BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028O08

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757535.1|  PREDICTED: LRR receptor-like serine/threonin...    275   8e-82   Nicotiana sylvestris
ref|XP_009757534.1|  PREDICTED: LRR receptor-like serine/threonin...    275   8e-82   Nicotiana sylvestris
ref|XP_009600406.1|  PREDICTED: LRR receptor-like serine/threonin...    273   3e-81   Nicotiana tomentosiformis
emb|CAN79933.1|  hypothetical protein VITISV_008329                     256   2e-80   Vitis vinifera
ref|XP_010109087.1|  LRR receptor-like serine/threonine-protein k...    260   2e-79   
ref|XP_006348051.1|  PREDICTED: LRR receptor-like serine/threonin...    263   2e-77   Solanum tuberosum [potatoes]
ref|XP_006348052.1|  PREDICTED: LRR receptor-like serine/threonin...    263   2e-77   
ref|XP_007038488.1|  ERECTA-like 1                                      262   3e-77   
ref|NP_001237639.1|  ERECTA-like kinase                                 259   6e-77   Glycine max [soybeans]
ref|XP_004234153.1|  PREDICTED: LRR receptor-like serine/threonin...    261   9e-77   Solanum lycopersicum
ref|XP_006588387.1|  PREDICTED: ERECTA-like kinase isoform X1           259   4e-76   Glycine max [soybeans]
ref|XP_006588388.1|  PREDICTED: ERECTA-like kinase isoform X2           259   4e-76   Glycine max [soybeans]
gb|KDP22376.1|  hypothetical protein JCGZ_26207                         259   4e-76   Jatropha curcas
ref|XP_002510897.1|  erecta, putative                                   258   6e-76   
ref|XP_002269540.2|  PREDICTED: LRR receptor-like serine/threonin...    255   1e-74   Vitis vinifera
emb|CDP20026.1|  unnamed protein product                                245   2e-74   Coffea canephora [robusta coffee]
ref|XP_011029995.1|  PREDICTED: LRR receptor-like serine/threonin...    248   3e-72   Populus euphratica
ref|XP_007143329.1|  hypothetical protein PHAVU_007G063200g             248   3e-72   Phaseolus vulgaris [French bean]
ref|XP_010940921.1|  PREDICTED: LRR receptor-like serine/threonin...    247   9e-72   Elaeis guineensis
gb|KHG06831.1|  LRR receptor-like serine/threonine-protein kinase...    247   9e-72   Gossypium arboreum [tree cotton]
gb|KEH43759.1|  LRR receptor-like kinase family protein                 247   9e-72   Medicago truncatula
emb|CBI24498.3|  unnamed protein product                                246   2e-71   Vitis vinifera
ref|XP_010035002.1|  PREDICTED: LRR receptor-like serine/threonin...    246   2e-71   
gb|KHN15712.1|  LRR receptor-like serine/threonine-protein kinase...    246   3e-71   Glycine soja [wild soybean]
emb|CDP05285.1|  unnamed protein product                                245   3e-71   Coffea canephora [robusta coffee]
gb|KJB39364.1|  hypothetical protein B456_007G009000                    245   3e-71   Gossypium raimondii
ref|XP_010277441.1|  PREDICTED: LRR receptor-like serine/threonin...    245   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010277442.1|  PREDICTED: LRR receptor-like serine/threonin...    245   4e-71   Nelumbo nucifera [Indian lotus]
ref|XP_010277439.1|  PREDICTED: LRR receptor-like serine/threonin...    245   5e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006606082.1|  PREDICTED: LRR receptor-like serine/threonin...    244   1e-70   Glycine max [soybeans]
ref|XP_006606083.1|  PREDICTED: LRR receptor-like serine/threonin...    243   2e-70   Glycine max [soybeans]
ref|XP_010276048.1|  PREDICTED: LRR receptor-like serine/threonin...    242   4e-70   Nelumbo nucifera [Indian lotus]
gb|ADM86148.1|  leucine-rich repeat receptor-like kinase                242   4e-70   Populus nigra x Populus x canadensis
ref|XP_010276057.1|  PREDICTED: LRR receptor-like serine/threonin...    242   5e-70   Nelumbo nucifera [Indian lotus]
ref|XP_002318267.2|  PTH-1 family protein                               242   5e-70   
gb|ACF87330.1|  unknown                                                 226   2e-69   Zea mays [maize]
ref|XP_008810292.1|  PREDICTED: LRR receptor-like serine/threonin...    240   2e-69   
ref|XP_008810291.1|  PREDICTED: LRR receptor-like serine/threonin...    240   2e-69   Phoenix dactylifera
ref|XP_008810290.1|  PREDICTED: LRR receptor-like serine/threonin...    240   2e-69   
ref|XP_009346939.1|  PREDICTED: LRR receptor-like serine/threonin...    240   2e-69   
ref|XP_011076300.1|  PREDICTED: LRR receptor-like serine/threonin...    239   3e-69   Sesamum indicum [beniseed]
ref|XP_009345019.1|  PREDICTED: LRR receptor-like serine/threonin...    239   3e-69   
ref|XP_011076298.1|  PREDICTED: LRR receptor-like serine/threonin...    239   3e-69   Sesamum indicum [beniseed]
ref|XP_004496653.1|  PREDICTED: LRR receptor-like serine/threonin...    239   4e-69   Cicer arietinum [garbanzo]
ref|NP_001235330.1|  ERECTA-like kinase                                 239   6e-69   Glycine max [soybeans]
gb|KHN24405.1|  LRR receptor-like serine/threonine-protein kinase...    239   6e-69   Glycine soja [wild soybean]
ref|XP_006598682.1|  PREDICTED: ERECTA-like kinase isoform X1           239   6e-69   Glycine max [soybeans]
ref|XP_006598683.1|  PREDICTED: ERECTA-like kinase isoform X2           239   6e-69   Glycine max [soybeans]
gb|KDO65362.1|  hypothetical protein CISIN_1g002278mg                   236   4e-68   Citrus sinensis [apfelsine]
ref|XP_006490262.1|  PREDICTED: LRR receptor-like serine/threonin...    236   4e-68   
ref|XP_011041677.1|  PREDICTED: LRR receptor-like serine/threonin...    236   5e-68   Populus euphratica
gb|KGN49592.1|  hypothetical protein Csa_5G014290                       236   9e-68   Cucumis sativus [cucumbers]
ref|XP_004149628.1|  PREDICTED: LRR receptor-like serine/threonin...    235   1e-67   
ref|XP_009398741.1|  PREDICTED: LRR receptor-like serine/threonin...    235   2e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACR34621.1|  unknown                                                 227   2e-67   Zea mays [maize]
gb|ACN26436.1|  unknown                                                 227   3e-67   Zea mays [maize]
gb|EEE65024.1|  hypothetical protein OsJ_19993                          233   6e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006421768.1|  hypothetical protein CICLE_v10004259mg             233   8e-67   
gb|ACY07616.1|  stress-induced protein kinase                           233   8e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008376471.1|  PREDICTED: LRR receptor-like serine/threonin...    233   9e-67   Malus domestica [apple tree]
ref|XP_008234344.1|  PREDICTED: LRR receptor-like serine/threonin...    233   9e-67   Prunus mume [ume]
dbj|BAD44800.1|  putative transmembrane protein kinase                  233   9e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002436407.1|  hypothetical protein SORBIDRAFT_10g001970          233   1e-66   Sorghum bicolor [broomcorn]
dbj|BAJ90194.1|  predicted protein                                      231   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001056687.1|  Os06g0130100                                       232   1e-66   
ref|XP_006656595.1|  PREDICTED: LRR receptor-like serine/threonin...    232   2e-66   Oryza brachyantha
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...    232   2e-66   Setaria italica
ref|XP_007152392.1|  hypothetical protein PHAVU_004G126100g             232   2e-66   Phaseolus vulgaris [French bean]
ref|XP_006587379.1|  PREDICTED: LRR receptor-like serine/threonin...    232   2e-66   Glycine max [soybeans]
ref|XP_003561134.2|  PREDICTED: LRR receptor-like serine/threonin...    231   3e-66   
ref|XP_008465055.1|  PREDICTED: LRR receptor-like serine/threonin...    231   4e-66   Cucumis melo [Oriental melon]
dbj|BAJ89970.1|  predicted protein                                      231   5e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN27841.1|  LRR receptor-like serine/threonine-protein kinase...    230   6e-66   Glycine soja [wild soybean]
gb|AGT17158.1|  ERECTA-like 2                                           229   2e-65   Saccharum hybrid cultivar R570
ref|NP_001146239.1|  uncharacterized LOC100279811                       226   5e-65   
ref|XP_004308156.1|  PREDICTED: LRR receptor-like serine/threonin...    228   7e-65   Fragaria vesca subsp. vesca
ref|XP_008658489.1|  PREDICTED: uncharacterized protein LOC100279...    226   2e-64   
dbj|BAC42683.1|  unknown protein                                        215   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25015.1|  hypothetical protein MIMGU_mgv1a000865mg                225   4e-64   Erythranthe guttata [common monkey flower]
ref|XP_010555314.1|  PREDICTED: LRR receptor-like serine/threonin...    225   4e-64   Tarenaya hassleriana [spider flower]
ref|XP_002322426.1|  PTH-1 family protein                               224   5e-64   
gb|AGL91675.1|  erecta-like leucine-rich-repeat receptor-like kinase    224   1e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AGL91674.1|  erecta-like leucine-rich-repeat receptor-like kinase    222   8e-63   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007221096.1|  hypothetical protein PRUPE_ppa017398mg             219   4e-62   
ref|XP_006858024.1|  hypothetical protein AMTR_s00069p00198500          217   3e-61   
ref|XP_002864777.1|  hypothetical protein ARALYDRAFT_496399             216   8e-61   
ref|NP_001190595.1|  LRR receptor-like serine/threonine-protein k...    214   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAP69763.1|  ERECTA-like kinase 1                                    214   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201029.1|  LRR receptor-like serine/threonine-protein kina...    214   3e-60   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66497.1|  hypothetical protein M569_08274                         213   6e-60   Genlisea aurea
ref|XP_006279954.1|  hypothetical protein CARUB_v10025821mg             213   8e-60   Capsella rubella
emb|CDX86913.1|  BnaC03g51830D                                          213   9e-60   
ref|XP_010423244.1|  PREDICTED: LRR receptor-like serine/threonin...    212   1e-59   
ref|XP_010423243.1|  PREDICTED: LRR receptor-like serine/threonin...    212   2e-59   Camelina sativa [gold-of-pleasure]
gb|KFK27954.1|  hypothetical protein AALP_AA8G452900                    212   2e-59   Arabis alpina [alpine rockcress]
ref|XP_009151345.1|  PREDICTED: LRR receptor-like serine/threonin...    212   2e-59   Brassica rapa
ref|XP_009151343.1|  PREDICTED: LRR receptor-like serine/threonin...    212   2e-59   Brassica rapa
emb|CDY00268.1|  BnaA06g21690D                                          212   2e-59   
ref|NP_196335.2|  LRR receptor-like serine/threonine-protein kina...    212   2e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87274.1|  receptor-like protein kinase                           211   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289323.1|  hypothetical protein CARUB_v10002808mg             211   6e-59   
ref|XP_010491322.1|  PREDICTED: LRR receptor-like serine/threonin...    211   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010483916.1|  PREDICTED: LRR receptor-like serine/threonin...    209   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010483915.1|  PREDICTED: LRR receptor-like serine/threonin...    209   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002873299.1|  hypothetical protein ARALYDRAFT_908657             209   3e-58   Arabidopsis lyrata subsp. lyrata
gb|EMS58253.1|  LRR receptor-like serine/threonine-protein kinase...    208   3e-58   Triticum urartu
ref|XP_006399198.1|  hypothetical protein EUTSA_v10012600mg             208   4e-58   
ref|XP_006394418.1|  hypothetical protein EUTSA_v100036151mg            207   6e-58   
gb|EMT12712.1|  LRR receptor-like serine/threonine-protein kinase...    208   6e-58   
ref|XP_010444058.1|  PREDICTED: LRR receptor-like serine/threonin...    208   6e-58   Camelina sativa [gold-of-pleasure]
dbj|BAD16970.1|  receptor protein kinase PERK1-like                     200   8e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AAO26312.1|  receptor-like protein kinase                            205   2e-57   Elaeis guineensis
ref|NP_001048290.1|  Os02g0777400                                       199   4e-57   
gb|EPS58979.1|  hypothetical protein M569_15834                         194   5e-57   Genlisea aurea
gb|EEC74102.1|  hypothetical protein OsI_09151                          203   3e-56   Oryza sativa Indica Group [Indian rice]
dbj|BAJ87863.1|  predicted protein                                      202   4e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAA97187.1|  receptor-like protein kinase                           202   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452673.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    202   7e-56   
ref|XP_010458423.1|  PREDICTED: LRR receptor-like serine/threonin...    202   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009408412.1|  PREDICTED: LRR receptor-like serine/threonin...    201   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF80312.1|  unknown                                                 191   4e-55   Zea mays [maize]
ref|XP_010431630.1|  PREDICTED: LRR receptor-like serine/threonin...    188   4e-55   Camelina sativa [gold-of-pleasure]
gb|EEE57902.1|  hypothetical protein OsJ_08587                          199   6e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564133.1|  PREDICTED: LRR receptor-like serine/threonin...    200   6e-55   Brachypodium distachyon [annual false brome]
ref|XP_010227884.1|  PREDICTED: LRR receptor-like serine/threonin...    199   7e-55   Brachypodium distachyon [annual false brome]
gb|AFJ14786.1|  ERECTA-like kinase                                      199   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649092.1|  PREDICTED: LRR receptor-like serine/threonin...    199   1e-54   Oryza brachyantha
gb|EEE65279.1|  hypothetical protein OsJ_20503                          198   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132173.1|  uncharacterized protein LOC100193598               194   1e-54   
ref|NP_001281212.1|  uncharacterized protein LOC103504710               190   2e-54   
ref|XP_009122365.1|  PREDICTED: LRR receptor-like serine/threonin...    198   2e-54   Brassica rapa
gb|EEC80197.1|  hypothetical protein OsI_22078                          198   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_008452789.1|  PREDICTED: LRR receptor-like serine/threonin...    198   3e-54   Cucumis melo [Oriental melon]
ref|NP_001057087.1|  Os06g0203800                                       198   3e-54   
ref|XP_006656743.1|  PREDICTED: LRR receptor-like serine/threonin...    198   3e-54   Oryza brachyantha
emb|CDX99001.1|  BnaC09g48340D                                          197   4e-54   
ref|XP_004964942.1|  PREDICTED: LRR receptor-like serine/threonin...    197   4e-54   Setaria italica
ref|XP_002438023.1|  hypothetical protein SORBIDRAFT_10g006670          197   4e-54   Sorghum bicolor [broomcorn]
ref|XP_004964941.1|  PREDICTED: LRR receptor-like serine/threonin...    197   5e-54   Setaria italica
emb|CDX70013.1|  BnaA10g23620D                                          196   8e-54   
ref|XP_004141340.1|  PREDICTED: LRR receptor-like serine/threonin...    196   1e-53   Cucumis sativus [cucumbers]
ref|XP_006452986.1|  hypothetical protein CICLE_v100073972mg            189   1e-53   
ref|XP_010429656.1|  PREDICTED: LRR receptor-like serine/threonin...    188   1e-53   
gb|EMS68149.1|  LRR receptor-like serine/threonine-protein kinase...    195   1e-53   Triticum urartu
gb|AGS56396.1|  LRR receptor-like serine/threonine-protein kinase       189   2e-53   Populus tremula [European aspen]
ref|XP_011069519.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    195   3e-53   Sesamum indicum [beniseed]
ref|XP_010261893.1|  PREDICTED: LRR receptor-like serine/threonin...    195   3e-53   Nelumbo nucifera [Indian lotus]
gb|KJB65469.1|  hypothetical protein B456_010G096300                    194   3e-53   Gossypium raimondii
gb|KJB65470.1|  hypothetical protein B456_010G096300                    194   3e-53   Gossypium raimondii
ref|XP_008393579.1|  PREDICTED: LRR receptor-like serine/threonin...    194   5e-53   Malus domestica [apple tree]
gb|KJB65471.1|  hypothetical protein B456_010G096300                    194   5e-53   Gossypium raimondii
