct  230  LYHPNLKLLIVTEGSKGCRYYTKEFKGRVPG-----VKSKSVDTTGAGDAFVSGILNCLA  284

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +   +F++++ L   L FA + G I+    GA+   PT+ A   L
Sbjct  285  SDLNLFKDEERLREALLFANACGAITVTERGAIPALPTKEAVLKL  329



>ref|XP_009783705.1| PREDICTED: putative fructokinase-5 [Nicotiana sylvestris]
Length=325

 Score = 85.5 bits (210),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LWHDRLK L VTDG     Y+T SF+G V G      +  T D TG+GDA V  +
Sbjct  214  ETVLSLWHDRLKLLVVTDGEKGCRYFTKSFKGKVSG-----FSVKTIDTTGAGDAFVGSL  268

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +  +   P +F++++ L++ LRFA + G IS    GA+   P+ S  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALRFANACGAISTTQKGAIPALPSTSDAQGL  318


 Score = 56.2 bits (134),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L +    S    A+  +K+ G L+ +D N+ LPLW S +   +
Sbjct  124  NLGLIKQAKIFHYGSISLITEPCRSAHMAAMKAAKEAGVLLSYDPNVRLPLWPSPEAARD  183

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             I+  W +AD I+VS  E+ FL  +D
Sbjct  184  NIRSIWNEADFIKVSDDEVNFLTQKD  209



>ref|XP_008790605.1| PREDICTED: fructokinase-1-like [Phoenix dactylifera]
Length=326

 Score = 75.5 bits (184),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A +FHF S  L +    S   +A+  +K+ G L+ +D+NL LPLW S  E  E
Sbjct  128  NLDLIRSAAVFHFGSISLIAEPCRSAHLRAMEVAKEAGALLSYDVNLRLPLWPSPAEARE  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYK  419
             I   W+QADII+VS  ELEFL DE   E +   K
Sbjct  188  QIMSIWDQADIIKVSDVELEFLTDEASVEDEVAMK  222


 Score = 65.9 bits (159),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = -2

Query  354  EEVA-PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  178
            +EVA  LW   LK L VT G     YYT  F G V   E   +     D TG+GDA +  
Sbjct  217  DEVAMKLWQPNLKLLLVTIGKKGCKYYTKDFHGAV---ESFAVQ--QVDTTGAGDAFIGS  271

Query  177  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            ++RK+       ++++ L   LRFA + G I+    GA+  FP ES    L E
Sbjct  272  LLRKIVEDKSALQDENKLREILRFANACGAITATKEGAIPSFPNESEVMQLLE  324



>ref|XP_009787481.1| PREDICTED: fructokinase-2 isoform X2 [Nicotiana sylvestris]
Length=208

 Score = 71.6 bits (174),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  9    NLEVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEARK  68

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W++AD+I+VS  ELEFL   D  +
Sbjct  69   QIKSIWDKADVIKVSDVELEFLTGSDKID  97


 Score = 68.6 bits (166),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  +
Sbjct  99   ESAMSLWHPNLKLLLVTLGDKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGAL  153

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  154  LTKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  203



>ref|XP_009787480.1| PREDICTED: fructokinase-2 isoform X1 [Nicotiana sylvestris]
Length=327

 Score = 71.2 bits (173),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  128  NLEVIRPAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEARK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W++AD+I+VS  ELEFL   D  +
Sbjct  188  QIKSIWDKADVIKVSDVELEFLTGSDKID  216


 Score = 68.2 bits (165),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  +
Sbjct  218  ESAMSLWHPNLKLLLVTLGDKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGAL  272

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  273  LTKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  322



>ref|XP_009605011.1| PREDICTED: fructokinase-2 [Nicotiana tomentosiformis]
Length=327

 Score = 71.2 bits (173),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  128  NLDVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEARK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W++AD+I+VS  ELEFL   D  +
Sbjct  188  QIKSIWDKADVIKVSDVELEFLTGSDKID  216


 Score = 67.8 bits (164),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  +
Sbjct  218  ESAMSLWHPNLKLLLVTLGEKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGAL  272

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  273  LTKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  322



>ref|XP_011074982.1| PREDICTED: probable fructokinase-5 [Sesamum indicum]
Length=325

 Score = 74.7 bits (182),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            + V  LWHD+LK L +TDG     Y+T SF+G V G      +  T D TG+GDA V  +
Sbjct  214  DAVMSLWHDQLKLLVITDGGKGCRYFTKSFKGKVDG-----FSVKTIDTTGAGDAFVGAL  268

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +  +   P + +++  L+  L FA + G IS    GA+   PT S  Q L
Sbjct  269  LVSIAKNPSIMQDEAKLKEALTFANACGAISTTRKGAIPALPTVSDAQAL  318


 Score = 63.9 bits (154),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A IFH+ S  L S    S    A+  +K+ G L+ +D N+ LPLW S     + IK
Sbjct  127  MIKQASIFHYGSISLISEPCRSAHMAAMKDAKEAGALLSYDPNVRLPLWPSAQAARDGIK  186

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W +AD I+VS  E+EFL  +D
Sbjct  187  SIWNKADFIKVSDDEVEFLTQKD  209



>gb|AIE16180.1| fructokinase [Nicotiana tabacum]
Length=327

 Score = 71.6 bits (174),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  128  NLEVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEARK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W++AD+I+VS  ELEFL   D  +
Sbjct  188  QIKSIWDKADVIKVSDVELEFLTGSDKID  216


 Score = 67.0 bits (162),  Expect(2) = 5e-24, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  +
Sbjct  218  ESAMSLWHPNLKLLLVTLGEKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGAL  272

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  LRFA + G I+    GA    PTES    L
Sbjct  273  LTKIVDDQSILEDEARLKEVLRFACACGAITTTKKGATPALPTESEALTL  322



>ref|XP_010999528.1| PREDICTED: probable fructokinase-5 [Populus euphratica]
Length=326

 Score = 72.4 bits (176),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 5/106 (5%)
 Frame = -2

Query  357  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  178
             E V  LWHDRLK L VTDG     Y+T SF+G V G    ++     D TG+GDA V  
Sbjct  215  EEVVLSLWHDRLKLLVVTDGEKGCRYFTKSFKGSVPGFSVKVV-----DTTGAGDAFVGS  269

Query  177  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  40
            ++  +     +F+N++ L+  L FA + G I     GA+   P+ S
Sbjct  270  LLFSVAKDTSIFDNEEKLKEALSFANACGAICTTQKGAIPALPSGS  315


 Score = 65.9 bits (159),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +LK+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S D   +
Sbjct  126  NMGLLKQAKVFHYGSISLISEPCRSAHLTAMKAAREAGILLSYDPNVRLPLWPSSDAARD  185

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W +AD I+VS  E+ FL   D
Sbjct  186  GIKSIWNEADFIKVSDDEVAFLTQGD  211



>gb|AIE16179.1| fructokinase [Nicotiana tabacum]
Length=384

 Score = 70.9 bits (172),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++++ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D   + I 
Sbjct  184  LIQKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADAARKGIL  243

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYE  437
              W+QAD+I+VS  E+ FL D ED Y+
Sbjct  244  SIWDQADVIKVSEDEITFLTDGEDAYD  270


 Score = 67.4 bits (163),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G     YYT +F G V G     I     D TG+GDA V G++  + 
Sbjct  278  LFHPNLKLLLVTEGGEGCRYYTKNFHGRVNG-----IKVTAVDTTGAGDAFVGGLLNSMA  332

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  333  SDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  373



>gb|AIL30508.1| fructokinase [Nicotiana tabacum]
Length=390

 Score = 70.5 bits (171),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++++ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D   + I 
Sbjct  184  LIQKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADAARKGIL  243

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYE  437
              W+QAD+I+VS  E+ FL D ED Y+
Sbjct  244  SIWDQADVIKVSEDEITFLTDGEDAYD  270


 Score = 67.4 bits (163),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G     YYT +F G V G     I     D TG+GDA V G++  + 
Sbjct  278  LFHPNLKLLLVTEGGEGCRYYTKNFHGRVNG-----IKVTAVDTTGAGDAFVGGLLNSMA  332

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  333  SDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  373



>gb|AAQ09999.1| putative fructokinase 2 [Petunia integrifolia subsp. inflata]
Length=328

 Score = 72.8 bits (177),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A+IFH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  129  NLDVIRSAKIFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEARK  188

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W++AD+I+VS +ELEFL   D  +
Sbjct  189  QIKSIWDKADVIKVSDNELEFLTGSDKID  217


 Score = 65.1 bits (157),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G     YYT +F G V G         T D TG+GD+ V  +
Sbjct  219  ESAMSLWHPNLKLLLVTLGEKGCRYYTKNFHGGVEG-----FHVKTVDTTGAGDSFVGAL  273

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  L FA + G I+    GA+   PTES    L
Sbjct  274  LTKIVDDQSILEDEARLKEVLTFACACGAITTTKKGAIPALPTESEALTL  323



>gb|AAQ10000.1| putative fructokinase 2 [Petunia integrifolia subsp. inflata]
Length=328

 Score = 72.8 bits (177),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A+IFH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  129  NLDVIRSAKIFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEARK  188

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W++AD+I+VS +ELEFL   D  +
Sbjct  189  QIKSIWDKADVIKVSDNELEFLTGSDKID  217


 Score = 65.1 bits (157),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G     YYT +F G V G         T D TG+GD+ V  +
Sbjct  219  ESAMSLWHPNLKLLLVTLGEKGCRYYTKNFHGGVEG-----FHVKTVDTTGAGDSFVGAL  273

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  L FA + G I+    GA+   PTES    L
Sbjct  274  LTKIVDDQSILEDEARLKEVLTFACACGAITTTKKGAIPALPTESEALTL  323



>ref|XP_008460045.1| PREDICTED: probable fructokinase-4 [Cucumis melo]
 gb|ADN34093.1| fructokinase [Cucumis melo subsp. melo]
Length=331

 Score = 70.5 bits (171),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +++ A+IFH+ S  L      S   KA+  +KK G L+ +D NL LPLW S +E  E IK
Sbjct  135  LIRSAKIFHYGSISLIVEPCRSAHIKAMDEAKKAGVLLSYDPNLRLPLWPSANEAREQIK  194

Query  514  GAWEQADIIEVSRSELEFLLDEDHYE  437
              W +ADII+VS  EL+FL  +D  +
Sbjct  195  SIWNKADIIKVSDEELKFLTQKDKVD  220


 Score = 66.2 bits (160),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 55/117 (47%), Gaps = 11/117 (9%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G     YYT +F G V         PF     D TG+GD+ V
Sbjct  222  ENAMSLWHDGLKLLLVTLGEQGCRYYTKNFRGCV--------DPFKVKAVDTTGAGDSFV  273

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPS  13
              ++ K+     + +++  L   LRFA + G I+    GA+   PTE+    L + S
Sbjct  274  GALLSKIVDDQSVLQDEKKLRDILRFANACGAITTTKKGAIPALPTEADVAALIKAS  330



>ref|XP_010526109.1| PREDICTED: probable fructokinase-4 [Tarenaya hassleriana]
Length=326

 Score = 72.4 bits (176),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 55/113 (49%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G     YYT +F G V         PF     D TG+GD+ V
Sbjct  218  ETALSLWHDNLKLLLVTLGDKGCRYYTKNFRGTV--------DPFRVNAVDTTGAGDSYV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++ KL     + E++  L   LRFA + G I+    GA+   PTE+  QNL
Sbjct  270  GALLCKLVDDRSILEDEPRLRDVLRFANACGAITTTKKGAIPALPTEAEVQNL  322


 Score = 64.3 bits (155),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  128  NLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEARK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL+FL   D  +
Sbjct  188  QILSIWDKAEVIKVSDEELQFLTGSDKID  216



>gb|AIL30505.1| fructokinase-2 [Nicotiana tabacum]
Length=327

 Score = 68.2 bits (165),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V+K A++FH+ S  L      S   KA+  +K+   L+ +D NL LPLW S +E  +
Sbjct  128  NLEVIKSAKVFHYGSINLIVEPCRSAHLKAMEVAKEARALLSYDPNLRLPLWPSAEEARK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W++AD+I+VS  ELEFL   D  +
Sbjct  188  QIKSIWDKADVIKVSDVELEFLTGSDKID  216


 Score = 68.2 bits (165),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  +
Sbjct  218  ESAMSLWHPNLKLLLVTLGDKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGAL  272

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  273  LTKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  322



>ref|XP_002321869.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
 gb|EEF05996.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
Length=349

 Score = 68.6 bits (166),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  242  LFHPNLKLLIVTEGSKGCRYYTKEFKGWVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  296

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +   +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  297  SNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKDAVLKL  341


 Score = 67.4 bits (163),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+ F A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  148  LLEQARIFHYGSISLISEPCRSSQFAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  207

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QAD+I++S  E+ FL   D
Sbjct  208  SIWDQADVIKISEEEITFLTGCD  230



>ref|XP_011041646.1| PREDICTED: probable fructokinase-7 isoform X1 [Populus euphratica]
Length=345

 Score = 68.6 bits (166),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  239  LFHPNLKLLIVTEGSKGCRYYTKEFKGWVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  293

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +   +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  294  SNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKDAVLKL  338


 Score = 67.4 bits (163),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+ F A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  145  LLEQARIFHYGSISLISEPCRSSQFAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  204

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QAD+I++S  E+ FL   D
Sbjct  205  SIWDQADVIKISEEEITFLTGCD  227



>ref|XP_011041647.1| PREDICTED: probable fructokinase-7 isoform X2 [Populus euphratica]
Length=329

 Score = 68.6 bits (166),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  223  LFHPNLKLLIVTEGSKGCRYYTKEFKGWVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  277

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +   +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  278  SNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKDAVLKL  322


 Score = 67.0 bits (162),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+ F A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  129  LLEQARIFHYGSISLISEPCRSSQFAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  188

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QAD+I++S  E+ FL   D
Sbjct  189  SIWDQADVIKISEEEITFLTGCD  211



>ref|XP_002318851.2| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
 gb|EEE97071.2| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
Length=351

 Score = 68.2 bits (165),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  240  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  294

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
                +FE++ +L   L FA + G ++    GA+   PT+ A   L E
Sbjct  295  FNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKLLE  341


 Score = 67.8 bits (164),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  146  LLEQARIFHYGSISLISEPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  205

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYEHK  431
              WEQAD+I++S  E+ FL   +DH + K
Sbjct  206  SIWEQADVIKISEEEITFLTGCDDHTDDK  234



>ref|XP_009618746.1| PREDICTED: fructokinase-1-like [Nicotiana tomentosiformis]
Length=385

 Score = 69.7 bits (169),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++ +ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D   + I 
Sbjct  185  LIHKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADAARKGIL  244

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYE  437
              W+QAD+I+VS  E+ FL D ED Y+
Sbjct  245  SIWDQADVIKVSEDEITFLTDGEDAYD  271


 Score = 65.5 bits (158),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G     YYT +F G V      +I     D TG+GDA V G++  + 
Sbjct  279  LFHPNLKLLLVTEGGEGCRYYTKNFHGRVN-----VIKVTAVDTTGAGDAFVGGLLNSMA  333

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  334  SDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  374



>ref|XP_002521094.1| fructokinase, putative [Ricinus communis]
 gb|EEF41245.1| fructokinase, putative [Ricinus communis]
Length=329

 Score = 76.6 bits (187),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 60/117 (51%), Gaps = 5/117 (4%)
 Frame = -2

Query  363  TSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  184
            T  E V  L+HDRLK L VTDG     Y+T SF+G V G      +  T D TG+GDA V
Sbjct  216  TKEEVVLSLYHDRLKLLIVTDGEKGCRYFTKSFKGKVSG-----YSVKTVDTTGAGDAFV  270

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPS  13
              ++  +     +FEN+  L+  L FA + G I     GA+   P+ S  Q L + S
Sbjct  271  GALLVSVAKDASIFENEGKLKEALTFANACGAICTTQKGAIPALPSTSDAQALIKSS  327


 Score = 58.2 bits (139),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L S    S    A+  +K  G L+ +D N+ LPLW S +   +
Sbjct  129  NMGLIKQAKIFHYGSISLISEPCRSAHMAAMKAAKAAGILLSYDPNVRLPLWPSHEAARD  188

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W +AD I+VS  E+ FL   D
Sbjct  189  GIKSIWNEADFIKVSDDEVAFLTQGD  214



>ref|XP_006443006.1| hypothetical protein CICLE_v10021105mg [Citrus clementina]
 ref|XP_006478719.1| PREDICTED: probable fructokinase-4-like [Citrus sinensis]
 gb|ESR56246.1| hypothetical protein CICLE_v10021105mg [Citrus clementina]
Length=329

 Score = 69.3 bits (168),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 53/110 (48%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G     YYT SF G V    D      T D TG+GDA V  +
Sbjct  221  ESALSLWHPNLKLLLVTLGEHGCRYYTKSFRGAV----DAFHVN-TVDTTGAGDAFVGAL  275

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + KL     + E++  L   L+FA + G I+    GA+   PTES   NL
Sbjct  276  LGKLVDDQSVLEDEPRLREILKFANACGAITTTKKGAIPALPTESEALNL  325


 Score = 65.5 bits (158),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   +A+  +K+ G L+ +D NL LPLW S +E  E
Sbjct  131  NLELIRSAKVFHYGSISLIVEPCRSAHLEAMKAAKEAGALLSYDPNLRLPLWPSPEEARE  190

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  ELEFL   D  +
Sbjct  191  QIMSIWDKAEVIKVSDVELEFLTGSDKID  219



>emb|CDY06000.1| BnaA09g37800D [Brassica napus]
Length=326

 Score = 69.3 bits (168),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 54/113 (48%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G    +YYT SF G V         PF     D TG+GD+ V
Sbjct  218  ETALSLWHDNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVNAVDTTGAGDSYV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++        + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  270  GALLCNFVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322


 Score = 65.5 bits (158),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAKK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D+ +
Sbjct  188  QILSIWDKAEVIKVSDEELMFLTGSDNVD  216



>ref|XP_010930218.1| PREDICTED: fructokinase-1-like [Elaeis guineensis]
Length=327

 Score = 69.3 bits (168),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 54/116 (47%), Gaps = 5/116 (4%)
 Frame = -2

Query  366  TTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAV  187
            T   + V  LWH  LK L VT G     YYT  F G V G     I     D TG+GDA 
Sbjct  215  TVEDDAVMNLWHPELKLLLVTLGGKGCKYYTKDFRGTVNG-----IAVKAIDTTGAGDAF  269

Query  186  VAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            V  ++RK+       ++++ L   LRFA + G I+    GA+   P E+    L E
Sbjct  270  VGAMLRKIADDQSALQDEEKLREVLRFANACGAITTTKRGAIPALPVEAEVLELLE  325


 Score = 65.5 bits (158),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K A IFHF S  L      ST   A+  +KK G L+ FD NL L LW+S      
Sbjct  129  NLDLIKRATIFHFGSISLIEEPCRSTQLAAMEIAKKEGALLSFDPNLRLRLWESPKVAQA  188

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
            +I   W+Q++II+VS +E+EFL ++D  E
Sbjct  189  LIMEIWKQSNIIKVSDAEVEFLTNKDTVE  217



>gb|ACN40355.1| unknown [Picea sitchensis]
Length=347

 Score = 72.4 bits (176),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = -2

Query  366  TTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAV  187
            + + E V  LWH +LK L VTDG     YYT SF G V       I+    D TG+GDA 
Sbjct  233  SNNDEVVMSLWHSKLKLLLVTDGPKGCRYYTKSFRGRVD-----TISVKAIDTTGAGDAF  287

Query  186  VAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            V G++ ++     + E++  L++ LR A + G I+    GA+   P +S    L
Sbjct  288  VGGVLNQIADDISVLEDEQRLKKALRLANACGAITATKKGAIPALPDKSTVLEL  341