gb|KJB65472.1|  hypothetical protein B456_010G096300                    194   5e-53   Gossypium raimondii
gb|ABR08864.1|  erecta                                                  179   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb|EMT04765.1|  LRR receptor-like serine/threonine-protein kinase...    194   5e-53   
ref|NP_001235257.1|  ERECTA                                             189   7e-53   Glycine max [soybeans]
ref|XP_010669304.1|  PREDICTED: LRR receptor-like serine/threonin...    193   1e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR08875.1|  erecta                                                  178   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273915.1|  PREDICTED: LRR receptor-like serine/threonin...    193   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010273914.1|  PREDICTED: LRR receptor-like serine/threonin...    193   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_008647408.1|  PREDICTED: uncharacterized protein LOC100193...    193   2e-52   Zea mays [maize]
ref|XP_008647407.1|  PREDICTED: uncharacterized protein LOC100193...    193   2e-52   Zea mays [maize]
ref|XP_009802873.1|  PREDICTED: LRR receptor-like serine/threonin...    193   2e-52   Nicotiana sylvestris
ref|XP_010526027.1|  PREDICTED: LRR receptor-like serine/threonin...    193   2e-52   Tarenaya hassleriana [spider flower]
ref|XP_002452905.1|  hypothetical protein SORBIDRAFT_04g034820          192   2e-52   
emb|CAN74952.1|  hypothetical protein VITISV_025649                     191   2e-52   Vitis vinifera
ref|XP_004955237.1|  PREDICTED: LRR receptor-like serine/threonin...    192   2e-52   
gb|AFW76643.1|  putative leucine-rich repeat receptor-like protei...    193   3e-52   
emb|CDP13474.1|  unnamed protein product                                192   4e-52   Coffea canephora [robusta coffee]
ref|XP_009362801.1|  PREDICTED: LRR receptor-like serine/threonin...    192   5e-52   Pyrus x bretschneideri [bai li]
ref|XP_007012431.1|  Leucine-rich receptor-like protein kinase fa...    192   5e-52   
gb|AFW73725.1|  putative leucine-rich repeat receptor-like protei...    190   6e-52   
ref|XP_011081595.1|  PREDICTED: LRR receptor-like serine/threonin...    191   6e-52   Sesamum indicum [beniseed]
gb|AFW73726.1|  putative leucine-rich repeat receptor-like protei...    190   6e-52   
emb|CBI20727.3|  unnamed protein product                                191   6e-52   Vitis vinifera
ref|XP_002280069.2|  PREDICTED: LRR receptor-like serine/threonin...    191   7e-52   Vitis vinifera
ref|XP_008220576.1|  PREDICTED: LRR receptor-like serine/threonin...    191   9e-52   Prunus mume [ume]
ref|XP_008220575.1|  PREDICTED: LRR receptor-like serine/threonin...    191   9e-52   Prunus mume [ume]
dbj|BAD94220.1|  putative receptor-like protein kinase                  185   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KDO73637.1|  hypothetical protein CISIN_1g0023491mg                  189   1e-51   Citrus sinensis [apfelsine]
ref|XP_009337156.1|  PREDICTED: LRR receptor-like serine/threonin...    191   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_009605434.1|  PREDICTED: LRR receptor-like serine/threonin...    191   1e-51   Nicotiana tomentosiformis
gb|KDP34024.1|  hypothetical protein JCGZ_07595                         191   1e-51   Jatropha curcas
ref|XP_002516144.1|  erecta, putative                                   190   1e-51   Ricinus communis
ref|XP_008393446.1|  PREDICTED: LRR receptor-like serine/threonin...    190   2e-51   
ref|XP_008786642.1|  PREDICTED: LRR receptor-like serine/threonin...    190   2e-51   
gb|AIR08789.1|  receptor-like kinase ERECTA                             190   2e-51   Medicago sativa [alfalfa]
ref|XP_007225368.1|  hypothetical protein PRUPE_ppa000847mg             190   2e-51   
ref|XP_008786640.1|  PREDICTED: LRR receptor-like serine/threonin...    190   2e-51   Phoenix dactylifera
ref|XP_008786639.1|  PREDICTED: LRR receptor-like serine/threonin...    190   2e-51   Phoenix dactylifera
ref|XP_011019342.1|  PREDICTED: LRR receptor-like serine/threonin...    190   2e-51   Populus euphratica
gb|KEH39916.1|  LRR receptor-like kinase family protein                 189   2e-51   Medicago truncatula
gb|AFW73724.1|  putative leucine-rich repeat receptor-like protei...    190   2e-51   
ref|XP_006353850.1|  PREDICTED: LRR receptor-like serine/threonin...    190   3e-51   Solanum tuberosum [potatoes]
gb|AES59193.2|  LRR receptor-like kinase family protein                 190   3e-51   Medicago truncatula
ref|XP_003588942.1|  LRR receptor-like serine/threonine-protein k...    189   3e-51   
gb|KJB07391.1|  hypothetical protein B456_001G019800                    189   3e-51   Gossypium raimondii
ref|XP_004245043.1|  PREDICTED: LRR receptor-like serine/threonin...    189   4e-51   Solanum lycopersicum
dbj|BAK61880.1|  LRR receptor-like serine/threonine-protein kinase      189   4e-51   Citrus unshiu [satsuma mandarin]
gb|AGL91671.1|  erecta leucine-rich-repeat receptor-like kinase         189   4e-51   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63677.1|  LRR receptor-like serine/threonine-protein kinase...    189   5e-51   Triticum urartu
ref|XP_004498861.1|  PREDICTED: LRR receptor-like serine/threonin...    189   5e-51   
ref|XP_010917192.1|  PREDICTED: LRR receptor-like serine/threonin...    189   5e-51   Elaeis guineensis
dbj|BAJ96098.1|  predicted protein                                      189   5e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFC88469.1|  ERECTA                                                  189   6e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006474503.1|  PREDICTED: LRR receptor-like serine/threonin...    189   6e-51   Citrus sinensis [apfelsine]
gb|AFJ38187.2|  receptor-like serine/threonine protein kinase 2         189   6e-51   Triticum aestivum [Canadian hard winter wheat]
gb|AFJ38186.2|  receptor-like serine/threonine protein kinase 1         189   6e-51   Triticum aestivum [Canadian hard winter wheat]
gb|AGL91672.1|  erecta leucine-rich-repeat receptor-like kinase         189   6e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004498860.1|  PREDICTED: LRR receptor-like serine/threonin...    189   7e-51   Cicer arietinum [garbanzo]
gb|EMT11370.1|  LRR receptor-like serine/threonine-protein kinase...    189   7e-51   
ref|XP_004498859.1|  PREDICTED: LRR receptor-like serine/threonin...    189   7e-51   Cicer arietinum [garbanzo]
ref|XP_007161049.1|  hypothetical protein PHAVU_001G038400g             188   1e-50   Phaseolus vulgaris [French bean]
gb|KJB65473.1|  hypothetical protein B456_010G096300                    188   1e-50   Gossypium raimondii
ref|XP_006381995.1|  hypothetical protein POPTR_0006s23680g             187   1e-50   
gb|KHN37058.1|  LRR receptor-like serine/threonine-protein kinase...    188   1e-50   Glycine soja [wild soybean]
ref|XP_010429655.1|  PREDICTED: LRR receptor-like serine/threonin...    187   2e-50   Camelina sativa [gold-of-pleasure]
dbj|BAK07025.1|  predicted protein                                      187   3e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003522304.1|  PREDICTED: LRR receptor-like serine/threonin...    187   3e-50   
ref|XP_006578096.1|  PREDICTED: LRR receptor-like serine/threonin...    187   3e-50   Glycine max [soybeans]
ref|XP_010417421.1|  PREDICTED: LRR receptor-like serine/threonin...    186   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004303459.1|  PREDICTED: LRR receptor-like serine/threonin...    186   5e-50   Fragaria vesca subsp. vesca
ref|XP_010474472.1|  PREDICTED: LRR receptor-like serine/threonin...    184   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006296065.1|  hypothetical protein CARUB_v10025215mg             186   9e-50   Capsella rubella
ref|XP_006581305.1|  PREDICTED: LRR receptor-like serine/threonin...    186   9e-50   Glycine max [soybeans]
ref|XP_003544548.1|  PREDICTED: LRR receptor-like serine/threonin...    185   9e-50   Glycine max [soybeans]
gb|EYU20292.1|  hypothetical protein MIMGU_mgv1a026417mg                184   1e-49   Erythranthe guttata [common monkey flower]
ref|XP_006849687.1|  hypothetical protein AMTR_s00024p00237440          185   2e-49   
ref|XP_010047401.1|  PREDICTED: LRR receptor-like serine/threonin...    184   2e-49   Eucalyptus grandis [rose gum]
ref|XP_002880777.1|  hypothetical protein ARALYDRAFT_481491             184   2e-49   
ref|NP_180201.1|  LRR receptor-like serine/threonine-protein kina...    184   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32328.1|  hypothetical protein MIMGU_mgv1a000790mg                184   4e-49   Erythranthe guttata [common monkey flower]
gb|KFK32516.1|  hypothetical protein AALP_AA6G252800                    182   9e-49   Arabis alpina [alpine rockcress]
ref|XP_010098375.1|  LRR receptor-like serine/threonine-protein k...    182   2e-48   
ref|XP_006408746.1|  hypothetical protein EUTSA_v10001898mg             181   3e-48   Eutrema salsugineum [saltwater cress]
ref|XP_009117015.1|  PREDICTED: LRR receptor-like serine/threonin...    180   8e-48   Brassica rapa
gb|AGL91677.1|  erecta leucine-rich-repeat receptor-like kinase         180   8e-48   Brassica napus [oilseed rape]
ref|XP_007136889.1|  hypothetical protein PHAVU_009G082500g             179   1e-47   Phaseolus vulgaris [French bean]
ref|XP_002981099.1|  hypothetical protein SELMODRAFT_114051             170   2e-44   
ref|XP_002982573.1|  hypothetical protein SELMODRAFT_155267             170   3e-44   
ref|XP_002975149.1|  hypothetical protein SELMODRAFT_102522             165   1e-42   
ref|XP_002977553.1|  hypothetical protein SELMODRAFT_107124             165   2e-42   
gb|AAL50210.1|  ER1-like receptor kinase                                142   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_001770079.1|  ERL1c AtERECTA-like receptor S/T protein kin...    148   1e-36   
ref|XP_001755991.1|  ERL1d AtERECTA-like receptor S/T protein kin...    146   6e-36   
ref|XP_001783127.1|  ERL1a AtERECTA-like receptor S/T protein kin...    144   2e-35   
gb|AAL68842.1|AF466199_1  putative receptor protein kinase              144   4e-35   Sorghum bicolor [broomcorn]
ref|XP_001763775.1|  ERL2a AtERECTA-like receptor S/T protein kin...    141   4e-34   
ref|XP_001770421.1|  ERL2b AtERECTA-like receptor S/T protein kin...    137   5e-33   
ref|XP_001755734.1|  ERL1b AtERECTA-like receptor S/T protein kin...    135   3e-32   
gb|AFW86034.1|  putative leucine-rich repeat receptor-like protei...    120   6e-27   
gb|AFW76644.1|  putative leucine-rich repeat receptor-like protei...    114   4e-25   
gb|AFW86031.1|  putative leucine-rich repeat receptor-like protei...    112   4e-24   
emb|CDM85311.1|  unnamed protein product                                105   7e-24   Triticum aestivum [Canadian hard winter wheat]
gb|KFK22048.1|  hypothetical protein AALP_AAs71129U000200               103   6e-23   Arabis alpina [alpine rockcress]
ref|XP_004245388.2|  PREDICTED: receptor-like protein kinase 2          108   8e-23   Solanum lycopersicum
emb|CBI20590.3|  unnamed protein product                                101   2e-22   Vitis vinifera
ref|XP_006377697.1|  hypothetical protein POPTR_0011s10340g           99.0    5e-22   
ref|XP_006364731.1|  PREDICTED: leucine-rich repeat receptor-like...    105   6e-22   
gb|ACI05997.1|  kinase-like protein pac.EREC.L.4                        100   7e-22   Platanus x hispanica [London plane tree]
gb|KJB12909.1|  hypothetical protein B456_002G044400                    102   1e-21   Gossypium raimondii
ref|XP_010275524.1|  PREDICTED: receptor-like serine/threonine-pr...    100   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009600836.1|  PREDICTED: receptor-like protein kinase 5          100   2e-21   Nicotiana tomentosiformis
ref|XP_002285658.2|  PREDICTED: receptor-like serine/threonine-pr...    100   3e-21   Vitis vinifera
ref|XP_010055907.1|  PREDICTED: LRR receptor-like serine/threonin...  97.1    3e-21   
emb|CDM84625.1|  unnamed protein product                              98.6    3e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009628518.1|  PREDICTED: receptor protein kinase CLAVATA1-...    102   4e-21   Nicotiana tomentosiformis
ref|XP_001777220.1|  predicted protein                                  100   4e-21   
gb|EYU39369.1|  hypothetical protein MIMGU_mgv1a0024251mg             98.6    4e-21   Erythranthe guttata [common monkey flower]
ref|XP_011008125.1|  PREDICTED: inactive protein kinase SELMODRAF...  97.4    5e-21   Populus euphratica
ref|XP_009628517.1|  PREDICTED: LRR receptor-like serine/threonin...    102   6e-21   Nicotiana tomentosiformis
ref|XP_009803852.1|  PREDICTED: receptor-like protein kinase HSL1       101   1e-20   Nicotiana sylvestris
ref|XP_009339374.1|  PREDICTED: receptor-like serine/threonine-pr...  99.0    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_008226301.1|  PREDICTED: receptor-like serine/threonine-pr...  99.0    1e-20   Prunus mume [ume]
ref|XP_009389786.1|  PREDICTED: wall-associated receptor kinase-l...  97.4    1e-20   
ref|XP_010241346.1|  PREDICTED: receptor-like serine/threonine-pr...  98.6    1e-20   
ref|XP_010241342.1|  PREDICTED: receptor-like serine/threonine-pr...  98.6    1e-20   
ref|XP_010241344.1|  PREDICTED: receptor-like serine/threonine-pr...  98.6    1e-20   
ref|XP_009628514.1|  PREDICTED: receptor-like protein kinase 2 is...    101   2e-20   Nicotiana tomentosiformis
ref|XP_011098153.1|  PREDICTED: receptor-like serine/threonine-pr...  98.2    2e-20   Sesamum indicum [beniseed]
ref|XP_007022084.1|  Kinase superfamily protein isoform 2             98.2    2e-20   
ref|XP_008366523.1|  PREDICTED: receptor-like serine/threonine-pr...  97.8    2e-20   
ref|XP_007211497.1|  hypothetical protein PRUPE_ppa007835mg           97.8    2e-20   
ref|XP_007022083.1|  Kinase superfamily protein isoform 1             97.8    2e-20   
emb|CAN80774.1|  hypothetical protein VITISV_042330                     100   3e-20   
ref|XP_011085555.1|  PREDICTED: proline-rich receptor-like protei...    100   3e-20   
gb|KGN55018.1|  hypothetical protein Csa_4G622770                     96.3    3e-20   
ref|XP_001781606.1|  predicted protein                                97.4    3e-20   
ref|XP_010648291.1|  PREDICTED: receptor-like protein kinase HSL1       100   3e-20   
gb|KJB82092.1|  hypothetical protein B456_013G175900                  97.1    4e-20   
ref|XP_011045570.1|  PREDICTED: receptor-like serine/threonine-pr...  97.1    5e-20   
ref|XP_001771196.1|  predicted protein                                98.6    5e-20   
emb|CBI20580.3|  unnamed protein product                                100   5e-20   
dbj|BAG99359.1|  unnamed protein product                              96.7    5e-20   
ref|XP_001763816.1|  predicted protein                                97.1    6e-20   
dbj|BAD94141.1|  leucine-rich repeat receptor-like kinase At1g09970   96.7    6e-20   
ref|XP_002300445.2|  hypothetical protein POPTR_0001s38980g           96.7    6e-20   
gb|KDP39779.1|  hypothetical protein JCGZ_04938                       96.7    7e-20   
ref|XP_004146008.1|  PREDICTED: receptor-like serine/threonine-pr...  96.3    7e-20   
ref|XP_004294182.1|  PREDICTED: receptor-like serine/threonine-pr...  96.3    8e-20   
ref|XP_003631769.1|  PREDICTED: receptor-like protein kinase HSL1     99.4    9e-20   
ref|XP_006477799.1|  PREDICTED: receptor-like serine/threonine-pr...  96.3    9e-20   
gb|AEP84281.1|  leucine rich repeat-containing protein                99.4    9e-20   
ref|XP_006644402.1|  PREDICTED: probable receptor-like protein ki...  97.8    9e-20   
gb|KDO54052.1|  hypothetical protein CISIN_1g009340mg                 98.2    9e-20   
gb|AFW64545.1|  putative protein kinase superfamily protein           96.7    9e-20   
gb|AAS65794.1|  putative protein kinase                               94.7    1e-19   
ref|XP_002279394.1|  PREDICTED: receptor-like serine/threonine-pr...  95.9    1e-19   
ref|XP_004168305.1|  PREDICTED: receptor-like serine/threonine-pr...  96.3    1e-19   
dbj|BAK01734.1|  predicted protein                                    96.7    1e-19   
ref|XP_009779466.1|  PREDICTED: receptor-like protein kinase HSL1     99.0    1e-19   
ref|XP_010106739.1|  Receptor-like serine/threonine-protein kinase    95.9    1e-19   
ref|XP_006364718.1|  PREDICTED: receptor-like protein kinase HSL1...  95.5    1e-19   