 Score = 62.4 bits (150),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +++EA +FH+ S  L +    S    A++ +++ G L+ +D N+ LPLW S DE  + I 
Sbjct  150  LIREASVFHYGSISLIAEPTRSAHLAAMAIARQGGALLSYDPNVRLPLWPSADEARKGIL  209

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W++AD+I++S  E+ FL   D
Sbjct  210  SIWDEADLIKISDEEVGFLTGGD  232



>ref|XP_009782121.1| PREDICTED: fructokinase-1-like [Nicotiana sylvestris]
Length=390

 Score = 70.5 bits (171),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++++ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D   + I 
Sbjct  184  LIQKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADAARKGIL  243

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYE  437
              W+QAD+I+VS  E+ FL D ED Y+
Sbjct  244  SIWDQADVIKVSEDEITFLTDGEDAYD  270


 Score = 63.9 bits (154),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+   LK L VT+G     YYT +F G V G     I     D TG+GDA V G++  + 
Sbjct  278  LFRPNLKLLLVTEGGEGCRYYTKNFHGRVNG-----IKVTAVDTTGAGDAFVGGLLNSMA  332

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  333  SDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  373



>ref|XP_011030018.1| PREDICTED: probable fructokinase-7 isoform X1 [Populus euphratica]
Length=351

 Score = 67.4 bits (163),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  146  LLEQARIFHYGSISLISDPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  205

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYEHK  431
              WEQAD+I++S  E+ FL   +DH + K
Sbjct  206  SIWEQADVIKISEEEITFLTGYDDHTDDK  234


 Score = 67.0 bits (162),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  240  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  294

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
                +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  295  FNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKL  339



>ref|XP_007201273.1| hypothetical protein PRUPE_ppa008482mg [Prunus persica]
 gb|EMJ02472.1| hypothetical protein PRUPE_ppa008482mg [Prunus persica]
 gb|AGH25527.1| fructokinase [Prunus persica]
Length=330

 Score = 71.6 bits (174),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LWHD LK L VTDG     YYT  F+G V G      +    D TG+GDA V   + 
Sbjct  218  VLSLWHDNLKLLVVTDGEKGCRYYTKKFKGKVTG-----FSVKAVDTTGAGDAFVGSFLL  272

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             +     +FE++  L+  L F+ + G I     GA+   PT+SA   L
Sbjct  273  SMAKDMSIFEDETKLKEALSFSNACGAICTTQKGAIPALPTQSAALEL  320


 Score = 62.8 bits (151),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L S    S    A+  +K  G ++ +D N+ LPLW S D   E
Sbjct  126  NMPLIKQAKIFHYGSISLISEPCRSAHMAAMKAAKDAGIMLSYDPNVRLPLWPSADAARE  185

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W QAD I+VS  E++FL   D
Sbjct  186  GIKSIWNQADFIKVSDDEVQFLTQGD  211



>ref|XP_011016155.1| PREDICTED: probable fructokinase-7 isoform X1 [Populus euphratica]
Length=351

 Score = 67.4 bits (163),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  146  LLEQARIFHYGSISLISEPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  205

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYEHK  431
              WEQAD+I++S  E+ FL   +DH + K
Sbjct  206  SIWEQADVIKISEEEITFLTGYDDHTDDK  234


 Score = 67.0 bits (162),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  240  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  294

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
                +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  295  FNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKL  339



>ref|XP_011030019.1| PREDICTED: probable fructokinase-7 isoform X2 [Populus euphratica]
Length=335

 Score = 67.4 bits (163),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  130  LLEQARIFHYGSISLISDPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  189

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYEHK  431
              WEQAD+I++S  E+ FL   +DH + K
Sbjct  190  SIWEQADVIKISEEEITFLTGYDDHTDDK  218


 Score = 67.0 bits (162),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  224  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  278

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
                +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  279  FNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKL  323



>ref|XP_011016156.1| PREDICTED: probable fructokinase-7 isoform X2 [Populus euphratica]
Length=335

 Score = 67.4 bits (163),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S +   E I 
Sbjct  130  LLEQARIFHYGSISLISEPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEAAREGIM  189

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYEHK  431
              WEQAD+I++S  E+ FL   +DH + K
Sbjct  190  SIWEQADVIKISEEEITFLTGYDDHTDDK  218


 Score = 67.0 bits (162),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G++  L 
Sbjct  224  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKP--VDTTGAGDAFVGGMLSNLA  278

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
                +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  279  FNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKL  323



>gb|AAM64445.1| fructokinase-like protein [Arabidopsis thaliana]
Length=326

 Score = 68.2 bits (165),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 54/113 (48%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWH  LK L VT G     YYT SF G V         PF     D TG+GD+ V
Sbjct  218  ETALSLWHSNLKLLLVTLGEKGCSYYTKSFRGSV--------DPFHVDAVDTTGAGDSFV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++ K+     + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  270  GALLCKIVDDRAVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322


 Score = 65.9 bits (159),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAQK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D  +
Sbjct  188  QILSIWDKAEVIKVSDEELMFLTGSDKVD  216



>ref|XP_009116612.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
Length=326

 Score = 69.7 bits (169),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 55/113 (49%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G    +YYT SF G V         PF     D TG+GD+ V
Sbjct  218  ETALSLWHDNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVNAVDTTGAGDSYV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++  +     + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  270  GALLCNIVDDRAVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322


 Score = 64.3 bits (155),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  128  NLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSEEEAKK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D+ +
Sbjct  188  QILSIWDKAEVIKVSDEELMFLTGSDNVD  216



>ref|XP_003597523.1| Fructokinase [Medicago truncatula]
 gb|AES67774.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=329

 Score = 70.1 bits (170),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S DE  +
Sbjct  132  NLELIRSAKVFHYGSISLIVEPCRSAHLKALEVAKEAGCLLSYDPNLRLPLWPSADEARK  191

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   WE+AD+I+VS +ELEFL   D  +
Sbjct  192  QILSIWEKADLIKVSDNELEFLTGSDKID  220


 Score = 63.9 bits (154),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 50/105 (48%), Gaps = 5/105 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            LWH  LK L VT G     YYT +F G V G         T D TG+GD+ V  ++ K+ 
Sbjct  227  LWHPNLKLLLVTLGEHGARYYTKNFHGQVDG-----FKVNTVDTTGAGDSFVGALLAKIV  281

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
                + E++  L   L+FA + G I+    GA+   P E    NL
Sbjct  282  DDQAILEDESRLREVLKFANACGAITTTKKGAIPALPKEEDVLNL  326



>emb|CDX98377.1| BnaC06g17380D [Brassica napus]
Length=326

 Score = 68.2 bits (165),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 52/113 (46%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G     YYT SF G V         PF   T D TG+GD+ V
Sbjct  218  ETALSLWHDNLKLLLVTLGEKGCKYYTKSFHGSV--------DPFHVNTVDTTGAGDSFV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++  +     + E +  L   LRFA + G I+    GA+   PT S  Q L
Sbjct  270  GALLSNIVDDSTILEEEARLREVLRFANACGAITTTKKGAIPALPTVSEVQTL  322


 Score = 65.5 bits (158),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAKK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D+ +
Sbjct  188  QILSIWDKAEVIKVSDDELMFLTGSDNVD  216



>ref|XP_010252312.1| PREDICTED: probable fructokinase-5 isoform X1 [Nelumbo nucifera]
Length=369

 Score = 67.0 bits (162),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LW++RLK L VTDG     Y+T +F+G + G      +  T D TG+GDA V   + 
Sbjct  227  VLSLWYERLKLLVVTDGEKGCRYFTKNFKGQING-----FSVNTIDTTGAGDAFVGAFLF  281

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             +     +FE+++ L+  L FA + G IS    GA+   P  SA   L
Sbjct  282  LVARDTAIFEDEEKLKEALLFANARGAISTTRKGAIPALPNTSAALKL  329


 Score = 66.6 bits (161),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L S    S  F A   +K+ G L+ +D NL LPLW S +   +
Sbjct  135  NLGLIKQAKIFHYGSISLISEPCRSAHFAATDAAKRAGALLSYDPNLRLPLWPSAEAARQ  194

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEH  434
             I   W +AD I+VS  E+ FL   D  + 
Sbjct  195  GIMSIWNEADFIKVSDDEVAFLTQGDPMDE  224



>ref|XP_004306875.1| PREDICTED: probable fructokinase-7 [Fragaria vesca subsp. vesca]
Length=366

 Score = 74.3 bits (181),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G     YYT  F+G V G     I     D TG+GD+ V  ++  L 
Sbjct  261  LYHSNLKLLLVTEGPAGCRYYTKEFKGKVAG-----IKADCVDTTGAGDSFVGSVLNSLA  315

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            + PE+F+N+  L   L+FA + G ++    GA+   PT+ A
Sbjct  316  SDPELFKNEKQLTEALKFANACGALTVEKKGAIPALPTKEA  356


 Score = 59.3 bits (142),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A IFH+ S  L      S    A+  +K+ G ++ +D NL LPLW S +   +
Sbjct  164  NVDLIKKASIFHYGSISLIEEPCRSAHLAAMDIAKQAGCILSYDPNLRLPLWPSAEAARK  223

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             I   W  ADII+VS  E+ FL   D
Sbjct  224  GIMSIWNLADIIKVSEEEITFLTGGD  249



>ref|XP_002511766.1| fructokinase, putative [Ricinus communis]
 gb|EEF50435.1| fructokinase, putative [Ricinus communis]
Length=381

 Score = 68.2 bits (165),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT +F G V G +   +     D TG+GDA V GI+ KL 
Sbjct  276  LFHPNLKLLLVTEGSEGCRYYTQAFNGKVAGVKVDAV-----DTTGAGDAFVGGILSKLA  330

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +   +++++  L   L FA + G I+    GA+   PT+ A
Sbjct  331  SDMNLYKDEKKLSEALLFANACGAITVTERGAIPALPTKEA  371


 Score = 65.5 bits (158),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A +FH+ S  L      S    A+  +KK G ++ +D NL LPLW S +   E I 
Sbjct  182  LIKKASVFHYGSISLIHEPCKSAHLAAMEIAKKAGCILSYDPNLRLPLWPSAEAAREGIM  241

Query  514  GAWEQADIIEVSRSELEFL  458
              W+QADII+VS  E+EFL
Sbjct  242  SVWKQADIIKVSEEEIEFL  260



>gb|KDP41134.1| hypothetical protein JCGZ_03625 [Jatropha curcas]
Length=325

 Score = 74.3 bits (181),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -2

Query  360  SREEVA-PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  184
            S+EEVA  LWH+ LK L VTDG     Y+T SF+G V G      +  T D TG+GD+ V
Sbjct  212  SKEEVALQLWHEGLKLLVVTDGEKGCRYFTKSFKGKVAG-----FSVKTVDTTGAGDSFV  266

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++  +     +F+N++ L+  L FA + G I     GA+   P+ S  Q L
Sbjct  267  GSLLCSVAKDTSIFDNEEKLKEALTFANACGAICTTQKGAIPALPSPSDAQAL  319


 Score = 58.9 bits (141),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L +    S    A+  +K  G L+ +D NL LPLW S D   +
Sbjct  125  NLDLIKQAKIFHYGSISLITEPCRSAHMAAMKAAKAAGVLLSYDPNLRLPLWPSSDAARK  184

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W++AD I+VS  E+ FL   D
Sbjct  185  GIKSIWKEADFIKVSDEEVAFLTQGD  210



>ref|XP_008800140.1| PREDICTED: fructokinase-1-like [Phoenix dactylifera]
Length=327

 Score = 67.4 bits (163),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 54/112 (48%), Gaps = 5/112 (4%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            + V  LWH  LK L VT G     YYT  F G V G   + + P   D TG+GDA V  +
Sbjct  219  DAVMSLWHPELKLLLVTLGGKGCKYYTKDFRGTVKG---IAVKP--VDTTGAGDAFVGAM  273

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            +RK+       +++  L   LRFA + G I+    GA+   P E+    L E
Sbjct  274  LRKIADDQSTLQDEKKLTEVLRFANACGAITTTKRGAIPALPKEAEVLELLE  325


 Score = 65.9 bits (159),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A IFH+ S  L      ST   A+  +KK G L+ FD NL L LW+S  +   
Sbjct  129  NLDLVRRATIFHYGSISLIEEPCRSTQLAAMEIAKKAGALLSFDPNLRLRLWESPKDAQA  188

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
            +I   W+Q++II+VS +E+EFL ++D  E
Sbjct  189  LIMRIWKQSNIIKVSDAEVEFLTNKDAVE  217



>emb|CDP08915.1| unnamed protein product [Coffea canephora]
Length=381

 Score = 71.2 bits (173),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G     YYT  F G V G +   +     D TG+GDA V G++  L 
Sbjct  276  LYHPNLKLLLVTEGPEGCRYYTKEFHGRVHGVKVQAV-----DTTGAGDAFVGGLLNSLA  330

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            T P++++N+  L+  L FA   G I+    GA+   PT+ A
Sbjct  331  TDPDLYKNEKKLQEALLFANGCGAITVTEKGAIPALPTKEA  371


 Score = 61.6 bits (148),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +++++ IFH+ S  L      ST   A+  +K+ G ++ +D NL LPLW S +   + I 
Sbjct  182  LIRKSCIFHYGSISLIEEPCRSTHLAALKVAKEAGCILSYDPNLRLPLWPSAEAARQGIM  241

Query  514  GAWEQADIIEVSRSELEFLL-DEDHYEHKRNYKPQY  410
              W+QAD+I++S  E+ FL   +D Y+    +K  Y
Sbjct  242  SIWDQADVIKISEEEITFLTGGDDAYDDNVVFKKLY  277



>emb|CDX71907.1| BnaC08g29670D [Brassica napus]
Length=326

 Score = 67.4 bits (163),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 54/113 (48%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWH  LK L VT G    +YYT SF G V         PF     D TG+GD+ V
Sbjct  218  ETALSLWHSNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVNAVDTTGAGDSYV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++  +     + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  270  GALLCNIVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322


 Score = 65.9 bits (159),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKESGALLSYDPNLRLPLWPSKEEAKK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D+ +
Sbjct  188  QILSIWDKAEVIKVSEEELMFLTGSDNVD  216



>ref|XP_010252313.1| PREDICTED: fructokinase-2 isoform X2 [Nelumbo nucifera]
 ref|XP_010252314.1| PREDICTED: fructokinase-2 isoform X2 [Nelumbo nucifera]
Length=312

 Score = 67.0 bits (162),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LW++RLK L VTDG     Y+T +F+G + G      +  T D TG+GDA V   + 
Sbjct  170  VLSLWYERLKLLVVTDGEKGCRYFTKNFKGQING-----FSVNTIDTTGAGDAFVGAFLF  224

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             +     +FE+++ L+  L FA + G IS    GA+   P  SA   L
Sbjct  225  LVARDTAIFEDEEKLKEALLFANARGAISTTRKGAIPALPNTSAALKL  272


 Score = 66.2 bits (160),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 49/90 (54%), Gaps = 0/90 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L S    S  F A   +K+ G L+ +D NL LPLW S +   +
Sbjct  78   NLGLIKQAKIFHYGSISLISEPCRSAHFAATDAAKRAGALLSYDPNLRLPLWPSAEAARQ  137

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEH  434
             I   W +AD I+VS  E+ FL   D  + 
Sbjct  138  GIMSIWNEADFIKVSDDEVAFLTQGDPMDE  167



>ref|XP_010469311.1| PREDICTED: probable fructokinase-4 [Camelina sativa]
Length=326

 Score = 68.6 bits (166),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 54/113 (48%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWH  LK L VT G     YYT SF G V         PF     D TG+GDA V
Sbjct  218  ETALSLWHSNLKLLLVTLGDKGCRYYTKSFRGSV--------DPFHVNAVDTTGAGDAYV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++ K+     + E++  L   LRFA + G I+    GA+   PTE+  Q+L
Sbjct  270  GALLCKIVDDRAVLEDEPRLREVLRFANACGAITTTKKGAIPALPTEAEVQSL  322


 Score = 64.7 bits (156),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAQK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D  +
Sbjct  188  QILSIWDKAEVIKVSDEELMFLTGSDKVD  216



>ref|XP_006341727.1| PREDICTED: putative fructokinase-5-like [Solanum tuberosum]
Length=385

 Score = 67.0 bits (162),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 1/87 (1%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++++ARIFH+ S  L +    S    A+  +K  G ++ +D NL LPLW S +   E I 
Sbjct  185  LIQKARIFHYGSISLIAEPCRSAHLAAMETAKNAGCILSYDPNLRLPLWPSAEAAREGIL  244

Query  514  GAWEQADIIEVSRSELEFLLD-EDHYE  437
              W+QADII+VS  E+ FL + ED Y+
Sbjct  245  SIWDQADIIKVSEDEITFLTNGEDAYD  271


 Score = 65.9 bits (159),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G     YYT +F G V G +   +     D TG+GDA V G++  + 
Sbjct  279  LFHSNLKLLLVTEGGDGCRYYTKNFHGRVNGVKVTAV-----DTTGAGDAFVGGLLNSMA  333

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            + P+++ ++  L   L FA   G I+    GA+   PT+ A
Sbjct  334  SDPDIYMDEKKLRDALLFANGCGAITVTEKGAIPALPTKEA  374



>ref|XP_010907694.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-1-like [Elaeis guineensis]
Length=327

 Score = 69.7 bits (169),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A IFHF S  L +    S   KA+  +K+ G L+ +D+NL L LW S  E  E
Sbjct  128  NLDLIRSATIFHFGSVSLIAEPCRSAHLKAMEVAKEAGALLSYDVNLRLLLWPSPAEARE  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDE  449
             I   W+QADII+VS +ELEFL  E
Sbjct  188  QIMSIWDQADIIKVSDAELEFLTGE  212


 Score = 63.2 bits (152),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 54/113 (48%), Gaps = 6/113 (5%)
 Frame = -2

Query  354  EEVA-PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  178
            +E+A  LWH  LK L VT G     YY   F GVV   E   +     D TG+GDA +  
Sbjct  218  DEIAMKLWHPSLKLLLVTIGEKGCKYYAKDFHGVV---ESFAVQ--QVDTTGAGDAFMGS  272

Query  177  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            ++RK+       +++  L   LRF+ + G I+    GA+   P ES    L E
Sbjct  273  LLRKIVEDKSALQDEKKLREVLRFSNACGAITTTKKGAIPSLPNESEVMQLLE  325



>ref|XP_009396809.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=324

 Score = 68.6 bits (166),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++++A IFH+ S  L +    S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  126  NLDLIRKAAIFHYGSISLITEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWTSPEEARK  185

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W +ADII+VS  ELEFL   D  E
Sbjct  186  QILSIWNEADIIKVSDVELEFLTGHDSVE  214


 Score = 64.3 bits (155),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E +A LW   LK L VT G     YYT  F G V        T    D TG+GDA V  +
Sbjct  216  EVIAQLWRPSLKLLLVTLGEKGCKYYTKDFHGAVAS-----FTVEQVDTTGAGDAFVGAL  270

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPS  13
            +R++   P   +++  L   LRFA + G I+    GA+   P  +    L E +
Sbjct  271  LRRIVEDPSALQDEKKLREVLRFANACGAITTTKKGAIPSLPNVAEAMRLFESA  324



>ref|XP_004145029.1| PREDICTED: probable fructokinase-4-like [Cucumis sativus]
 ref|XP_004153919.1| PREDICTED: probable fructokinase-4-like [Cucumis sativus]
 ref|XP_004160686.1| PREDICTED: probable fructokinase-4-like [Cucumis sativus]
 gb|KGN46299.1| hypothetical protein Csa_6G080910 [Cucumis sativus]
Length=331