ref|XP_007013526.1|  Receptor serine/threonine-protein kinase         96.7    1e-19   
dbj|BAB84387.1|  putative calcium/calmodulin-regulated receptor-l...  95.5    1e-19   
gb|ACI42311.1|  putative leucine rich repeat transmembrane protei...  99.0    1e-19   
ref|XP_010926408.1|  PREDICTED: probable receptor-like protein ki...  97.4    1e-19   
dbj|BAF01968.1|  receptor protein kinase like protein                 94.7    1e-19   
ref|XP_009394806.1|  PREDICTED: probable receptor-like protein ki...  97.4    1e-19   
emb|CBI20582.3|  unnamed protein product                              94.7    1e-19   
ref|NP_001172615.1|  Os01g0810750                                     94.7    1e-19   
ref|XP_006364729.1|  PREDICTED: receptor-like protein kinase 5-like   98.2    1e-19   
ref|XP_006474421.1|  PREDICTED: probable receptor-like protein ki...  96.3    1e-19   
ref|XP_002988273.1|  hypothetical protein SELMODRAFT_159261           95.9    1e-19   
ref|XP_007199391.1|  hypothetical protein PRUPE_ppa025898mg           98.2    1e-19   
ref|XP_010670077.1|  PREDICTED: calmodulin-binding receptor-like ...  96.3    2e-19   
ref|XP_008797510.1|  PREDICTED: probable receptor-like protein ki...  97.1    2e-19   
ref|XP_008797511.1|  PREDICTED: probable receptor-like protein ki...  97.1    2e-19   
ref|XP_006453077.1|  hypothetical protein CICLE_v10008365mg           96.3    2e-19   
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                   98.6    2e-19   
gb|KHG16379.1|  Receptor-like protein kinase HSL1                     96.7    2e-19   
ref|XP_011017021.1|  PREDICTED: receptor-like protein kinase HSL1     98.2    2e-19   
emb|CBI20585.3|  unnamed protein product                              95.1    2e-19   
gb|KEH38485.1|  receptor-like kinase                                  95.1    2e-19   
gb|KCW81624.1|  hypothetical protein EUGRSUZ_C02985                   98.2    2e-19   
gb|EAZ11200.1|  hypothetical protein OsJ_01050                        98.2    2e-19   
dbj|BAJ94332.1|  predicted protein                                    95.9    2e-19   
emb|CDP10443.1|  unnamed protein product                              95.9    2e-19   
ref|XP_009587881.1|  PREDICTED: receptor-like protein kinase HSL1     98.2    2e-19   
ref|NP_001238381.1|  receptor protein kinase                          94.0    2e-19   
gb|KFK31438.1|  hypothetical protein AALP_AA6G111800                  98.2    2e-19   
ref|XP_002964937.1|  hypothetical protein SELMODRAFT_82557            94.7    2e-19   
ref|XP_002986517.1|  hypothetical protein SELMODRAFT_124295           94.7    2e-19   
ref|XP_002980938.1|  hypothetical protein SELMODRAFT_113448           95.1    2e-19   
ref|XP_002527168.1|  Protein kinase APK1B, chloroplast precursor,...  95.9    2e-19   
ref|XP_002301126.1|  hypothetical protein POPTR_0002s11230g           98.2    2e-19   
ref|XP_010046357.1|  PREDICTED: leucine-rich repeat receptor-like...  98.2    2e-19   
ref|XP_006442320.1|  hypothetical protein CICLE_v10020891mg           95.1    2e-19   
gb|KDO52114.1|  hypothetical protein CISIN_1g018702mg                 95.1    2e-19   
ref|NP_001043648.1|  Os01g0631700                                     96.7    2e-19   
ref|XP_010061583.1|  PREDICTED: receptor-like protein kinase HAIKU2   98.2    2e-19   
ref|XP_004164767.1|  PREDICTED: receptor-like protein kinase HSL1...  98.2    2e-19   
ref|XP_002989320.1|  hypothetical protein SELMODRAFT_129596           94.7    2e-19   
ref|XP_002979054.1|  hypothetical protein SELMODRAFT_177353           95.5    2e-19   
ref|NP_001042546.1|  Os01g0239700                                     98.2    2e-19   
gb|EAY73225.1|  hypothetical protein OsI_01100                        98.2    2e-19   
dbj|BAJ89946.1|  predicted protein                                    94.7    3e-19   
ref|XP_006480433.1|  PREDICTED: wall-associated receptor kinase-l...  97.4    3e-19   
ref|XP_004148398.1|  PREDICTED: receptor-like protein kinase HSL1...  97.8    3e-19   
ref|XP_008444991.1|  PREDICTED: receptor-like protein kinase HSL1     97.8    3e-19   
gb|KJB64049.1|  hypothetical protein B456_010G030500                  97.8    3e-19   
ref|XP_006428596.1|  hypothetical protein CICLE_v10013593mg           97.1    3e-19   
ref|XP_010325071.1|  PREDICTED: LRR receptor-like serine/threonin...  97.4    3e-19   
ref|XP_004245385.2|  PREDICTED: LRR receptor-like serine/threonin...  97.1    3e-19   
ref|XP_002991492.1|  hypothetical protein SELMODRAFT_133579           95.1    3e-19   
dbj|BAD29061.1|  serine/threonine-specific receptor protein kinas...  95.9    3e-19   
gb|EEC84431.1|  hypothetical protein OsI_31037                        93.6    3e-19   
ref|XP_001766257.1|  predicted protein                                97.4    3e-19   
gb|ABR16311.1|  unknown                                               95.5    3e-19   
ref|XP_010049140.1|  PREDICTED: receptor-like protein kinase HSL1     97.4    3e-19   
gb|KJB06472.1|  hypothetical protein B456_001G044200                  95.1    4e-19   
gb|KHG19731.1|  hypothetical protein F383_25550                       95.1    4e-19   
gb|AEW08413.1|  hypothetical protein 2_9226_01                        90.9    4e-19   
gb|KJB06473.1|  hypothetical protein B456_001G044200                  95.1    4e-19   
ref|XP_006575659.1|  PREDICTED: probable receptor-like protein ki...  95.1    4e-19   
ref|XP_007153306.1|  hypothetical protein PHAVU_003G024000g           97.1    4e-19   
ref|XP_006492008.1|  PREDICTED: putative wall-associated receptor...  95.5    4e-19   
ref|XP_004966984.1|  PREDICTED: proline-rich receptor-like protei...  96.3    4e-19   
emb|CDO98692.1|  unnamed protein product                              96.7    4e-19   
ref|XP_010675415.1|  PREDICTED: putative serine/threonine-protein...  94.7    4e-19   
gb|KDP30253.1|  hypothetical protein JCGZ_17035                       95.1    4e-19   
ref|XP_010675411.1|  PREDICTED: putative serine/threonine-protein...  94.7    4e-19   
ref|XP_010491332.1|  PREDICTED: leucine-rich repeat receptor prot...  97.4    4e-19   
ref|XP_004291157.1|  PREDICTED: receptor-like protein kinase 5        97.1    4e-19   
ref|XP_002440392.1|  hypothetical protein SORBIDRAFT_09g000220        94.0    5e-19   
ref|XP_010229848.1|  PREDICTED: proline-rich receptor-like protei...  94.7    5e-19   
gb|ABR17553.1|  unknown                                               94.0    5e-19   
ref|XP_004237515.1|  PREDICTED: leucine-rich repeat receptor-like...  97.1    5e-19   
ref|XP_010648290.1|  PREDICTED: receptor-like protein kinase 5 is...  97.1    5e-19   
emb|CDP04271.1|  unnamed protein product                              97.1    5e-19   
ref|XP_002889783.1|  hypothetical protein ARALYDRAFT_888256           96.7    5e-19   
ref|XP_008452434.1|  PREDICTED: receptor-like serine/threonine-pr...  94.0    5e-19   
ref|XP_010277643.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  94.7    5e-19   
ref|XP_002456009.1|  hypothetical protein SORBIDRAFT_03g028800        95.5    5e-19   
ref|XP_006367082.1|  PREDICTED: receptor-like protein kinase HAIK...  97.1    5e-19   
ref|XP_010112470.1|  Receptor-like serine/threonine-protein kinase    94.7    6e-19   
gb|AGT16797.1|  ATP binding protein                                   95.5    6e-19   
gb|AAK52544.1|AC078891_13  Putative receptor-like protein kinase      97.1    6e-19   
emb|CBI20586.3|  unnamed protein product                              96.7    6e-19   
ref|NP_001146428.1|  uncharacterized protein LOC100280010             92.0    6e-19   
ref|XP_008679322.1|  PREDICTED: probable LRR receptor-like serine...  96.7    6e-19   
ref|XP_007145035.1|  hypothetical protein PHAVU_007G204300g           95.5    6e-19   
gb|KDO54051.1|  hypothetical protein CISIN_1g046188mg                 96.3    6e-19   
ref|XP_007202128.1|  hypothetical protein PRUPE_ppa006069mg           94.7    6e-19   
emb|CDY21453.1|  BnaC03g27440D                                        94.7    6e-19   
ref|XP_009762091.1|  PREDICTED: probable receptor-like protein ki...  94.4    6e-19   
gb|AGT17266.1|  hypothetical protein SHCRBa_022_D05_R_300             95.5    6e-19   
ref|XP_007149372.1|  hypothetical protein PHAVU_005G064700g           94.0    6e-19   
emb|CBI20587.3|  unnamed protein product                              96.7    6e-19   
ref|XP_002278306.2|  PREDICTED: receptor-like protein kinase 5 is...  96.7    6e-19   
ref|XP_006417507.1|  hypothetical protein EUTSA_v10006696mg           96.7    6e-19   
ref|XP_011098386.1|  PREDICTED: probable receptor-like protein ki...  95.5    6e-19   
emb|CAE03948.3|  OSJNba0093F12.22                                     96.3    6e-19   
ref|XP_010645959.1|  PREDICTED: probable LRR receptor-like serine...  96.7    6e-19   
ref|XP_004287283.1|  PREDICTED: probable receptor-like protein ki...  94.7    6e-19   
gb|EEC72500.1|  hypothetical protein OsI_05872                        96.7    6e-19   
ref|XP_006656979.1|  PREDICTED: proline-rich receptor-like protei...  94.0    6e-19   
ref|XP_008794074.1|  PREDICTED: wall-associated receptor kinase-l...  95.9    6e-19   
emb|CBI20588.3|  unnamed protein product                              97.1    6e-19   
dbj|BAD38053.1|  putative light repressible receptor protein kinase   96.7    7e-19   
ref|XP_006286925.1|  hypothetical protein CARUB_v10000068mg           96.7    7e-19   
ref|XP_006428597.1|  hypothetical protein CICLE_v10011219mg           96.3    7e-19   
ref|XP_004969248.1|  PREDICTED: probable receptor-like protein ki...  95.5    7e-19   
ref|XP_006442751.1|  hypothetical protein CICLE_v10018723mg           96.7    7e-19   
ref|XP_011017856.1|  PREDICTED: calmodulin-binding receptor-like ...  95.1    7e-19   
ref|XP_009783572.1|  PREDICTED: leucine-rich repeat receptor-like...  96.7    7e-19   
gb|EEE55560.1|  hypothetical protein OsJ_03825                        96.3    7e-19   
ref|XP_003536030.1|  PREDICTED: probable receptor-like protein ki...  95.1    7e-19   
gb|EYU39493.1|  hypothetical protein MIMGU_mgv1a025586mg              96.3    8e-19   
ref|NP_001053747.1|  Os04g0599000                                     95.9    8e-19   
gb|EAY76225.1|  hypothetical protein OsI_04161                        96.3    8e-19   
ref|XP_008800690.1|  PREDICTED: probable receptor-like protein ki...  95.1    8e-19   
ref|XP_007143951.1|  hypothetical protein PHAVU_007G116300g           96.7    8e-19   
ref|XP_006841050.1|  hypothetical protein AMTR_s00085p00158310        95.9    8e-19   
ref|XP_009798995.1|  PREDICTED: putative wall-associated receptor...  95.9    8e-19   
ref|XP_002965380.1|  hypothetical protein SELMODRAFT_24884            93.2    8e-19   
ref|XP_002991493.1|  hypothetical protein SELMODRAFT_133636           94.0    8e-19   
gb|AGV22099.1|  receptor protein kinase                               95.9    8e-19   
emb|CBI20535.3|  unnamed protein product                              96.3    8e-19   
ref|NP_001044587.1|  Os01g0810900                                     96.3    8e-19   
ref|NP_001064047.2|  Os10g0114400                                     96.7    8e-19   
ref|XP_010688211.1|  PREDICTED: proline-rich receptor-like protei...  95.5    8e-19   
emb|CAN66040.1|  hypothetical protein VITISV_035756                   95.5    8e-19   
gb|KJB58763.1|  hypothetical protein B456_009G225100                  96.3    8e-19   
gb|EPS61733.1|  hypothetical protein M569_13062                       90.9    8e-19   
ref|XP_002271607.3|  PREDICTED: probable LRR receptor-like serine...  96.3    8e-19   
dbj|BAD68200.1|  putative light repressible receptor protein kinase   96.3    8e-19   
ref|XP_006348958.1|  PREDICTED: probable receptor-like protein ki...  95.1    8e-19   
ref|XP_009780464.1|  PREDICTED: wall-associated receptor kinase 2...  96.3    8e-19   
ref|XP_011018851.1|  PREDICTED: wall-associated receptor kinase-l...  95.5    9e-19   
ref|XP_002978933.1|  hypothetical protein SELMODRAFT_177358           94.0    9e-19   
ref|XP_010645957.1|  PREDICTED: probable LRR receptor-like serine...  96.3    9e-19   
gb|KHN11969.1|  Putative receptor-like protein kinase                 95.1    9e-19   
ref|XP_010645958.1|  PREDICTED: probable LRR receptor-like serine...  96.3    9e-19   
ref|XP_009381679.1|  PREDICTED: receptor-like serine/threonine-pr...  93.2    9e-19   
gb|EMS48532.1|  Proline-rich receptor-like protein kinase PERK8       93.2    9e-19   
ref|XP_011017855.1|  PREDICTED: calmodulin-binding receptor-like ...  95.1    9e-19   
gb|KHN38324.1|  Putative receptor-like protein kinase                 95.1    9e-19   
gb|EMT32300.1|  Putative serine/threonine-protein kinase              93.2    9e-19   
ref|XP_006575654.1|  PREDICTED: probable receptor-like protein ki...  95.1    9e-19   
ref|XP_004243208.1|  PREDICTED: probable receptor-like protein ki...  95.1    9e-19   
ref|XP_007018366.1|  Leucine-rich repeat transmembrane protein ki...  96.3    9e-19   
gb|EPS64239.1|  hypothetical protein M569_10541                       93.2    9e-19   
emb|CDP15875.1|  unnamed protein product                              96.3    9e-19   
ref|XP_010648289.1|  PREDICTED: receptor-like protein kinase HSL1     96.3    9e-19   
gb|EMS54404.1|  Proline-rich receptor-like protein kinase PERK8       95.1    9e-19   
ref|XP_006595756.1|  PREDICTED: probable receptor-like protein ki...  95.1    9e-19   
ref|XP_010243707.1|  PREDICTED: probable receptor-like protein ki...  94.7    1e-18   
ref|XP_007225200.1|  hypothetical protein PRUPE_ppa002064mg           95.9    1e-18   
ref|XP_009762090.1|  PREDICTED: probable receptor-like protein ki...  94.4    1e-18   
gb|EPS73567.1|  hypothetical protein M569_01191                       92.0    1e-18   
ref|XP_006643977.1|  PREDICTED: receptor-like protein kinase HSL1...  96.3    1e-18   
ref|XP_010667798.1|  PREDICTED: receptor-like protein kinase HSL1     96.3    1e-18   
gb|KFK43299.1|  hypothetical protein AALP_AA1G106000                  95.9    1e-18   
gb|KCW79628.1|  hypothetical protein EUGRSUZ_C00987                   95.9    1e-18   
ref|XP_010924307.1|  PREDICTED: probable receptor-like protein ki...  94.7    1e-18   
ref|XP_008243134.1|  PREDICTED: proline-rich receptor-like protei...  95.9    1e-18   
ref|XP_004488675.1|  PREDICTED: receptor-like serine/threonine-pr...  93.2    1e-18   
ref|XP_002977227.1|  hypothetical protein SELMODRAFT_24883            92.8    1e-18   
tpg|DAA52780.1|  TPA: putative prolin-rich extensin-like receptor...  93.2    1e-18   
gb|EEE69547.1|  hypothetical protein OsJ_29034                        95.9    1e-18   
ref|XP_004488679.1|  PREDICTED: receptor-like serine/threonine-pr...  93.2    1e-18   
gb|AFK49115.1|  unknown                                               92.4    1e-18   
gb|EAZ08768.1|  hypothetical protein OsI_31031                        92.4    1e-18   
ref|XP_002516533.1|  serine-threonine protein kinase, plant-type,...  95.9    1e-18   
gb|KDO37944.1|  hypothetical protein CISIN_1g039736mg                 95.1    1e-18   
gb|EMT18055.1|  Wall-associated receptor kinase 5                     95.5    1e-18   
ref|XP_002301367.1|  hypothetical protein POPTR_0002s16310g           93.2    1e-18   
gb|KJB69979.1|  hypothetical protein B456_011G052000                  93.2    1e-18   
gb|KHN10176.1|  Leucine-rich repeat receptor-like protein kinase ...  91.7    1e-18   
gb|AFW79385.1|  putative protein kinase superfamily protein           92.4    1e-18   
ref|XP_010047669.1|  PREDICTED: receptor-like protein kinase 5        95.9    1e-18   
ref|XP_006856462.1|  hypothetical protein AMTR_s00046p00017580        92.0    1e-18   
gb|EEE65746.1|  hypothetical protein OsJ_21402                        96.3    1e-18   
gb|KHN18088.1|  Putative receptor-like protein kinase                 94.4    1e-18   
gb|KDP29525.1|  hypothetical protein JCGZ_19238                       95.1    1e-18   
emb|CDM83465.1|  unnamed protein product                              94.4    1e-18   
ref|XP_010312390.1|  PREDICTED: wall-associated receptor kinase 5...  91.3    1e-18   
gb|KJB54000.1|  hypothetical protein B456_009G015800                  93.6    1e-18   
ref|XP_010250180.1|  PREDICTED: probable receptor-like protein ki...  93.6    1e-18   
gb|KDO42901.1|  hypothetical protein CISIN_1g003199mg                 95.5    1e-18   