 Score = 68.6 bits (166),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +++ A+IFH+ S  L      S   KA+  +KK G L+ +D NL LPLW S +E  E IK
Sbjct  135  LIRSAKIFHYGSISLIVEPCRSAHIKAMDEAKKAGVLLSYDPNLRLPLWPSANEAREQIK  194

Query  514  GAWEQADIIEVSRSELEFLLDEDHYE  437
              W +ADII+VS  EL+FL  ++  +
Sbjct  195  SIWNKADIIKVSDEELKFLTQKEKVD  220


 Score = 64.3 bits (155),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 55/117 (47%), Gaps = 11/117 (9%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G     YYT +F G V         PF     D TG+GD+ V
Sbjct  222  ENAMSLWHDGLKLLLVTLGEQGCRYYTKNFRGSV--------DPFKVKAVDTTGAGDSFV  273

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPS  13
              ++ K+     + +++  L   LRFA + G I+    GA+   P+E+    L + S
Sbjct  274  GALLTKIVDDQSVLQDEKKLRDILRFANACGAITTTKKGAIPALPSEADVAALIKAS  330



>ref|XP_010696263.1| PREDICTED: probable fructokinase-5 [Beta vulgaris subsp. vulgaris]
Length=322

 Score = 66.6 bits (161),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 5/114 (4%)
 Frame = -2

Query  366  TTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAV  187
             T  E +  LW D LK L VTDG     Y+T  F+G V G      +    D TG+GDA 
Sbjct  209  ATKEEVIKTLWFDGLKLLLVTDGEKGCRYFTKDFKGSVKG-----FSVKAIDTTGAGDAF  263

Query  186  VAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            V   +  L   P + ++++ L+  L  + + G I     GA+   P+ S  Q+L
Sbjct  264  VGSFLYSLAKDPSILQDENKLKEALTLSNACGAICTTQKGAIPALPSLSQAQDL  317


 Score = 66.2 bits (160),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A++FH+ S  L +    S    A+  +K+ G  + +D N+ LPLW S +   E
Sbjct  123  NLDLIKQAKVFHYGSISLITEPCRSAHIAAMKAAKEAGVTLSYDPNVRLPLWSSPEAARE  182

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W QADII+VS  E+EFL   D
Sbjct  183  GIKSIWNQADIIKVSDDEVEFLTQGD  208



>ref|XP_008234319.1| PREDICTED: fructokinase-1 [Prunus mume]
Length=358

 Score = 67.0 bits (162),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++++ARIFH+ S  L      ST   A+  +KK G ++ +D NL LPLW S +   + I 
Sbjct  157  LIQQARIFHYGSISLIDEPCRSTHLAAMRIAKKSGCILSYDPNLRLPLWPSEEAARKGIM  216

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QADII++S  E+ FL   D
Sbjct  217  SIWDQADIIKISEDEITFLTGGD  239


 Score = 65.9 bits (159),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F G V G   V + P   D TG+GDA V+G++  + 
Sbjct  251  LFHPNLKLLVVTEGSEGCRYYTQKFRGRVAG---VKVKP--VDTTGAGDAFVSGVLNSIA  305

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +   +F+N+  L   L FA + G ++    GA+   PT  A
Sbjct  306  SDLSLFQNEQGLREALLFANACGALTVTERGAIPAMPTREA  346



>ref|XP_007033923.1| PfkB-like carbohydrate kinase family protein [Theobroma cacao]
 gb|EOY04849.1| PfkB-like carbohydrate kinase family protein [Theobroma cacao]
Length=328

 Score = 68.6 bits (166),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 54/95 (57%), Gaps = 0/95 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ +++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S DE  +
Sbjct  130  NLDLIRSSKVFHYGSISLIVEPCRSAHLKAMEVAKQSGALLSYDPNLRLPLWPSADEARK  189

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYK  419
             I   W++AD+I+VS  ELEFL   D  + +   K
Sbjct  190  QILSIWDKADVIKVSDVELEFLTGSDKIDDETAMK  224


 Score = 63.9 bits (154),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 51/105 (49%), Gaps = 5/105 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  L  L VT G     YYT +F G V    D      T D TG+GD+ V  +
Sbjct  220  ETAMKLWHPNLTLLLVTLGEKGSRYYTKNFHGSV----DAFHVN-TVDTTGAGDSFVGAL  274

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  40
            + K+   P + EN+  L   L+FA + G I+    GA+   PTE+
Sbjct  275  LCKIVEDPTILENESKLREVLKFANACGAITTTKKGAIPALPTEA  319



>ref|XP_009370536.1| PREDICTED: putative fructokinase-5 [Pyrus x bretschneideri]
Length=327

 Score = 71.6 bits (174),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 6/114 (5%)
 Frame = -2

Query  363  TSREEVA-PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAV  187
            + +E+V   LWHD LK L VTDG     YYT  F+G V G      +    D TG+GD+ 
Sbjct  212  SEKEDVVLSLWHDNLKLLVVTDGEKGCRYYTKKFKGKVAG-----FSVKAVDTTGAGDSF  266

Query  186  VAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            V   +  +     +FE++  L+  L FA + G I     GA+   PT+S  + L
Sbjct  267  VGSFLLSMANDMSIFEDEAKLKEALSFANACGAICTTQKGAIPALPTQSDAREL  320


 Score = 60.8 bits (146),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L +    S    A+  +K+ G L+ +D N+ LPLW S D   +
Sbjct  126  NMGLIKQAKIFHYGSISLIAEPCRSAHMAAMKAAKEAGVLLSYDPNVRLPLWPSADAARQ  185

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W QAD I+VS  E+ FL   D
Sbjct  186  EIKSIWNQADFIKVSDDEVNFLTQGD  211



>gb|AFO84081.1| fructokinase [Actinidia chinensis]
Length=329

 Score = 68.2 bits (165),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A+IFH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +E  E
Sbjct  131  NLDLIRSAKIFHYGSISLIVEPCRSAHLKAMEVAKDAGALLSYDPNLRLPLWPSAEEARE  190

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS +ELEFL   D  +
Sbjct  191  QIMSIWDKAEVIKVSDNELEFLTGSDKID  219


 Score = 64.3 bits (155),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 53/110 (48%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G     YYT SF G V    D      T D TG+GDA +  +
Sbjct  221  ESAMSLWHPNLKLLLVTLGEKGCRYYTKSFHGSV----DAFHVK-TVDTTGAGDAFIGAL  275

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L   L+FA + G I+    GA+   PTES   +L
Sbjct  276  LCKMVDDRSVIEDEARLREILKFANACGAITTTKKGAIPALPTESDVLSL  325



>emb|CDX67798.1| BnaA07g18380D [Brassica napus]
Length=326

 Score = 67.4 bits (163),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 53/113 (47%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G     YYT SF G V         PF   T D TG+GD+ V
Sbjct  218  ETALSLWHDNLKLLLVTLGEKGCKYYTKSFRGSV--------DPFHVNTVDTTGAGDSFV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++  +     + E++  L   LRFA + G I+    GA+   PT S  Q L
Sbjct  270  GALLCNIVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTVSEVQTL  322


 Score = 65.1 bits (157),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAKK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D+ +
Sbjct  188  QILSIWDKAELIKVSDEELMFLTGSDNVD  216



>gb|AJK93569.1| fructokinase [Manihot esculenta]
Length=370

 Score = 66.6 bits (161),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT +F+G V+G     +     D TG+GDA + G++ KL 
Sbjct  262  LFHPNLKLLLVTEGSGGCQYYTKAFKGKVLG-----VKVDAVDTTGAGDAFMGGLLSKLA  316

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESAT  34
            +   +++++  L   L FA + G I+    GA+   PT+ A 
Sbjct  317  SDLNLYKDEKKLREALLFANACGAITVTQKGAIPSLPTKEAV  358


 Score = 65.5 bits (158),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++++A IFH+ S  L +    S    A+  +K+ G ++ +D NL LPLW S +   + I 
Sbjct  168  LIRKASIFHYGSISLINEPCKSAHLAAMDIAKRAGCILSYDPNLRLPLWPSANAARDGIM  227

Query  514  GAWEQADIIEVSRSELEFLLDEDH  443
              W QADII++S  E+EFL++ D+
Sbjct  228  SIWNQADIIKISGEEMEFLIEGDN  251



>ref|XP_009104208.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
Length=326

 Score = 66.6 bits (161),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 52/113 (46%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWHD LK L VT G     YYT SF G V         PF   T D TG+GD+ V
Sbjct  218  ETALSLWHDNLKLLLVTLGEKGCKYYTKSFRGSV--------DPFHVNTVDTTGAGDSFV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++  +     + E +  L   LRFA + G I+    GA+   PT S  Q L
Sbjct  270  GALLCNIVDDRSVLEEEARLREVLRFANACGAITTTKKGAIPALPTVSEVQTL  322


 Score = 65.5 bits (158),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAKK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D+ +
Sbjct  188  QILSIWDKAEVIKVSDEELMFLTGSDNVD  216



>ref|XP_007218097.1| hypothetical protein PRUPE_ppa006628mg [Prunus persica]
 gb|EMJ19296.1| hypothetical protein PRUPE_ppa006628mg [Prunus persica]
Length=402

 Score = 66.6 bits (161),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++++ARIFH+ S  L      ST   A+  +KK G ++ +D NL LPLW S +   + I 
Sbjct  201  LIQQARIFHYGSISLIDEPCRSTHLAAMRIAKKSGCILSYDPNLRLPLWPSEEAARKGIM  260

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QADII++S  E+ FL   D
Sbjct  261  SIWDQADIIKISEDEITFLTGGD  283


 Score = 65.5 bits (158),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 54/101 (53%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F G V G   V + P   D TG+GDA V+G++  + 
Sbjct  295  LFHPNLKLLVVTEGSEGCRYYTQKFRGRVAG---VKVKP--VDTTGAGDAFVSGVLNSIA  349

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +   +F+N+  L   L FA + G ++    GA+   PT  A
Sbjct  350  SDLSLFQNEQGLREALLFANACGALTVTERGAIPAMPTREA  390