>ref|XP_009757535.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nicotiana sylvestris]
Length=964

 Score =   275 bits (702),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH ST+VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPV ND N
Sbjct  788  AKCIPTAKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVHNDLN  847

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVMEAVD EVSVTC DL+HV KTFQLALLCTKR P ERPTMHEV RVL
Sbjct  848  LHQLILSKADNNTVMEAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVL  907

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLPPPP KPCL P KSI+Y +F++GKG  + QQ+ NSSDAQWLVRFREAISKNT 
Sbjct  908  VSLLPPPPTKPCLDPPKSIDYTKFVLGKGLPQAQQNDNSSDAQWLVRFREAISKNTF  964



>ref|XP_009757534.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nicotiana sylvestris]
Length=967

 Score =   275 bits (702),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH ST+VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPV ND N
Sbjct  791  AKCIPTAKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVHNDLN  850

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVMEAVD EVSVTC DL+HV KTFQLALLCTKR P ERPTMHEV RVL
Sbjct  851  LHQLILSKADNNTVMEAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVL  910

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLPPPP KPCL P KSI+Y +F++GKG  + QQ+ NSSDAQWLVRFREAISKNT 
Sbjct  911  VSLLPPPPTKPCLDPPKSIDYTKFVLGKGLPQAQQNDNSSDAQWLVRFREAISKNTF  967



>ref|XP_009600406.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Nicotiana tomentosiformis]
Length=967

 Score =   273 bits (698),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH ST+VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPV ND N
Sbjct  791  AKCIPTAKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVHNDLN  850

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVMEAVD EVSVTC DL+HV KTFQLALLCTKR P ERPTMHEV RVL
Sbjct  851  LHQLILSKADNNTVMEAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVSRVL  910

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLPPPP KPCL P KSI+Y +F++GKG  + QQ  NSSDAQWLVRFREAISKNT+
Sbjct  911  VSLLPPPPTKPCLAPPKSIDYTKFVLGKGLPQVQQSENSSDAQWLVRFREAISKNTI  967



>emb|CAN79933.1| hypothetical protein VITISV_008329 [Vitis vinifera]
Length=340

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 152/187 (81%), Gaps = 10/187 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  154  AKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  213

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC DL+HV KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  214  LHQLILSKADDNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARVL  273

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN--------QQDGNSS--DAQWLVRFRE  225
             SLLP PP KPC  P K I+YA F++ KGQ +         + D N+S  DAQW VRF E
Sbjct  274  VSLLPAPPAKPCSSPPKPIDYAHFVMDKGQKQQNAQLPPHVEPDNNTSSNDAQWFVRFHE  333

Query  224  AISKNTL  204
             ISKN+L
Sbjct  334  VISKNSL  340



>ref|XP_010109087.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Morus 
notabilis]
 gb|EXC20887.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Morus 
notabilis]
Length=527

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 152/185 (82%), Gaps = 8/185 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  343  AKSIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  402

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVMEAVD EVSVTC DL+HV KTFQLALLCTKR PSERPTMHE+ RVL
Sbjct  403  LHQLILSKADNNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRNPSERPTMHEIARVL  462

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE--------NQQDGNSSDAQWLVRFREAI  219
             SLLP P +KPC    K+I+YA+F+V KG  +         QQ+ NSSDAQW VRF E I
Sbjct  463  VSLLPAPAIKPCPITPKTIDYAKFVVDKGGQQPKVMQPLARQQENNSSDAQWFVRFGEVI  522

Query  218  SKNTL  204
            SKNTL
Sbjct  523  SKNTL  527



>ref|XP_006348051.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X1 [Solanum tuberosum]
Length=975

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI SAKTH ST VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDND N
Sbjct  798  AKCIPSAKTHASTLVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDLN  857

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SKAD+NTVM+AVD EVSVTC DL+HV KTFQLALLCTKR P ERPTMHEV RVL
Sbjct  858  LHQLIMSKADDNTVMDAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVL  917

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             + L PPP      PP KSI+Y +F++GKG  + QQ  +SS+AQWLVRF+EAISKN+L
Sbjct  918  VSLLPPPPTKPCLDPPPKSIDYTKFVIGKGLPQVQQGDDSSEAQWLVRFQEAISKNSL  975



>ref|XP_006348052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like isoform X2 [Solanum tuberosum]
Length=973

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI SAKTH ST VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDND N
Sbjct  796  AKCIPSAKTHASTLVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDLN  855

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SKAD+NTVM+AVD EVSVTC DL+HV KTFQLALLCTKR P ERPTMHEV RVL
Sbjct  856  LHQLIMSKADDNTVMDAVDPEVSVTCMDLTHVRKTFQLALLCTKRFPCERPTMHEVARVL  915

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             + L PPP      PP KSI+Y +F++GKG  + QQ  +SS+AQWLVRF+EAISKN+L
Sbjct  916  VSLLPPPPTKPCLDPPPKSIDYTKFVIGKGLPQVQQGDDSSEAQWLVRFQEAISKNSL  973



>ref|XP_007038488.1| ERECTA-like 1 [Theobroma cacao]
 gb|EOY22989.1| ERECTA-like 1 [Theobroma cacao]
Length=991

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 152/186 (82%), Gaps = 9/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + KTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  806  AKCIPTTKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVS+TC DLSHV KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  866  LHQLILSKADDNTVMEAVDPEVSITCMDLSHVRKTFQLALLCTKRHPSERPTMHEVARVL  925

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDG---------NSSDAQWLVRFREA  222
             SLLP PP K    P KSI+Y+QF++GKGQ   Q +          NSSDAQW VRFRE 
Sbjct  926  VSLLPAPPTKLSSAPPKSIDYSQFVIGKGQKRLQLEQQQPQVEQETNSSDAQWFVRFREV  985

Query  221  ISKNTL  204
            ISKNTL
Sbjct  986  ISKNTL  991



>ref|NP_001237639.1| ERECTA-like kinase [Glycine max]
 gb|ACM89517.1| ERECTA-like kinase [Glycine max]
Length=828

 Score =   259 bits (663),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 152/182 (84%), Gaps = 6/182 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCIS+AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  647  AKCISTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  706

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVMEAVD EVS+TCTDL+HV KTFQLALLCTK+ PSERP+MHEV RVL
Sbjct  707  LHQLILSKADNNTVMEAVDPEVSITCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVL  766

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN------QQDGNSSDAQWLVRFREAISK  213
             SLLP PP K   PP+K  +YA F++ KGQ         QQD NSS+AQW VRF + ISK
Sbjct  767  VSLLPSPPSKILAPPAKKFDYAHFVIEKGQQRKMEEQKPQQDNNSSNAQWFVRFGDVISK  826

Query  212  NT  207
            +T
Sbjct  827  ST  828



>ref|XP_004234153.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Solanum lycopersicum]
Length=976

 Score =   261 bits (666),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH ST VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDND N
Sbjct  799  AKCIPTAKTHASTLVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDLN  858

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SKAD+NTVM+AVD EVSVTC DL HV KTFQLALLC KR P ERPTMHEV RVL
Sbjct  859  LHQLIMSKADDNTVMDAVDPEVSVTCMDLMHVRKTFQLALLCAKRFPCERPTMHEVARVL  918

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             + L PPP      PP KSI+Y +F++GKG  + QQ  NSS+AQWLVRF+EAISKN+L
Sbjct  919  VSLLPPPPTKPCLDPPPKSIDYTKFVIGKGLPQVQQGDNSSEAQWLVRFQEAISKNSL  976



>ref|XP_006588387.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
 gb|KHN02765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 152/182 (84%), Gaps = 6/182 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCIS+AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  812  AKCISTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  871

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVMEAVD EVS+TCTDL+HV KTFQLALLCTK+ PSERP+MHEV RVL
Sbjct  872  LHQLILSKADNNTVMEAVDPEVSITCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVL  931

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN------QQDGNSSDAQWLVRFREAISK  213
             SLLP PP K   PP+K  +YA F++ KGQ         QQD NSS+AQW VRF + ISK
Sbjct  932  VSLLPSPPSKILAPPAKKFDYAHFVIEKGQQRKMEEQKPQQDNNSSNAQWFVRFGDVISK  991

Query  212  NT  207
            +T
Sbjct  992  ST  993



>ref|XP_006588388.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=989

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 152/182 (84%), Gaps = 6/182 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCIS+AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  808  AKCISTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  867

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVMEAVD EVS+TCTDL+HV KTFQLALLCTK+ PSERP+MHEV RVL
Sbjct  868  LHQLILSKADNNTVMEAVDPEVSITCTDLAHVKKTFQLALLCTKKNPSERPSMHEVARVL  927

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN------QQDGNSSDAQWLVRFREAISK  213
             SLLP PP K   PP+K  +YA F++ KGQ         QQD NSS+AQW VRF + ISK
Sbjct  928  VSLLPSPPSKILAPPAKKFDYAHFVIEKGQQRKMEEQKPQQDNNSSNAQWFVRFGDVISK  987

Query  212  NT  207
            +T
Sbjct  988  ST  989



>gb|KDP22376.1| hypothetical protein JCGZ_26207 [Jatropha curcas]
Length=992

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 150/184 (82%), Gaps = 7/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ + KTH  TYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  809  AKCLPTTKTHALTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  868

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVME VD EVSVTC DL+HV KTFQLALLCTK  PSERPTMHEVVRVL
Sbjct  869  LHQLILSKADNNTVMEVVDQEVSVTCVDLTHVRKTFQLALLCTKPYPSERPTMHEVVRVL  928

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN-------QQDGNSSDAQWLVRFREAIS  216
             S LP P +KPC  P K I+YA+F++ KGQ +        QQ+ NSSDAQW V FRE IS
Sbjct  929  VSFLPAPAMKPCSAPPKRIDYAKFVIDKGQQQPAPKQEQAQQENNSSDAQWFVGFREVIS  988

Query  215  KNTL  204
            KNTL
Sbjct  989  KNTL  992



>ref|XP_002510897.1| erecta, putative [Ricinus communis]
 gb|EEF51499.1| erecta, putative [Ricinus communis]
Length=948

 Score =   258 bits (660),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 153/185 (83%), Gaps = 8/185 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCIS+AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  764  AKCISTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  823

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVME VD EVSVTC D++HV KTFQLALLCTKR PSERPTM EVVRVL
Sbjct  824  LHQLILSKADDNTVMEVVDQEVSVTCMDITHVRKTFQLALLCTKRHPSERPTMPEVVRVL  883

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTEN-------QQDGNSSDAQWLVRFREAI  219
             + L  PP  KPC  P K I+YA+F++ KGQ +        QQ+ NSSDAQW +RFRE I
Sbjct  884  VSFLPAPPTKKPCSAPPKPIDYAKFVIDKGQQQPAPKNQLAQQENNSSDAQWFLRFREVI  943

Query  218  SKNTL  204
            SKNTL
Sbjct  944  SKNTL  948



>ref|XP_002269540.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Vitis vinifera]
Length=989

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 152/187 (81%), Gaps = 10/187 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  803  AKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  862

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC DL+HV KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  863  LHQLILSKADDNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRHPSERPTMHEVARVL  922

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN--------QQDGNSS--DAQWLVRFRE  225
             SLLP PP KPC  P K I+YA F++ KGQ +         + D N+S  DAQW VRF E
Sbjct  923  VSLLPAPPAKPCSSPPKPIDYAHFVMDKGQKQQNAQLPPHVEPDNNTSSNDAQWFVRFHE  982

Query  224  AISKNTL  204
             ISKN+L
Sbjct  983  VISKNSL  989



>emb|CDP20026.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 152/184 (83%), Gaps = 7/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK IS+AKTH STYVLGTIGYIDPEYARTSRLTEKSDVYSFG+VLLELLTGKK VDN+SN
Sbjct  307  AKSISAAKTHESTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDNNSN  366

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+IL KAD+NT+MEAVD EVSVTC DL HV K FQLALLCT+  PSERPT+HEV RVL
Sbjct  367  LHQMILLKADDNTIMEAVDPEVSVTCMDLGHVKKVFQLALLCTRPHPSERPTIHEVARVL  426

Query  374  TsllpppplkpclppskSINYAQFLVGKGQT-------ENQQDGNSSDAQWLVRFREAIS  216
             SLLPPPP KP L  +K+INY+QF++ K Q+       + + D NSSDA+W VRF E +S
Sbjct  427  VSLLPPPPTKPALGTAKTINYSQFVIAKEQSQLKTMQPQVRGDNNSSDAEWFVRFGEVVS  486

Query  215  KNTL  204
            KNT+
Sbjct  487  KNTI  490



>ref|XP_011029995.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=984

 Score =   248 bits (634),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 144/187 (77%), Gaps = 11/187 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + KTH ST+VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  799  AKCIPTTKTHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNESN  858

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L QLILS+AD+NTVMEAVD EVSVTC DL+HV K+FQLALLCTKR PSERPTM +V RVL
Sbjct  859  LQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRVL  918

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ----------QDGNSSDAQWLVRFRE  225
                 P          K I+YA+F++ KGQ + Q          Q+ NSSDAQW VRF+E
Sbjct  919  V-SFLPALPTKASLLPKPIDYAKFVIDKGQQQQQPSIVNQQQPSQENNSSDAQWFVRFKE  977

Query  224  AISKNTL  204
             +SKNTL
Sbjct  978  VVSKNTL  984



>ref|XP_007143329.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
 gb|ESW15323.1| hypothetical protein PHAVU_007G063200g [Phaseolus vulgaris]
Length=987

 Score =   248 bits (634),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 6/182 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK IS+A+TH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  806  AKSISTARTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLIL+KADNNTVMEAVD+EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  866  LHQLILAKADNNTVMEAVDAEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVL  925

Query  374  TsllpppplkpclppskSINYAQFLVGKGQT------ENQQDGNSSDAQWLVRFREAISK  213
             SLLP PP K   PP+K  +YA F++ KGQ       +  Q+ NS++AQW VRF + ISK
Sbjct  926  VSLLPSPPSKILAPPAKKFDYAHFVIEKGQPRKVEGQQPHQEDNSTNAQWFVRFGDVISK  985

Query  212  NT  207
            +T
Sbjct  986  ST  987



>ref|XP_010940921.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Elaeis guineensis]
Length=988

 Score =   247 bits (630),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 145/180 (81%), Gaps = 3/180 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  809  AKCIPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  868

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTC D+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  869  LHQLILSKADDNTVMEAVDSEVSVTCMDMGLVKKAFQLALLCTKRHPSDRPTMHEVARVL  928

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE---NQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP P LKP L P K ++YA +L      +   N  D +SSD QW +RF E ISKNTL
Sbjct  929  VSLLPVPSLKPGLVPQKPMDYAHYLAAGPDVKIKRNHDDNSSSDGQWFLRFGEVISKNTL  988



>gb|KHG06831.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Gossypium 
arboreum]
Length=991

 Score =   247 bits (630),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 149/188 (79%), Gaps = 11/188 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + KTHTSTYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  804  AKCIPTTKTHTSTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC +L+HV KTFQLALLCTKRLPSERPTMHEV R L
Sbjct  864  LHQLILSKADDNTVMEAVDPEVSVTCMNLTHVRKTFQLALLCTKRLPSERPTMHEVARAL  923

Query  374  -TsllpppplkpclppskSINYAQFLVGKG----------QTENQQDGNSSDAQWLVRFR  228
             + L   P  K C  P+K ++YA+F+V +G          + +  Q+ NSSDAQW  RFR
Sbjct  924  VSLLPSAPAPKLCSAPTKPVDYARFIVDEGLQRSQKEQQQRQQVPQETNSSDAQWFARFR  983

Query  227  EAISKNTL  204
            E IS NTL
Sbjct  984  EVISMNTL  991



>gb|KEH43759.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=993

 Score =   247 bits (630),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 148/184 (80%), Gaps = 7/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  810  AKSIPATKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  869

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC DL+HV KTFQLALLCT+R PSERP+MHEV RVL
Sbjct  870  LHQLILSKADSNTVMEAVDPEVSVTCIDLAHVKKTFQLALLCTRRNPSERPSMHEVARVL  929

Query  374  TsllpppplkpclppskSINYAQFLVGKGQ-------TENQQDGNSSDAQWLVRFREAIS  216
             SLLPPPP K     +KS +YA F+  KGQ        + QQD N S+AQW VRF + IS
Sbjct  930  ISLLPPPPSKVVAAAAKSFDYAPFVAEKGQHHRKLDGLQPQQDNNLSNAQWFVRFGDVIS  989

Query  215  KNTL  204
            K++L
Sbjct  990  KSSL  993



>emb|CBI24498.3| unnamed protein product [Vitis vinifera]
Length=930

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 139/187 (74%), Gaps = 29/187 (16%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  763  AKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  822

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC DL+HV KTFQLALLCTKR PSERPTMHEV R  
Sbjct  823  LHQLILSKADDNTVMEAVDPEVSVTCMDLAHVRKTFQLALLCTKRHPSERPTMHEVAR--  880

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN--------QQDGNSS--DAQWLVRFRE  225
                              I+YA F++ KGQ +         + D N+S  DAQW VRF E
Sbjct  881  -----------------PIDYAHFVMDKGQKQQNAQLPPHVEPDNNTSSNDAQWFVRFHE  923

Query  224  AISKNTL  204
             ISKN+L
Sbjct  924  VISKNSL  930



>ref|XP_010035002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Eucalyptus grandis]
 gb|KCW46259.1| hypothetical protein EUGRSUZ_K00138 [Eucalyptus grandis]
Length=948

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 150/185 (81%), Gaps = 8/185 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  764  AKCLPTAKTHASTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNESN  823

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L Q+ILSKADNNTVMEAVD EVSVTC D+S V K FQLALLC KR PSERPTMHEV RVL
Sbjct  824  LLQMILSKADNNTVMEAVDPEVSVTCMDISLVKKVFQLALLCAKRYPSERPTMHEVARVL  883

Query  374  TsllpppplkpclppskSINYAQFLV-GKGQ-------TENQQDGNSSDAQWLVRFREAI  219
             SLLP P  KP     K+I+YA+F++  KGQ        + +Q+ ++SDAQW ++FRE I
Sbjct  884  ISLLPAPASKPSSCNVKTIDYARFVINNKGQQQLMSQLPQVRQEDSTSDAQWFLKFREVI  943

Query  218  SKNTL  204
            SKNTL
Sbjct  944  SKNTL  948



>gb|KHN15712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=993

 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 146/182 (80%), Gaps = 6/182 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCIS+ +TH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  812  AKCISTTRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  871

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  872  LHQLILSKADSNTVMEAVDPEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVL  931

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN------QQDGNSSDAQWLVRFREAISK  213
             SLLP P  K   PP+K  +YA F++ KGQ         QQD    +AQW VRF + ISK
Sbjct  932  VSLLPSPLSKILAPPAKKFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDVISK  991

Query  212  NT  207
            +T
Sbjct  992  ST  993



>emb|CDP05285.1| unnamed protein product [Coffea canephora]
Length=948

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 152/184 (83%), Gaps = 7/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK IS+AKTH STYVLGTIGYIDPEYARTSRLTEKSDVYSFG+VLLELLTGKK VDN+SN
Sbjct  765  AKSISAAKTHESTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDNNSN  824

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+IL KAD+NT+MEAVD EVSVTC DL HV K FQLALLCT+  PSERPT+HEV RVL
Sbjct  825  LHQMILLKADDNTIMEAVDPEVSVTCMDLGHVKKVFQLALLCTRPHPSERPTIHEVARVL  884

Query  374  TsllpppplkpclppskSINYAQFLVGKGQT-------ENQQDGNSSDAQWLVRFREAIS  216
             SLLPPPP KP L  +K+INY+QF++ K Q+       + + D NSSDA+W VRF E +S
Sbjct  885  VSLLPPPPTKPALGTAKTINYSQFVIAKEQSQLKTMQPQVRGDNNSSDAEWFVRFGEVVS  944

Query  215  KNTL  204
            KNT+
Sbjct  945  KNTI  948



>gb|KJB39364.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
 gb|KJB39365.1| hypothetical protein B456_007G009000 [Gossypium raimondii]
Length=993

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 148/188 (79%), Gaps = 11/188 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + KTHTSTYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  806  AKCIPTTKTHTSTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC +L+HV KTFQLALLCTKR PSERPTMHEV R L
Sbjct  866  LHQLILSKADDNTVMEAVDPEVSVTCMNLTHVRKTFQLALLCTKRHPSERPTMHEVARAL  925

Query  374  -TsllpppplkpclppskSINYAQFLVGKG----------QTENQQDGNSSDAQWLVRFR  228
             + L   P  K C  P+K ++YA+F++ KG          + +  Q+ NSSDAQW  RFR
Sbjct  926  VSLLPSAPAPKLCSAPTKPVDYARFIIDKGLQRSQKEQQQRQQVPQETNSSDAQWFARFR  985