>ref|NP_191507.1| probable fructokinase-4 [Arabidopsis thaliana]
 sp|Q9M1B9.1|SCRK4_ARATH RecName: Full=Probable fructokinase-4 [Arabidopsis thaliana]
 emb|CAB75445.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|ABI49475.1| At3g59480 [Arabidopsis thaliana]
 gb|AEE79930.1| probable fructokinase-4 [Arabidopsis thaliana]
Length=326

 Score = 66.2 bits (160),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 53/113 (47%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWH  LK L VT G     YYT SF G V         PF     D TG+GD+ V
Sbjct  218  ETALSLWHSNLKLLLVTLGEKGCRYYTKSFRGSV--------DPFHVDAVDTTGAGDSFV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++ K+     + E++  L   LR A + G I+    GA+   PTES  Q+L
Sbjct  270  GALLCKIVDDRAVLEDEARLREVLRLANACGAITTTKKGAIPALPTESEVQSL  322


 Score = 65.9 bits (159),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAQK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D  +
Sbjct  188  QILSIWDKAEVIKVSDEELMFLTGSDKVD  216



>ref|XP_001762258.1| predicted protein [Physcomitrella patens]
 gb|EDQ73050.1| predicted protein [Physcomitrella patens]
Length=393

 Score = 68.2 bits (165),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +LK+A I H+ S  L +    ST  +A+  +K+ G L+ +D NL L LW S     E IK
Sbjct  142  LLKQASILHYGSISLITEPSRSTHLEAMRIAKEAGALLSYDPNLRLALWPSAAAAKEGIK  201

Query  514  GAWEQADIIEVSRSELEFLLDEDHYEHKRNYK  419
              WE+ADII+VS  E+ FL D D  + + N K
Sbjct  202  SIWERADIIKVSDEEVVFLTDGDPKDDQNNMK  233


 Score = 63.9 bits (154),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 7/112 (6%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            ++H R K + VT+G     YYTP F G V G +  ++     D TG+GDA  AG++ +L 
Sbjct  234  MFHPRCKLMLVTEGGEGCRYYTPKFRGHVNGVKVQVV-----DTTGAGDAFCAGLLSQLA  288

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL--KEPSL  10
              P + +++  L   L FA + G I+    GA+   P +     L  K P L
Sbjct  289  VVPSIIDDEPKLRNALTFANACGAITTTERGAIPALPDKDTVLRLIRKTPRL  340



>ref|XP_002876506.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52765.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=326

 Score = 67.4 bits (163),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 54/113 (48%), Gaps = 11/113 (10%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVV  184
            E    LWH  LK L VT G     YYT SF G V         PF     D TG+GD+ V
Sbjct  218  ETALSLWHSNLKLLLVTLGDKGCRYYTKSFRGSV--------DPFHVNAVDTTGAGDSYV  269

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++ K+     + E++  L   LR+A + G I+    GA+   PTES  Q+L
Sbjct  270  GALLCKIVDDRAVLEDEARLREVLRYANACGAITTTKKGAIPALPTESEVQSL  322


 Score = 64.7 bits (156),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E  +
Sbjct  128  NLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAQK  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++A++I+VS  EL FL   D  +
Sbjct  188  QILSIWDKAEVIKVSDEELMFLTGSDKVD  216



>ref|XP_007143920.1| hypothetical protein PHAVU_007G113500g [Phaseolus vulgaris]
 gb|ESW15914.1| hypothetical protein PHAVU_007G113500g [Phaseolus vulgaris]
Length=327

 Score = 69.7 bits (169),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 51/101 (50%), Gaps = 5/101 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LWHDRLK L VTDG     Y+T +F+G V G      +    D TG+GD+ V  I+ 
Sbjct  218  VMSLWHDRLKLLLVTDGEKGCRYFTKNFKGRVTG-----FSVKAVDTTGAGDSFVGAILT  272

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPT  46
             +     +F+N+  L   L FA + G +     GA+   PT
Sbjct  273  AVARDASIFDNEQKLREALMFANACGAMCTTQKGAIPALPT  313


 Score = 62.0 bits (149),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S +    
Sbjct  126  NMGLIKQAKVFHYGSISLISEPCRSAHLAAMKVARESGALLSYDPNVRLPLWPSEEAARS  185

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W  AD I+VS  E++FL   D
Sbjct  186  GIKSIWFDADFIKVSDDEVQFLTQGD  211



>ref|XP_008777085.1| PREDICTED: fructokinase-2-like [Phoenix dactylifera]
Length=331

 Score = 70.1 bits (170),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 56/113 (50%), Gaps = 5/113 (4%)
 Frame = -2

Query  363  TSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  184
             S + +  LW D LK L VTDG     Y+T +F+G V G      +  T D TG+GDA V
Sbjct  219  ASEDVIMKLWFDGLKLLVVTDGEKGCRYFTKNFKGKVPG-----FSVTTVDTTGAGDAFV  273

Query  183  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
              ++  +     +F N++ L+  LRF+ + G I     GA+   P  S  Q L
Sbjct  274  GSLLVSIAKDNSLFHNEEKLKEALRFSNACGAICTTKKGAIPALPDTSMAQEL  326


 Score = 62.0 bits (149),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N A+++ A+IFH+ S  L S    S    A+  +K+ G L+ +D N+ LPLW S++   +
Sbjct  132  NLALIRRAKIFHYGSISLISEPCRSAHLAAMRAAKEAGILLSYDPNVRLPLWPSQEAARD  191

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             I   W++AD I+VS  E+ FL   D
Sbjct  192  GIMSIWKEADFIKVSDDEVAFLTQGD  217



>gb|AHE93349.1| fructokinase [Camellia sinensis]
Length=327

 Score = 66.2 bits (160),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++++A+IFH+ S  L      S   KA+  +K  G L+ +D NL LPLW S  E  E
Sbjct  131  NLELIRKAKIFHYGSISLIVEPCRSAHLKAMEVAKDAGALLSYDPNLRLPLWPSEKEARE  190

Query  523  VIKGAWEQADIIEVSRSELEFL  458
             I   W++A++I+VS +ELEFL
Sbjct  191  QIMSIWDKAEVIKVSDNELEFL  212


 Score = 65.9 bits (159),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 5/105 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH+ LK L VT G     YYT +F G V G         + D TG+GD+ V  +
Sbjct  219  ESAMSLWHNNLKLLLVTLGEQGCKYYTKNFRGCVDG-----FPVKSVDTTGAGDSFVGAL  273

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  40
            + K+     + E+++ L+  L++A + G I+    GA+   PTES
Sbjct  274  LCKIVDDRSVLEDEEKLKAVLKYANACGAITTTKKGAIPALPTES  318



>ref|XP_008376501.1| PREDICTED: fructokinase-1-like [Malus domestica]
Length=358

 Score = 68.9 bits (167),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A+IFH+ S  L      ST   A+  +KK G ++ +D NL LPLW S D   + I 
Sbjct  157  LIKKAKIFHYGSISLIDEPCRSTHLAAMKIAKKSGCILSYDPNLRLPLWPSEDAALKGIM  216

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QADII++S  E+ FL   D
Sbjct  217  SIWDQADIIKISEDEIRFLTGGD  239


 Score = 62.8 bits (151),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 59/110 (54%), Gaps = 6/110 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  L+ L VT+G+    YYT  F G V G   V + P   D TG+GDA V G++  + 
Sbjct  251  LFHPNLRLLVVTEGSEGCRYYTQKFHGRVGG---VKVKPV--DTTGAGDAFVGGVLNSIA  305

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPT-ESATQNLKEPS  13
            +   +F+++  L   L FA + G ++    GA+   PT E+  Q LK+ +
Sbjct  306  SNLSLFQDEKGLREALLFANACGALTVTERGAIPAMPTREAVLQCLKQAA  355



>ref|XP_006589570.1| PREDICTED: putative fructokinase-5-like [Glycine max]
Length=341

 Score = 72.0 bits (175),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G E   + P   D TG+GDA V+GI+  L 
Sbjct  239  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVAGVE---VKP--VDTTGAGDAFVSGIIYSLA  293

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +   +F+N++ L + L FA   G I+    GA+   PT+ A
Sbjct  294  SDQSLFQNEEHLRKALYFANVCGAITVTERGAIPALPTKEA  334


 Score = 60.1 bits (144),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A+IFH+ S  L      S    A+ ++K+ G ++ +D NL L LW S +   + I 
Sbjct  145  LIKKAKIFHYGSISLIDEPCKSAHLAAMRFAKESGCILSYDPNLRLALWPSAEAARDGIM  204

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QADII++S  E+ FL   D
Sbjct  205  SIWDQADIIKISEEEITFLTGGD  227



>ref|XP_009393498.1| PREDICTED: fructokinase-2 [Musa acuminata subsp. malaccensis]
Length=327

 Score = 70.1 bits (170),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E V  LW+D LK L VTDG     Y+T  F+G + G         T D TG+GDA V  +
Sbjct  218  ETVKTLWYDGLKLLVVTDGEKGCRYFTKDFKGQIPG-----YAVKTVDTTGAGDAFVGAL  272

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            +  +     +F+N++ L++ L FA + G I     GA+   PT S    L
Sbjct  273  LVSIAKDNSLFKNEEKLKKALTFANACGAICTTKKGAIPALPTASMAMEL  322


 Score = 62.0 bits (149),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N +++K A+IFH+ S  L S    +    A+  +K+ G L+ +D N+ LPLW S +    
Sbjct  128  NLSLIKRAKIFHYGSISLISEPCRTAHLAAMRAAKQAGILLSYDPNVRLPLWPSEEAART  187

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W++AD I+VS  E+ FL   D
Sbjct  188  GIKSIWKEADFIKVSDDEVAFLTQGD  213



>ref|XP_011073890.1| PREDICTED: fructokinase-2-like [Sesamum indicum]
Length=271

 Score = 70.5 bits (171),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L +    S  FKA+  +K  G L+ +D NL LPLW S +E  E
Sbjct  57   NFHLIRSAKVFHYGSISLIAEPCRSAHFKAMEVAKDAGALLSYDPNLRLPLWPSAEEARE  116

Query  523  VIKGAWEQADIIEVSRSELEFL  458
             I   WE+AD+I+VS  EL+FL
Sbjct  117  QILSIWEKADVIKVSDEELQFL  138


 Score = 61.2 bits (147),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (49%), Gaps = 5/117 (4%)
 Frame = -2

Query  375  ETITTSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSG  196
            +T     E    LWH  LK L VT G     YYT +F+G V  T  V     T D TG+G
Sbjct  140  QTNIVDDECAMSLWHHNLKLLLVTLGDRGCRYYTKNFKGAV-DTYQVK----TVDTTGAG  194

Query  195  DAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            D+ V  ++ K+     + + ++ L++ LR+A + G I+    GA+   PT S    L
Sbjct  195  DSFVGALLCKIVDDQFIIQKEERLKQVLRYACACGAITTTKKGAIPALPTHSQVLTL  251



>ref|XP_010111956.1| Putative fructokinase-5 [Morus notabilis]
 gb|EXC32163.1| Putative fructokinase-5 [Morus notabilis]
Length=339

 Score = 67.4 bits (163),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 5/99 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V+GI+  L 
Sbjct  234  LFHPNLKLLIVTEGSAGCRYYTKEFKGRVHG---VTVKPI--DTTGAGDAFVSGILYSLA  288

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTE  43
            +   +F+++  L   L FA + G I+    GA+   PT+
Sbjct  289  SDLNLFQDEKCLREALSFANACGAITVTERGAIPALPTK  327


 Score = 64.3 bits (155),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -1

Query  697  AVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVI  518
            A++K+A+IFH+ S  L      S    A+  +KK G  + +D NL LPLW S +   + I
Sbjct  139  ALIKQAKIFHYGSISLIEEPSRSAHLAAMGIAKKNGCFLSYDPNLRLPLWPSHEAALKGI  198

Query  517  KGAWEQADIIEVSRSELEFLLDED  446
               W+QAD+I++S  E+ FL   D
Sbjct  199  MSIWDQADLIKISEDEITFLTGGD  222



>emb|CDP17143.1| unnamed protein product [Coffea canephora]
Length=208

 Score = 67.0 bits (162),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G    +YYT +F G V           T D TG+GD+ V  +
Sbjct  99   ESAMSLWHPNLKLLLVTLGEKGCNYYTKNFHGSVPA-----FHVNTVDTTGAGDSFVGAL  153

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  LRFA + G I+    GA+   PTES   +L
Sbjct  154  LCKIVDNQAILEDEARLKEVLRFACACGAITTTKKGAIPALPTESDALSL  203


 Score = 64.7 bits (156),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +E  +
Sbjct  9    NLDLIRSAKVFHYGSISLIVEPCRSAHIKAMEAAKAAGVLLSYDPNLRLPLWPSAEEARK  68

Query  523  VIKGAWEQADIIEVSRSELEFL  458
             I   W++ADII+VS  ELEFL
Sbjct  69   QILSIWDKADIIKVSDVELEFL  90



>ref|XP_011091648.1| PREDICTED: fructokinase-2 [Sesamum indicum]
Length=329

 Score = 66.2 bits (160),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (49%), Gaps = 5/105 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWHD LK L VT G     YYT +F G V G         T D TG+GD+ V  +
Sbjct  220  ESAMSLWHDNLKLLLVTLGAKGCRYYTKNFRGAVEG-----FAVKTVDTTGAGDSFVGAL  274

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  40
            + K+     + +++  L+  L++A + G I+    GA+   P  S
Sbjct  275  LGKIVDDHSIIQDETRLKEALKYACACGAITTTKKGAIPALPAHS  319


 Score = 65.5 bits (158),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +   E
Sbjct  130  NLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKSAGALLSYDPNLRLPLWPSAEYAKE  189

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W +AD+I+VS  EL FL   D  +
Sbjct  190  QIKSIWNKADVIKVSDEELVFLTGSDKVD  218



>gb|KHN02781.1| Putative fructokinase-5 [Glycine soja]
Length=347

 Score = 71.6 bits (174),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G E   + P   D TG+GDA V+GI+  L 
Sbjct  245  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVAGVE---VKP--VDTTGAGDAFVSGIIYSLA  299

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +   +F+N++ L + L FA   G I+    GA+   PT+ A
Sbjct  300  SDQSLFQNEEHLRKALYFANVCGAITVTERGAIPALPTKEA  340


 Score = 59.7 bits (143),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A+IFH+ S  L      S    A+ ++K+ G ++ +D NL L LW S +   + I 
Sbjct  151  LIKKAKIFHYGSISLIDEPCKSAHLAAMRFAKESGCILSYDPNLRLALWPSAEAARDGIM  210

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QADII++S  E+ FL   D
Sbjct  211  SIWDQADIIKISEEEITFLTGGD  233



>ref|XP_009379916.1| PREDICTED: probable fructokinase-1 [Musa acuminata subsp. malaccensis]
Length=321

 Score = 71.2 bits (173),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V+K A +FH+ S  L +    S   KA+  +++ G L+ +D NL LPLW S +   E
Sbjct  123  NLDVIKSAAVFHYGSISLITEPCRSAHLKAMEVARQAGALLSYDPNLRLPLWPSPESARE  182

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W+QADII+VS  ELEFL  ++  E
Sbjct  183  QIMSIWDQADIIKVSDVELEFLTGQESVE  211


 Score = 60.1 bits (144),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LW    K L VT G     YYT  F G + G         T D TG+GDA V  ++R
Sbjct  215  VLTLWRPEFKLLLVTLGEKGCKYYTKDFRGSLDG-----FAVNTVDTTGAGDAFVGAMLR  269

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            K+     + + ++ L   LRFA + G I+    GA+   P E+    L
Sbjct  270  KIVDDQTVLQEEEKLREVLRFANACGAITTTKKGAIPALPNEAEAVEL  317



>ref|NP_001233888.1| fructokinase-2 [Solanum lycopersicum]
 sp|Q42896.2|SCRK2_SOLLC RecName: Full=Fructokinase-2 [Solanum lycopersicum]
 gb|AAB51108.1| fructokinase [Solanum lycopersicum]
 gb|AAB57734.1| fructokinase [Solanum lycopersicum]
Length=328

 Score = 66.2 bits (160),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      +   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  129  NLDLIRSAKVFHYGSISLIVEPCRAAHMKAMEVAKEAGALLSYDPNLRLPLWPSAEEAKK  188

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             IK  W+ AD+I+VS  ELEFL   +  +
Sbjct  189  QIKSIWDSADVIKVSDVELEFLTGSNKID  217


 Score = 65.1 bits (157),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G    +YYT  F G V G         T D TG+GD+ V  +
Sbjct  219  ESAMSLWHPNLKLLLVTLGEKGCNYYTKKFHGTVGG-----FHVKTVDTTGAGDSFVGAL  273

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L+  LRF+ + G I+    GA+   PT S    L
Sbjct  274  LTKIVDDQTILEDEARLKEVLRFSCACGAITTTKKGAIPALPTASEALTL  323



>gb|EMT27421.1| hypothetical protein F775_08291 [Aegilops tauschii]
Length=255

 Score = 65.9 bits (159),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V+K A +FH+ S  L +    S   +A+  +K+ G L+ +D N    LW SR+E   
Sbjct  57   NVDVIKRATVFHYGSISLIAEPCRSAHLRAMEIAKEAGALLSYDPNPREALWSSREEART  116

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W+QADI++VS SE+EFL   D  E
Sbjct  117  KILSIWDQADIVKVSESEVEFLTGIDSVE  145


 Score = 65.5 bits (158),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LW    K L VT G     YY   F GVV   +   +     D TG+GDA V  ++R
Sbjct  149  VMKLWRPTFKLLLVTLGGKGCKYYARDFRGVVPSYKIQQV-----DTTGAGDAFVGALLR  203

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKE  19
            K+   P   +NQ+ LE  ++FA + G I+    GA+   PTE     L E
Sbjct  204  KIVQDPSSLQNQEKLEEAIKFANACGAITTTKKGAIPSLPTEIEVLQLME  253



>gb|EYU36729.1| hypothetical protein MIMGU_mgv1a009780mg [Erythranthe guttata]
Length=332

 Score = 66.2 bits (160),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +E  +
Sbjct  131  NLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKAAGALLSYDPNLRLPLWSSAEEARK  190

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W QA++I+VS  EL+FL   D+ +
Sbjct  191  QILSIWNQAEVIKVSDEELQFLTQNDNID  219


 Score = 65.1 bits (157),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 5/105 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWHD LK L VT G     YYT +F G V    D      T D TG+GD+ V  +
Sbjct  221  ESAMSLWHDNLKLLLVTLGDKGCRYYTKNFRGAV----DAYRVK-TVDTTGAGDSFVGAL  275

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  40
            + K+     + E++  L+  L++A + G I+    GA+   PT S
Sbjct  276  LYKIVDDQAIIEDESRLKEVLKYACACGAITTTKKGAIPALPTPS  320



>ref|XP_002533363.1| fructokinase, putative [Ricinus communis]
 gb|EEF29025.1| fructokinase, putative [Ricinus communis]
Length=330

 Score = 68.6 bits (166),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  V++ A+IFH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +   E
Sbjct  131  NLEVIRSAKIFHYGSISLIVEPCRSAHLKAMEEAKNAGALLSYDPNLRLPLWPSAEYARE  190

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   W++ADII+VS  ELEFL   D  +
Sbjct  191  QIMSIWDKADIIKVSDVELEFLTGSDKID  219


 Score = 62.8 bits (151),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 54/114 (47%), Gaps = 5/114 (4%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G     YYT +F G V    D      T D TG+GD+ V  +
Sbjct  221  ESALSLWHPNLKLLLVTLGENGCRYYTKNFHGSV----DAFHVK-TVDTTGAGDSFVGAL  275