Query  227  EAISKNTL  204
            E IS NTL
Sbjct  986  EVISMNTL  993



>ref|XP_010277441.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=962

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 149/183 (81%), Gaps = 6/183 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCISSAKTH+ST+V+GTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  779  AKCISSAKTHSSTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  838

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVME VD EVSVTC D+  V KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  839  LHQLILSKADDNTVMEVVDPEVSVTCMDMGLVRKTFQLALLCTKRNPSERPTMHEVARVL  898

Query  374  TsllpppplkpclppskSINYAQFLVGK------GQTENQQDGNSSDAQWLVRFREAISK  213
             SLLPPPP K C    K INYAQF+V K       Q + QQD  SSDAQW ++F E ISK
Sbjct  899  VSLLPPPPSKSCTLSPKLINYAQFVVNKEGKQHHHQQQGQQDNCSSDAQWFMKFGEVISK  958

Query  212  NTL  204
             TL
Sbjct  959  TTL  961



>ref|XP_010277442.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
 ref|XP_010277443.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Nelumbo nucifera]
Length=947

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 149/183 (81%), Gaps = 6/183 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCISSAKTH+ST+V+GTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  764  AKCISSAKTHSSTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  823

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVME VD EVSVTC D+  V KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  824  LHQLILSKADDNTVMEVVDPEVSVTCMDMGLVRKTFQLALLCTKRNPSERPTMHEVARVL  883

Query  374  TsllpppplkpclppskSINYAQFLVGK------GQTENQQDGNSSDAQWLVRFREAISK  213
             SLLPPPP K C    K INYAQF+V K       Q + QQD  SSDAQW ++F E ISK
Sbjct  884  VSLLPPPPSKSCTLSPKLINYAQFVVNKEGKQHHHQQQGQQDNCSSDAQWFMKFGEVISK  943

Query  212  NTL  204
             TL
Sbjct  944  TTL  946



>ref|XP_010277439.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=986

 Score =   245 bits (625),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 149/183 (81%), Gaps = 6/183 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCISSAKTH+ST+V+GTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  803  AKCISSAKTHSSTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  862

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVME VD EVSVTC D+  V KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  863  LHQLILSKADDNTVMEVVDPEVSVTCMDMGLVRKTFQLALLCTKRNPSERPTMHEVARVL  922

Query  374  TsllpppplkpclppskSINYAQFLVGK------GQTENQQDGNSSDAQWLVRFREAISK  213
             SLLPPPP K C    K INYAQF+V K       Q + QQD  SSDAQW ++F E ISK
Sbjct  923  VSLLPPPPSKSCTLSPKLINYAQFVVNKEGKQHHHQQQGQQDNCSSDAQWFMKFGEVISK  982

Query  212  NTL  204
             TL
Sbjct  983  TTL  985



>ref|XP_006606082.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X1 [Glycine max]
Length=993

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCIS+ +TH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  812  AKCISTTRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  871

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVME VD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  872  LHQLILSKADSNTVMETVDPEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVL  931

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN------QQDGNSSDAQWLVRFREAISK  213
             SLLP P  K   PP+K  +YA F++ KGQ         QQD    +AQW VRF + ISK
Sbjct  932  VSLLPSPLSKILAPPAKKFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDVISK  991

Query  212  NT  207
            +T
Sbjct  992  ST  993



>ref|XP_006606083.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like isoform X2 [Glycine max]
Length=989

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 145/182 (80%), Gaps = 6/182 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCIS+ +TH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  808  AKCISTTRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  867

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVME VD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  868  LHQLILSKADSNTVMETVDPEVSITCIDLAHVKKTFQLALLCTKKNPSERPTMHEVARVL  927

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN------QQDGNSSDAQWLVRFREAISK  213
             SLLP P  K   PP+K  +YA F++ KGQ         QQD    +AQW VRF + ISK
Sbjct  928  VSLLPSPLSKILAPPAKKFDYAHFVIEKGQQRKVEEQKPQQDNILPNAQWFVRFGDVISK  987

Query  212  NT  207
            +T
Sbjct  988  ST  989



>ref|XP_010276048.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Nelumbo nucifera]
Length=981

 Score =   242 bits (618),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCISSAKTH ST+V+GTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  801  AKCISSAKTHASTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  860

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC D+  V KTFQLALLCTKR PS+RPTMHEV RVL
Sbjct  861  LHQLILSKADDNTVMEAVDPEVSVTCMDMGAVRKTFQLALLCTKRHPSDRPTMHEVSRVL  920

Query  374  TsllpppplkpclppskSINYAQFLVGK----GQTENQQDGNSSDAQWLVRFREAISKNT  207
             SLLPP   K C    K  NY QF+V K     Q + Q + NSSDAQW V+F E ISKN+
Sbjct  921  VSLLPPLSSKSCTALPKPFNYTQFVVNKEGKQNQHQQQDNNNSSDAQWFVKFGEVISKNS  980

Query  206  L  204
            L
Sbjct  981  L  981



>gb|ADM86148.1| leucine-rich repeat receptor-like kinase [Populus nigra x Populus 
x canadensis]
Length=947

 Score =   242 bits (618),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 143/185 (77%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + K+H ST+VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  764  AKCIPTTKSHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNESN  823

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L QLILS+AD+NTVMEAVD EVSVTC DL+HV K+FQLALLCTKR PSERPTM +V RVL
Sbjct  824  LQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRVL  883

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN--------QQDGNSSDAQWLVRFREAI  219
                 P          K I+YA+F++ KGQ +          Q+ NSSDAQW VRF+E +
Sbjct  884  V-SFLPALPTKASLLPKPIDYAKFVIDKGQQQQPIVNQQQPSQENNSSDAQWFVRFKEVV  942

Query  218  SKNTL  204
            SKNTL
Sbjct  943  SKNTL  947



>ref|XP_010276057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Nelumbo nucifera]
Length=965

 Score =   242 bits (617),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 146/181 (81%), Gaps = 4/181 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCISSAKTH ST+V+GTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  785  AKCISSAKTHASTFVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  844

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EVSVTC D+  V KTFQLALLCTKR PS+RPTMHEV RVL
Sbjct  845  LHQLILSKADDNTVMEAVDPEVSVTCMDMGAVRKTFQLALLCTKRHPSDRPTMHEVSRVL  904

Query  374  TsllpppplkpclppskSINYAQFLVGK----GQTENQQDGNSSDAQWLVRFREAISKNT  207
             SLLPP   K C    K  NY QF+V K     Q + Q + NSSDAQW V+F E ISKN+
Sbjct  905  VSLLPPLSSKSCTALPKPFNYTQFVVNKEGKQNQHQQQDNNNSSDAQWFVKFGEVISKNS  964

Query  206  L  204
            L
Sbjct  965  L  965



>ref|XP_002318267.2| PTH-1 family protein [Populus trichocarpa]
 gb|EEE96487.2| PTH-1 family protein [Populus trichocarpa]
Length=984

 Score =   242 bits (618),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 143/185 (77%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + K+H ST+VLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  801  AKCIPTTKSHASTFVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNESN  860

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L QLILS+AD+NTVMEAVD EVSVTC DL+HV K+FQLALLCTKR PSERPTM +V RVL
Sbjct  861  LQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSRVL  920

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN--------QQDGNSSDAQWLVRFREAI  219
                 P          K I+YA+F++ KGQ +          Q+ NSSDAQW VRF+E +
Sbjct  921  V-SFLPALPTKASLLPKPIDYAKFVIDKGQQQQPIVNQQQPSQENNSSDAQWFVRFKEVV  979

Query  218  SKNTL  204
            SKNTL
Sbjct  980  SKNTL  984



>gb|ACF87330.1| unknown [Zea mays]
Length=260

 Score =   226 bits (576),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 143/188 (76%), Gaps = 11/188 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTG+K VDN+SN
Sbjct  72   AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNESN  131

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD++TVME+VD EVSVTCTD++ V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  132  LHQLILSKADDDTVMESVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVL  191

Query  374  TsllpppplkpclppskSI----NYAQFLV-------GKGQTENQQDGNSSDAQWLVRFR  228
             SLLPP    P    + +     +Y +FL        G    ++  D +SSD QW VRF 
Sbjct  192  LSLLPPAAKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFG  251

Query  227  EAISKNTL  204
            E ISK+TL
Sbjct  252  EVISKHTL  259



>ref|XP_008810292.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X3 [Phoenix dactylifera]
Length=939

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI SAKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  761  AKCIPSAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  820

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTC D+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  821  LHQLILSKADDNTVMEAVDSEVSVTCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARVL  880

Query  374  TsllpppplkpclppskSINYAQFLVGKG--QTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP P LKP L P K+++Y  +L      + +     +SSD QW VRF E IS NTL
Sbjct  881  VSLLPAPSLKPGLVPPKAVDYKHYLAAGPDVKIKGSHGDSSSDGQWFVRFGEVISMNTL  939



>ref|XP_008810291.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Phoenix dactylifera]
Length=987

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI SAKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  809  AKCIPSAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  868

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTC D+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  869  LHQLILSKADDNTVMEAVDSEVSVTCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARVL  928

Query  374  TsllpppplkpclppskSINYAQFLVGKG--QTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP P LKP L P K+++Y  +L      + +     +SSD QW VRF E IS NTL
Sbjct  929  VSLLPAPSLKPGLVPPKAVDYKHYLAAGPDVKIKGSHGDSSSDGQWFVRFGEVISMNTL  987



>ref|XP_008810290.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Phoenix dactylifera]
Length=1017

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  734   AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
             AKCI SAKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  839   AKCIPSAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  898

Query  554   LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
             LHQLILSKAD+NTVMEAVDSEVSVTC D+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  899   LHQLILSKADDNTVMEAVDSEVSVTCMDMRLVRKAFQLALLCTKRHPSDRPTMHEVARVL  958

Query  374   TsllpppplkpclppskSINYAQFLVGKG--QTENQQDGNSSDAQWLVRFREAISKNTL  204
              SLLP P LKP L P K+++Y  +L      + +     +SSD QW VRF E IS NTL
Sbjct  959   VSLLPAPSLKPGLVPPKAVDYKHYLAAGPDVKIKGSHGDSSSDGQWFVRFGEVISMNTL  1017



>ref|XP_009346939.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=959

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 140/180 (78%), Gaps = 4/180 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I +A+TH STYVLGTIGYIDPEYAR+SR+TEKSDVYSFG+VLLELLTGKK V+ DSN
Sbjct  781  AKFIPTAQTHASTYVLGTIGYIDPEYARSSRVTEKSDVYSFGVVLLELLTGKKAVEQDSN  840

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD NTVME+VD EVSVTC DLSHV KTFQLALLCTKR P+ERPTMHEV RVL
Sbjct  841  LHQLILSKADTNTVMESVDPEVSVTCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARVL  900

Query  374  TsllpppplkpclppskSINYAQFLVGK---GQTENQQDGNSSDAQWLVRFREAISKNTL  204
               L P          K I+YA+F+  K        QQ+ +SSDAQW VRF E ISKNTL
Sbjct  901  V-SLLPATATKHGSIPKGIDYAKFVADKEPHKPKPQQQESHSSDAQWFVRFGEVISKNTL  959



>ref|XP_011076300.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Sesamum indicum]
Length=949

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 150/185 (81%), Gaps = 8/185 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYV+GTIGYIDPEYA TS LTEKSDVYSFGIV+LELLTGKK VDND N
Sbjct  765  AKCLPTAKTHASTYVVGTIGYIDPEYATTSWLTEKSDVYSFGIVILELLTGKKAVDNDLN  824

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L QL+LSKA+N+T+ME VD EVSVTC D+SHV KTFQLALLCTKR PSERPTMHEV R L
Sbjct  825  LLQLVLSKAENDTLMETVDPEVSVTCMDVSHVRKTFQLALLCTKRNPSERPTMHEVSRFL  884

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN--------QQDGNSSDAQWLVRFREAI  219
             SLLPPPP KPC  P K+I+Y QF++GKGQ  +        QQD NSSDAQW VRF E I
Sbjct  885  GSLLPPPPKKPCSTPPKNIDYTQFVIGKGQQPHLQIPQQQLQQDNNSSDAQWYVRFGEVI  944

Query  218  SKNTL  204
            SKNT 
Sbjct  945  SKNTF  949



>ref|XP_009345019.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Pyrus x bretschneideri]
Length=955

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 141/180 (78%), Gaps = 4/180 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I +A+TH STYVLGTIGYIDPEYARTSR+TEKSDVYSFG+VLLELLTGKK V+ DSN
Sbjct  777  AKFIPTAQTHASTYVLGTIGYIDPEYARTSRVTEKSDVYSFGVVLLELLTGKKAVEQDSN  836

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD NTVME+VD EVSVTC DLSHV KTFQLALLCTKR P+ERPTMHEV RVL
Sbjct  837  LHQLILSKADTNTVMESVDPEVSVTCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARVL  896

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE---NQQDGNSSDAQWLVRFREAISKNTL  204
               L P          K I+YA+F+  K   +    QQ+ +SS+AQW VRF E ISKNTL
Sbjct  897  V-SLLPATATKHGSIPKGIDYAKFVADKEPQKPKPQQQESHSSNAQWFVRFGEVISKNTL  955



>ref|XP_011076298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Sesamum indicum]
Length=993

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 150/185 (81%), Gaps = 8/185 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYV+GTIGYIDPEYA TS LTEKSDVYSFGIV+LELLTGKK VDND N
Sbjct  809  AKCLPTAKTHASTYVVGTIGYIDPEYATTSWLTEKSDVYSFGIVILELLTGKKAVDNDLN  868

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L QL+LSKA+N+T+ME VD EVSVTC D+SHV KTFQLALLCTKR PSERPTMHEV R L
Sbjct  869  LLQLVLSKAENDTLMETVDPEVSVTCMDVSHVRKTFQLALLCTKRNPSERPTMHEVSRFL  928

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTEN--------QQDGNSSDAQWLVRFREAI  219
             SLLPPPP KPC  P K+I+Y QF++GKGQ  +        QQD NSSDAQW VRF E I
Sbjct  929  GSLLPPPPKKPCSTPPKNIDYTQFVIGKGQQPHLQIPQQQLQQDNNSSDAQWYVRFGEVI  988

Query  218  SKNTL  204
            SKNT 
Sbjct  989  SKNTF  993



>ref|XP_004496653.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Cicer arietinum]
Length=986

 Score =   239 bits (611),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + +TH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  813  AKCIPATRTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  872

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA+NNT+MEAVD EVS+TC DL+HV KTF+LALLCTK+ PSERPTMHEV RVL
Sbjct  873  LHHLILSKAENNTIMEAVDPEVSITCIDLAHVKKTFRLALLCTKKNPSERPTMHEVARVL  932

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             S LP PP K     +KS +Y Q + G    + Q D N+S+AQW VRF + ISK+TL
Sbjct  933  ISQLPAPPSKVVAAAAKSFDYNQKVDG---LQPQPDNNASNAQWFVRFGDDISKSTL  986



>ref|NP_001235330.1| ERECTA-like kinase [Glycine max]
 gb|ACM89560.1| ERECTA-like kinase [Glycine max]
Length=1009

 Score =   239 bits (610),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 145/186 (78%), Gaps = 9/186 (5%)
 Frame = -2

Query  734   AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
             AKC+S+A+TH ST+VLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  824   AKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  883

Query  554   LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
             LH LILSKADNNT+ME VD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  884   LHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVL  943

Query  374   -TsllpppplkpclppskSINYAQFLVGKG--------QTENQQDGNSSDAQWLVRFREA  222
              + L  PP     +P SK+I+YAQF++ KG        Q +  Q    S+ QW VRF + 
Sbjct  944   ASLLPAPPSKNIFVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDV  1003

Query  221   ISKNTL  204
             +S N+L
Sbjct  1004  VSNNSL  1009



>gb|KHN24405.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=949

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 145/186 (78%), Gaps = 9/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+S+A+TH ST+VLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  764  AKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  823

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKADNNT+ME VD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  824  LHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVL  883

Query  374  -TsllpppplkpclppskSINYAQFLVGKG--------QTENQQDGNSSDAQWLVRFREA  222
             + L  PP     +P SK+I+YAQF++ KG        Q +  Q    S+ QW VRF + 
Sbjct  884  ASLLPAPPSKNIFVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDV  943

Query  221  ISKNTL  204
            +S N+L
Sbjct  944  VSNNSL  949



>ref|XP_006598682.1| PREDICTED: ERECTA-like kinase isoform X1 [Glycine max]
Length=993

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 145/186 (78%), Gaps = 9/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+S+A+TH ST+VLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  808  AKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  867

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKADNNT+ME VD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  868  LHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVL  927

Query  374  -TsllpppplkpclppskSINYAQFLVGKG--------QTENQQDGNSSDAQWLVRFREA  222
             + L  PP     +P SK+I+YAQF++ KG        Q +  Q    S+ QW VRF + 
Sbjct  928  ASLLPAPPSKNIFVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDV  987

Query  221  ISKNTL  204
            +S N+L
Sbjct  988  VSNNSL  993



>ref|XP_006598683.1| PREDICTED: ERECTA-like kinase isoform X2 [Glycine max]
Length=949

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 145/186 (78%), Gaps = 9/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+S+A+TH ST+VLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  764  AKCLSTARTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  823

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKADNNT+ME VD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  824  LHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVL  883

Query  374  -TsllpppplkpclppskSINYAQFLVGKG--------QTENQQDGNSSDAQWLVRFREA  222
             + L  PP     +P SK+I+YAQF++ KG        Q +  Q    S+ QW VRF + 
Sbjct  884  ASLLPAPPSKNIFVPSSKTIDYAQFVIQKGKQNNLHPLQMDRLQPQQFSNDQWFVRFEDV  943

Query  221  ISKNTL  204
            +S N+L
Sbjct  944  VSNNSL  949



>gb|KDO65362.1| hypothetical protein CISIN_1g002278mg [Citrus sinensis]
Length=943

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            A+CI +A  H ST+VLGTIGYIDPEYA TSRL EKSDVYSFGIVLLE+LTGKK VDN+SN
Sbjct  765  ARCIPTAMPHASTFVLGTIGYIDPEYAHTSRLNEKSDVYSFGIVLLEILTGKKAVDNESN  824

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SKAD+NTVMEAVD EVSVTC DLS V KTFQLALLCTKR PSERPTM EV RVL
Sbjct  825  LHQLIMSKADDNTVMEAVDPEVSVTCVDLSAVRKTFQLALLCTKRYPSERPTMQEVARVL  884

Query  374  TsllpppplkpclppskSIN-YAQFLVGKG-QTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP PP K  L   K I+ Y +F+V +  Q   + D NSSDA+W VRF E ISKNTL
Sbjct  885  VSLLPAPPAKLSLAAPKPIDYYTKFVVNRERQQRVEHDDNSSDARWFVRFGEVISKNTL  943



>ref|XP_006490262.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=965

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            A+CI +A  H ST+VLGTIGYIDPEYA TSRL EKSDVYSFGIVLLE+LTGKK VDN+SN
Sbjct  787  ARCIPTAMPHASTFVLGTIGYIDPEYAHTSRLNEKSDVYSFGIVLLEILTGKKAVDNESN  846

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SKAD+NTVMEAVD EVSVTC DLS V KTFQLALLCTKR PSERPTM EV RVL
Sbjct  847  LHQLIMSKADDNTVMEAVDPEVSVTCVDLSAVRKTFQLALLCTKRYPSERPTMQEVARVL  906

Query  374  TsllpppplkpclppskSIN-YAQFLVGKGQTEN-QQDGNSSDAQWLVRFREAISKNTL  204
             SLLP PP K  L   K I+ Y +F+V + + +  + D NSSDA+W VRF E ISKNTL
Sbjct  907  VSLLPAPPAKLSLAAPKPIDYYTKFVVNRERQQRVEHDDNSSDARWFVRFGEVISKNTL  965



>ref|XP_011041677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Populus euphratica]
Length=982

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + KTH ST+V+GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  801  AKCIPTTKTHASTFVMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNESN  860

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L QLILS+AD+NTVMEAVD EVSVTC DL+ V K+FQLALLCTKR PSERPTM +V RVL
Sbjct  861  LQQLILSRADDNTVMEAVDPEVSVTCMDLTTVKKSFQLALLCTKRHPSERPTMQDVSRVL  920

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ-------QDGNSSDAQWLVRFREAIS  216
                  P         K  +YA+F++ KGQ +         Q+ NSSDA W +RF+E +S
Sbjct  921  V--SFVPAPTKASLLPKPFDYAKFVMDKGQQQPTLHQPQLLQENNSSDAHWFMRFKEVVS  978

Query  215  KNTL  204
            KNTL
Sbjct  979  KNTL  982



>gb|KGN49592.1| hypothetical protein Csa_5G014290 [Cucumis sativus]
Length=994

 Score =   236 bits (601),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 146/184 (79%), Gaps = 10/184 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VD++SN
Sbjct  805  AKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDDESN  864

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSK ++NTVMEAVD EVSVTC DL+HV KTFQLALLCTK  PSERPTMHEV RVL
Sbjct  865  LHQLILSKINSNTVMEAVDPEVSVTCIDLAHVRKTFQLALLCTKHNPSERPTMHEVSRVL  924

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQQDG---------NSSDAQWLVRFRE  225
             +   P P +K    P+K+++YAQ+++ KGQ  N + G         N+SDA+W V+F E
Sbjct  925  ISLQPPRPTVKQTSFPTKTLDYAQYVIEKGQNRNAKGGQEEQQKSDVNTSDARWFVQFGE  984

Query  224  AISK  213
             +S+
Sbjct  985  VMSE  988



>ref|XP_004149628.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
 ref|XP_004166661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Cucumis sativus]
Length=950

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 146/184 (79%), Gaps = 10/184 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VD++SN
Sbjct  761  AKCIPTAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDDESN  820

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSK ++NTVMEAVD EVSVTC DL+HV KTFQLALLCTK  PSERPTMHEV RVL
Sbjct  821  LHQLILSKINSNTVMEAVDPEVSVTCIDLAHVRKTFQLALLCTKHNPSERPTMHEVSRVL  880

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQQDG---------NSSDAQWLVRFRE  225
             +   P P +K    P+K+++YAQ+++ KGQ  N + G         N+SDA+W V+F E
Sbjct  881  ISLQPPRPTVKQTSFPTKTLDYAQYVIEKGQNRNAKGGQEEQQKSDVNTSDARWFVQFGE  940

Query  224  AISK  213
             +S+
Sbjct  941  VMSE  944



>ref|XP_009398741.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Musa acuminata subsp. malaccensis]
Length=996

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 141/180 (78%), Gaps = 3/180 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+S AKTH STYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDN+SN
Sbjct  817  AKCLSPAKTHASTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNESN  876

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVS+TC D+  V K FQLALLCTKR PS+RP+MH+V  VL
Sbjct  877  LHQLILSKADDNTVMEAVDSEVSITCMDMGLVKKAFQLALLCTKRHPSDRPSMHQVALVL  936

Query  374  TsllpppplkpclppskSINYAQFLVGKG--QTENQQDGNS-SDAQWLVRFREAISKNTL  204
             +LLP P  KP     K  +Y  +L      +   + D +S SD QW VRF E ISK+TL
Sbjct  937  VTLLPAPSSKPSTAAPKPTDYTHYLAAGPVVKANAKHDSSSLSDGQWFVRFGEVISKSTL  996



>gb|ACR34621.1| unknown [Zea mays]
Length=460

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 11/188 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTG+K VDN+SN
Sbjct  272  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNESN  331

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD++TVMEAVD EVSVTCTD++ V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  332  LHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVL  391

Query  374  TsllpppplkpclppskSI----NYAQFLV-------GKGQTENQQDGNSSDAQWLVRFR  228
             SLLPP    P    + +     +Y +FL        G    ++  D +SSD QW VRF 
Sbjct  392  LSLLPPAAKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFG  451

Query  227  EAISKNTL  204
            E ISK+TL
Sbjct  452  EVISKHTL  459



>gb|ACN26436.1| unknown [Zea mays]
Length=500

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 11/188 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTG+K VDN+SN
Sbjct  312  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNESN  371

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD++TVMEAVD EVSVTCTD++ V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  372  LHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVL  431

Query  374  TsllpppplkpclppskSI----NYAQFLV-------GKGQTENQQDGNSSDAQWLVRFR  228
             SLLPP    P    + +     +Y +FL        G    ++  D +SSD QW VRF 
Sbjct  432  LSLLPPAAKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFG  491

Query  227  EAISKNTL  204
            E ISK+TL
Sbjct  492  EVISKHTL  499



>gb|EEE65024.1| hypothetical protein OsJ_19993 [Oryza sativa Japonica Group]
Length=908

 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 138/185 (75%), Gaps = 12/185 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ SAK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  728  AKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  787

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  788  LHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVL  847

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQ--------DGNSSDAQWLVRFREAI  219
                        +   K+++Y++ L       + +        D +SSD QW VRF E I
Sbjct  848  ----LSLLPASAMTTPKTVDYSRLLASTTTAADMRGHDVTDIGDNSSSDEQWFVRFGEVI  903

Query  218  SKNTL  204
            SK+T+
Sbjct  904  SKHTM  908



>ref|XP_006421768.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
 gb|ESR35008.1| hypothetical protein CICLE_v10004259mg [Citrus clementina]
Length=943

 Score =   233 bits (593),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            A+CI +A  H  T+VLGTIGYIDPEYA TSRL EKSDVYSFGIVLLE+LTGKK VDN+SN
Sbjct  765  ARCIPTAMPHALTFVLGTIGYIDPEYAHTSRLNEKSDVYSFGIVLLEILTGKKAVDNESN  824

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SKAD+NTVMEAVD EVSVTC DLS V KTFQLALLCTKR PSERPTM EV RVL
Sbjct  825  LHQLIMSKADDNTVMEAVDPEVSVTCMDLSVVRKTFQLALLCTKRYPSERPTMQEVARVL  884

Query  374  TsllpppplkpclppskSIN-YAQFLVGKG-QTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP PP K  L   K I+ Y +F+V +  Q   + D NSSDA+W VRF E ISKNTL
Sbjct  885  VSLLPAPPTKLSLAAPKPIDYYTKFVVDRERQQRVEHDDNSSDARWFVRFGEVISKNTL  943



>gb|ACY07616.1| stress-induced protein kinase [Oryza sativa Japonica Group]
Length=980

 Score =   233 bits (594),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 138/185 (75%), Gaps = 12/185 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ SAK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  800  AKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  859

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  860  LHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVL  919

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQ--------DGNSSDAQWLVRFREAI  219
                        +   K+++Y++ L       + +        D +SSD QW VRF E I
Sbjct  920  ----LSLLPASAMTTPKTVDYSRLLASTTTAADMRGHDVTDIGDNSSSDEQWFVRFGEVI  975

Query  218  SKNTL  204
            SK+T+
Sbjct  976  SKHTM  980



>ref|XP_008376471.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Malus domestica]
Length=987

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 141/187 (75%), Gaps = 11/187 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I +A+TH STYVLGTIGYIDPEYARTSR+TEKSDVYSFG+VLLELLTGKK V+ DSN
Sbjct  802  AKFIPTAETHASTYVLGTIGYIDPEYARTSRVTEKSDVYSFGVVLLELLTGKKAVEQDSN  861

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD NTVME+VD EVSVTC DLSHV KTFQLALLCTKR P+ERPTMHEV RVL
Sbjct  862  LHQLILSKADTNTVMESVDPEVSVTCMDLSHVRKTFQLALLCTKRNPTERPTMHEVARVL  921

Query  374  TsllpppplkpclppskSINYAQFLVGK----------GQTENQQDGNSSDAQWLVRFRE  225
               L P P        K I+YA+F+  K               QQ+ +SSDAQW VRF E
Sbjct  922  V-SLLPAPATKHCSIPKGIDYAKFVADKEQQRPKSQQQQPRPVQQESHSSDAQWFVRFGE  980

Query  224  AISKNTL  204
             ISKNTL
Sbjct  981  VISKNTL  987



>ref|XP_008234344.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Prunus mume]
Length=951

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 139/185 (75%), Gaps = 10/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFG+VLLELLTGKK VD +SN
Sbjct  767  AKSIPASKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDKESN  826

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD NTVME VD EVSVTC DLSHV KTFQLALLC KR P ERPTMHEV RVL
Sbjct  827  LHQLILSKADTNTVMETVDPEVSVTCMDLSHVRKTFQLALLCLKRNPIERPTMHEVARVL  886

Query  374  TsllpppplkpclppskSINYAQFLVGKG---------QTENQQDGNSSDAQWLVRFREA  222
               L P P       SK I+YA+F V KG         Q   QQ+ NSSDAQW  RF E 
Sbjct  887  V-SLLPSPPTKHCSVSKGIDYAKFAVDKGQQQSKLQQQQHPVQQESNSSDAQWFERFGEV  945

Query  221  ISKNT  207
            IS NT
Sbjct  946  ISNNT  950



>dbj|BAD44800.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAD67663.1| putative transmembrane protein kinase [Oryza sativa Japonica 
Group]
 gb|EEC79921.1| hypothetical protein OsI_21484 [Oryza sativa Indica Group]
Length=980