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEPS  13
            + K+     + E +  L   LRFA + G I+    GA+   PTE+   +L + S
Sbjct  276  LCKIVDDLSVLEEEPRLREVLRFANACGAITTTKKGAIPALPTEADVLSLMKAS  329



>ref|XP_007038535.1| PfkB-like carbohydrate kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY23036.1| PfkB-like carbohydrate kinase family protein isoform 1 [Theobroma 
cacao]
Length=348

 Score = 67.0 bits (162),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT +F+G V G   + + P   D TG+GDA V+G++  L 
Sbjct  242  LYHPNLKLLVVTEGSEGCRYYTKAFKGRVPG---IKVKP--VDTTGAGDAFVSGLLSSLA  296

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +  ++FE+++ L   L FA + G ++    GA+   P + A
Sbjct  297  SDLKLFEDEERLREALNFANACGALTVTERGAIPAMPMKKA  337


 Score = 64.3 bits (155),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 55/99 (56%), Gaps = 5/99 (5%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A+IFH+ S  L      S    A++ +K+ G ++ +D NL LPLW S +     I 
Sbjct  148  LIKQAKIFHYGSISLIEEPCKSAHLAAMNIAKRSGSILSYDPNLRLPLWPSSEAARTGIM  207

Query  514  GAWEQADIIEVSRSELEFLLD-----EDHYEHKRNYKPQ  413
              W+QAD+I+VS  E++FL       +D+   K+ Y P 
Sbjct  208  SIWDQADLIKVSEDEIKFLTGGDDPYDDNVVMKKLYHPN  246



>gb|KHN30534.1| Putative fructokinase-5 [Glycine soja]
Length=313

 Score = 69.7 bits (169),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LWHD+LK L VTDG     Y+T +F G V G    ++     D TG+GD+ V  ++ 
Sbjct  204  VMTLWHDKLKMLLVTDGEKGCRYFTKNFRGRVTGFSAKVV-----DTTGAGDSFVGALLT  258

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             +   P +F N+  L   L FA + G +     GA+   PT +  +  
Sbjct  259  AVARDPNIFHNEPKLREALTFANACGAMCTTQKGAIPALPTAAEAEKF  306


 Score = 61.2 bits (147),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S +    
Sbjct  112  NMGLIKQAKVFHYGSISLISEPCRSAHLAAMKVAREGGALLSYDPNVRLPLWPSEEAARS  171

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W  AD I+VS  E+ FL   D
Sbjct  172  GIKSIWFDADFIKVSDDEVHFLTQGD  197



>ref|XP_003555364.2| PREDICTED: putative fructokinase-5-like [Glycine max]
Length=429

 Score = 71.2 bits (173),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V+GI+  L 
Sbjct  327  LFHPNLKLLIVTEGSEGCRYYTKEFKGRVAG---VKVKP--VDTTGAGDAFVSGIIYSLA  381

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +   +F+N++ L + L FA   G I+    GA+   PT+ A
Sbjct  382  SDQSLFQNEEHLRKALHFANVCGAITVTERGAIPALPTKEA  422


 Score = 59.7 bits (143),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A+IFH+ S  L      S    A+ ++K+ G ++ +D NL L LW S +   + I 
Sbjct  233  LIKKAKIFHYGSISLIDEPCKSAHLAAMRFAKESGCILSYDPNLRLALWPSAEAARDGIM  292

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QAD+I++S  E+ FL   D
Sbjct  293  SIWDQADVIKISEDEITFLTGGD  315



>ref|XP_003543564.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=331

 Score = 68.2 bits (165),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E  +
Sbjct  132  NLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKESGCLLSYDPNLRLPLWPSAEEARK  191

Query  523  VIKGAWEQADIIEVSRSELEFLLDEDHYE  437
             I   WE+AD+I+VS +ELEFL   D  +
Sbjct  192  QILSIWEKADLIKVSDAELEFLTGSDKID  220


 Score = 62.8 bits (151),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 5/110 (5%)
 Frame = -2

Query  354  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  175
            E    LWH  LK L VT G     YYT SF+G V    D      T D TG+GD+ V  +
Sbjct  222  ESALSLWHPNLKLLLVTLGEHGSRYYTKSFKGSV----DAFHVN-TVDTTGAGDSFVGAL  276

Query  174  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
            + K+     + E++  L   L+FA + G I+    GA+   P E A   L
Sbjct  277  LAKIVDDQSILEDEPRLREVLKFANACGAITTTQKGAIPALPKEEAALKL  326



>ref|XP_003535409.1| PREDICTED: putative fructokinase-5-like [Glycine max]
Length=327

 Score = 69.7 bits (169),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LWHD+LK L VTDG     Y+T +F G V G    ++     D TG+GD+ V  ++ 
Sbjct  218  VMTLWHDKLKMLLVTDGEKGCRYFTKNFRGRVTGFSAKVV-----DTTGAGDSFVGALLT  272

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             +   P +F N+  L   L FA + G +     GA+   PT +  +  
Sbjct  273  AVARDPNIFHNEPKLREALTFANACGAMCTTQKGAIPALPTAAEAEKF  320


 Score = 61.2 bits (147),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S +    
Sbjct  126  NMGLIKQAKVFHYGSISLISEPCRSAHLAAMKVAREGGALLSYDPNVRLPLWPSEEAARS  185

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W  AD I+VS  E+ FL   D
Sbjct  186  GIKSIWFDADFIKVSDDEVHFLTQGD  211



>ref|XP_003622348.1| Fructokinase-2 [Medicago truncatula]
 gb|KEH42831.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=327

 Score = 68.2 bits (165),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 54/112 (48%), Gaps = 5/112 (4%)
 Frame = -2

Query  360  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  181
            + E V  LWHD+LK L +TDG     Y T +F+G V G      +    D TG+GD+ V 
Sbjct  214  NEEVVMSLWHDKLKLLIITDGEKGCRYVTKNFKGRVSG-----FSVKAIDTTGAGDSFVG  268

Query  180  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             ++R +     +FE++  L   L FA + G +     GA+   PT    Q  
Sbjct  269  ALLRDVARDTSIFEDEPKLRETLTFANACGAMCTTQKGAIPALPTAEEAQKF  320


 Score = 63.2 bits (152),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K  +IFH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S D     IK
Sbjct  129  MIKSTKIFHYGSISLISEPCRSAHMAAMKAAREGGALLSYDPNVRLPLWPSADAARSGIK  188

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W +AD I+VS  E++FL  +D
Sbjct  189  SIWNEADFIKVSDDEVQFLTQKD  211



>gb|KJB10970.1| hypothetical protein B456_001G234200 [Gossypium raimondii]
Length=327

 Score = 71.6 bits (174),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 56/108 (52%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LW+D  K L VTDG     Y+T  F+G V G +       T D TG+GDA V   ++
Sbjct  220  VMSLWNDNFKLLIVTDGPEGCRYFTKKFKGKVNGYK-----VKTIDTTGAGDAFVGAFLQ  274

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             +   P +F +++ L+  L FA + G IS    GA+   P ++  +NL
Sbjct  275  AVAKDPNLFNDENKLKEALVFANACGAISTTQKGAIPSLPDKAQAENL  322


 Score = 59.3 bits (142),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            ++K+A+IFH+ S  L S    S    A+  +K+ G L+ +D N+ LPLW S +   + IK
Sbjct  131  LIKQAKIFHYGSISLISEPCKSAHMAAMKAAKQAGVLLSYDPNVRLPLWPSPEAARDGIK  190

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QAD ++VS  E+EFL   D
Sbjct  191  SIWDQADFVKVSDDEVEFLTKGD  213



>ref|XP_008237799.1| PREDICTED: putative fructokinase-5 [Prunus mume]
Length=327

 Score = 69.3 bits (168),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 5/108 (5%)
 Frame = -2

Query  348  VAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMR  169
            V  LWHD LK L +TDG     YYT  F+G V G      +    D TG+GDA V   + 
Sbjct  218  VLSLWHDNLKLLVITDGEKGCRYYTKKFKGKVTG-----FSVKAVDTTGAGDAFVGSFLL  272

Query  168  KLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  25
             +     +FE++  L+  L F+ + G I     GA+   PT+ A   L
Sbjct  273  SMAKDMSIFEDETKLKEALSFSNACGAICTTQKGAIPALPTQCAALEL  320


 Score = 61.6 bits (148),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -1

Query  703  NXAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWE  524
            N  ++K+A+IFH+ S  L S    S    A+  +K  G ++ +D N+ LPLW S D   E
Sbjct  126  NMPLIKQAKIFHYGSISLISEPCRSAHMAAMKAAKDAGIMLSYDPNVRLPLWPSADAARE  185

Query  523  VIKGAWEQADIIEVSRSELEFLLDED  446
             IK  W QAD I+VS  E+ FL   D
Sbjct  186  GIKSIWNQADFIKVSDDEVHFLTQGD  211



>ref|XP_003548230.1| PREDICTED: putative fructokinase-5-like isoform X1 [Glycine max]
Length=345

 Score = 65.5 bits (158),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -1

Query  694  VLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIK  515
            +LK+ARIFH+ S  L      S    A+S +K  G ++ +D NL L LW S D   + I 
Sbjct  145  ILKQARIFHYGSISLIDEPCKSAHLAAMSIAKNSGCILSYDPNLRLALWPSADSARKGIM  204

Query  514  GAWEQADIIEVSRSELEFLLDED  446
              W+QAD+I++S  E+ FL   D
Sbjct  205  DIWDQADVIKISEDEITFLTGGD  227


 Score = 65.5 bits (158),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -2

Query  339  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  160
            L+H  LK L VT+G+    YYT +F+G V G   V + P   D TG+GDA V+GI+  + 
Sbjct  239  LFHPNLKLLIVTEGSQGCRYYTKAFKGRVAG---VKVKPV--DTTGAGDAFVSGILYCIA  293

Query  159  TQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  37
            +   +F+++  L + L FA   G ++    GA+   PT+ A
Sbjct  294  SDQTIFQDEKRLRKALYFANVCGALTVTERGAIPALPTKEA  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335