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 138/185 (75%), Gaps = 12/185 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ SAK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  800  AKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  859

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  860  LHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVL  919

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQ--------DGNSSDAQWLVRFREAI  219
                        +   K+++Y++ L       + +        D +SSD QW VRF E I
Sbjct  920  ----LSLLPASAMTTPKTVDYSRLLASTTTAADMRGHDVTDIGDNSSSDEQWFVRFGEVI  975

Query  218  SKNTL  204
            SK+T+
Sbjct  976  SKHTM  980



>ref|XP_002436407.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
 gb|EER87774.1| hypothetical protein SORBIDRAFT_10g001970 [Sorghum bicolor]
Length=978

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 142/184 (77%), Gaps = 7/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  794  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTCTD++ V K FQLALLCTKR P +RPTMHEV RVL
Sbjct  854  LHQLILSKADDNTVMEAVDSEVSVTCTDMNLVRKAFQLALLCTKRHPVDRPTMHEVARVL  913

Query  374  TsllpppplkpclppskSI--NYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAIS  216
             SLLP PP             +Y +FL     +  G  ++  D +SSD QW VRF E IS
Sbjct  914  LSLLPAPPAAKPPASKAVAAGDYTRFLAAAADMNHGLPDDIGDNSSSDEQWFVRFGEVIS  973

Query  215  KNTL  204
            K+TL
Sbjct  974  KHTL  977



>dbj|BAJ90194.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 139/186 (75%), Gaps = 9/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTG K VDNDSN
Sbjct  585  AKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDSN  644

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+S+AD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR P +RPTMHEV RVL
Sbjct  645  LHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVL  704

Query  374  --------TsllpppplkpclppskSINYAQFLVGKGQTE-NQQDGNSSDAQWLVRFREA  222
                     ++ P    K     SK ++Y ++L      + +  D +SSD QW VRF E 
Sbjct  705  LSLMPPPPAAVKPSSYGKTTTDASKKVDYTRYLAAAATPDTDHGDNSSSDEQWFVRFGEV  764

Query  221  ISKNTL  204
            ISK+T+
Sbjct  765  ISKHTM  770



>ref|NP_001056687.1| Os06g0130100 [Oryza sativa Japonica Group]
 gb|AAQ01160.1| transmembrane protein kinase [Oryza sativa]
 dbj|BAF18601.1| Os06g0130100 [Oryza sativa Japonica Group]
Length=999

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 138/185 (75%), Gaps = 12/185 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ SAK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  819  AKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  878

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  879  LHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVL  938

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQ--------DGNSSDAQWLVRFREAI  219
                        +   K+++Y++ L       + +        D +SSD QW VRF E I
Sbjct  939  ----LSLLPASAMTTPKTVDYSRLLASTTTAADMRGHDVTDIGDNSSSDEQWFVRFGEVI  994

Query  218  SKNTL  204
            SK+T+
Sbjct  995  SKHTM  999



>ref|XP_006656595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Oryza brachyantha]
Length=984

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 139/184 (76%), Gaps = 11/184 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ SAK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  805  AKCVPSAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  864

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  865  LHQLILSKADDNTVMEAVDSEVSVTCTDIGLVRKAFQLALLCTKRHPSDRPTMHEVARVL  924

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ-------QDGNSSDAQWLVRFREAIS  216
                      P +   K+++Y++ L      + +        D +SSD QW VRF E IS
Sbjct  925  ----LSLLPAPAVTTPKTVDYSRLLASTTAADMRGHDVTDIGDNSSSDEQWFVRFGEVIS  980

Query  215  KNTL  204
            K+T+
Sbjct  981  KHTM  984



>ref|XP_004964421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Setaria italica]
Length=978

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 145/183 (79%), Gaps = 6/183 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  795  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLIL+KAD+NTVMEAVDSEVSVTCTD++ V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  855  LHQLILAKADDNTVMEAVDSEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVL  914

Query  374  TsllpppplkpclppskSINYAQFL------VGKGQTENQQDGNSSDAQWLVRFREAISK  213
             SLLP P +KP      + +Y +FL      +    + +  D +SSD QW VRF E ISK
Sbjct  915  LSLLPAPAVKPPTTKGAAGDYTRFLATTTADMKHDVSVDIGDNSSSDEQWFVRFGEVISK  974

Query  212  NTL  204
            +T+
Sbjct  975  HTM  977



>ref|XP_007152392.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
 gb|ESW24386.1| hypothetical protein PHAVU_004G126100g [Phaseolus vulgaris]
Length=989

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 142/183 (78%), Gaps = 6/183 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+S+ +TH ST VLGTIGYIDPEYAR+SRL EKSDVYSFGIVLLELLTGKK VD+DSN
Sbjct  807  AKCLSTTRTHASTSVLGTIGYIDPEYARSSRLNEKSDVYSFGIVLLELLTGKKAVDDDSN  866

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKADNNT+ME VD EVS+TC DL+HV KTFQLALLCTK  PSERPTMH+V RVL
Sbjct  867  LHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKGNPSERPTMHQVARVL  926

Query  374  TsllpppplkpclppskSINYAQFLVGKG------QTENQQDGNSSDAQWLVRFREAISK  213
             SLLP PP     PPSK+I+YAQ ++ KG      Q E  Q    S+ QW VRF   +S 
Sbjct  927  ASLLPAPPSNIFAPPSKTIDYAQIVIQKGNNLHPPQMERLQSQKYSNDQWFVRFENVVSN  986

Query  212  NTL  204
            N+L
Sbjct  987  NSL  989



>ref|XP_006587379.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1-like [Glycine max]
Length=984

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 140/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+S+ +TH ST+VLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  809  AKCLSTTRTHVSTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  868

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKADNNT+ME VD EVS+TC DL+HV KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  869  LHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKRNPSERPTMHEVARVL  928

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             + L  PP     +P S +I+YAQF++ K   +N       D QW VRF + +S N+L
Sbjct  929  ASLLPAPPSKNIFVPSSNTIDYAQFVIQK-VNKNSLHTPQMD-QWFVRFEDVVSNNSL  984



>ref|XP_003561134.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brachypodium distachyon]
Length=943

 Score =   231 bits (589),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  762  AKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  821

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRV-  378
            LHQLILS+AD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR P +RPTMHEV RV 
Sbjct  822  LHQLILSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPMDRPTMHEVARVL  881

Query  377  LTsllpppplkpclppskSINYAQFLVGKGQTENQQDG------NSSDAQWLVRFREAIS  216
            L+ +  P         SK+++Y ++L      +   DG      +SSD QW VRF E IS
Sbjct  882  LSLMPAPALKPSYTTASKTVDYTRYLATT--PDLNHDGTDIGNNSSSDEQWFVRFGEVIS  939

Query  215  KNTL  204
            K+T+
Sbjct  940  KHTM  943



>ref|XP_008465055.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Cucumis melo]
Length=1000

 Score =   231 bits (589),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 144/184 (78%), Gaps = 10/184 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH ST+VLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VD++SN
Sbjct  811  AKCIPTAKTHASTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDDESN  870

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSK DNNTVMEAVD EVSVTC DL+HV KTFQLALLCTK   SERPTMHEV RVL
Sbjct  871  LHQLILSKIDNNTVMEAVDPEVSVTCIDLAHVRKTFQLALLCTKHNSSERPTMHEVSRVL  930

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQ-------TENQQ--DGNSSDAQWLVRFRE  225
             +     P +K    P+K+++YAQ+++ KGQ        E QQ  D N+SDA+W V+F E
Sbjct  931  ISLQPAQPTVKRSSFPTKTLDYAQYVIEKGQHRKLKGGQEEQQKSDVNTSDARWFVQFGE  990

Query  224  AISK  213
              S+
Sbjct  991  VTSE  994



>dbj|BAJ89970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=982

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 139/186 (75%), Gaps = 9/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTG K VDNDSN
Sbjct  797  AKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDSN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+S+AD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR P +RPTMHEV RVL
Sbjct  857  LHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVL  916

Query  374  --------TsllpppplkpclppskSINYAQFLVGKGQTE-NQQDGNSSDAQWLVRFREA  222
                     ++ P    K     SK ++Y ++L      + +  D +SSD QW VRF E 
Sbjct  917  LSLMPPPPAAVKPSSYGKTTTDASKKVDYTRYLAAAATPDTDHGDNSSSDEQWFVRFGEV  976

Query  221  ISKNTL  204
            ISK+T+
Sbjct  977  ISKHTM  982



>gb|KHN27841.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Glycine 
soja]
Length=940

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 140/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+S+ +TH ST+VLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  765  AKCLSTTRTHVSTFVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  824

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKADNNT+ME VD EVS+TC DL+HV KTFQLALLCTK+ PSERPTMHEV RVL
Sbjct  825  LHHLILSKADNNTIMETVDPEVSITCMDLTHVKKTFQLALLCTKKNPSERPTMHEVARVL  884

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             + L  PP     +P S +I+YAQF++ K   +N       D QW VRF + +S N+L
Sbjct  885  ASLLPAPPSKNIFVPSSNTIDYAQFVIQK-VNKNSLHTPQMD-QWFVRFEDVVSNNSL  940



>gb|AGT17158.1| ERECTA-like 2 [Saccharum hybrid cultivar R570]
Length=986

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 142/184 (77%), Gaps = 7/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  802  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN  861

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ ILSKAD+NTVMEAVDSEVSVTCTD++ V K FQLALLCTKR P +RPTMHEV RVL
Sbjct  862  LHQSILSKADDNTVMEAVDSEVSVTCTDMNLVRKAFQLALLCTKRHPVDRPTMHEVARVL  921

Query  374  TsllpppplkpclppskSI-NYAQFLV------GKGQTENQQDGNSSDAQWLVRFREAIS  216
             SLLP PP         +  +Y +FL         G +++  D +SSD QW VRF E IS
Sbjct  922  LSLLPAPPAAKPPATKAAAGDYTRFLATAADMKHGGLSDDIGDNSSSDEQWFVRFGEVIS  981

Query  215  KNTL  204
            K+TL
Sbjct  982  KHTL  985



>ref|NP_001146239.1| uncharacterized LOC100279811 [Zea mays]
 gb|ACL53538.1| unknown [Zea mays]
Length=774

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 11/188 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTG+K VDN+SN
Sbjct  586  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNESN  645

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD++TVMEAVD EVSVTCTD++ V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  646  LHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVL  705

Query  374  TsllpppplkpclppskSI----NYAQFLV-------GKGQTENQQDGNSSDAQWLVRFR  228
             SLLPP    P    + +     +Y +FL        G    ++  D +SSD QW VRF 
Sbjct  706  LSLLPPAAKPPAPKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFG  765

Query  227  EAISKNTL  204
            E ISK+TL
Sbjct  766  EVISKHTL  773



>ref|XP_004308156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Fragaria vesca subsp. vesca]
Length=989

 Score =   228 bits (580),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 136/187 (73%), Gaps = 12/187 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I  A TH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VD +SN
Sbjct  805  AKSIPGANTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDRESN  864

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKADNNTVME VD EVSVTC D +H+ KTFQLALLCTKR P+ERPTMHEV  VL
Sbjct  865  LHQLILSKADNNTVMETVDPEVSVTCMDTTHLKKTFQLALLCTKRNPTERPTMHEVASVL  924

Query  374  TsllpppplkpclppskSINYAQFLVGK----------GQTENQQDGNSSDAQWLVRFRE  225
                  P      P SK I+YA+F V K               QQ+ +S+DAQW VRF E
Sbjct  925  V--SLLPLRHSKKPLSKGIDYAKFAVDKEQQQPKAQPQQPKPVQQENHSTDAQWFVRFGE  982

Query  224  AISKNTL  204
             ISKNTL
Sbjct  983  VISKNTL  989



>ref|XP_008658489.1| PREDICTED: uncharacterized protein LOC100279811 isoform X1 [Zea 
mays]
 gb|AFW86035.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=985

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 143/188 (76%), Gaps = 11/188 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTG+K VDN+SN
Sbjct  797  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNESN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD++TVMEAVD EVSVTCTD++ V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  857  LHQLILSKADDDTVMEAVDPEVSVTCTDMNLVRKAFQLALLCTKRHPADRPTMHEVARVL  916

Query  374  TsllpppplkpclppskSI----NYAQFLV-------GKGQTENQQDGNSSDAQWLVRFR  228
             SLLPP    P    + +     +Y +FL        G    ++  D +SSD QW VRF 
Sbjct  917  LSLLPPAAKPPASKAAAASAAAGDYTRFLATAADLRRGGVADDDTGDNSSSDEQWFVRFG  976

Query  227  EAISKNTL  204
            E ISK+TL
Sbjct  977  EVISKHTL  984



>dbj|BAC42683.1| unknown protein [Arabidopsis thaliana]
Length=325

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSR+ EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  154  AKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEAN  213

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  214  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  273

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ-QDGNSSDAQWLVRFREAISKNTL  204
               L   P         S++++     K Q EN+ ++ ++  +QW V+FRE ISK+++
Sbjct  274  ---LSLVPSLQVAKKLPSLDHS---TKKLQQENEVRNPDAEASQWFVQFREVISKSSI  325



>gb|EYU25015.1| hypothetical protein MIMGU_mgv1a000865mg [Erythranthe guttata]
Length=955

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 141/190 (74%), Gaps = 13/190 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ + KTH  TYVLGTIGYIDPEYART RLTEKSDVYSFGIVLLELLTGKK +DND N
Sbjct  766  AKCLPTTKTHAFTYVLGTIGYIDPEYARTIRLTEKSDVYSFGIVLLELLTGKKAIDNDLN  825

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQL+ SKAD++T+M+AVD EVS+TCTDLSHV K FQLALLCTK+ P+ RPTMHEV  VL
Sbjct  826  LHQLMQSKADDDTLMDAVDPEVSITCTDLSHVRKAFQLALLCTKQHPTARPTMHEVRNVL  885

Query  374  -TsllpppplkpclppskSINYAQFLVGKGQTENQ------------QDGNSSDAQWLVR  234
             + L  PP    C   +KS++YAQF+VGK Q  +              + +SSDAQW VR
Sbjct  886  VSLLPSPPKNTTCSTNTKSVDYAQFVVGKEQQPHHLQTPQQQQQLQQDNSSSSDAQWYVR  945

Query  233  FREAISKNTL  204
            F E IS NT 
Sbjct  946  FGEVISNNTF  955



>ref|XP_010555314.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Tarenaya hassleriana]
Length=986

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 138/196 (70%), Gaps = 22/196 (11%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + +TH STYVLGTIGYIDPEYA TSRL EKSD+YSFGIVLLELLTGKK VDN+SN
Sbjct  794  AKCIPATRTHASTYVLGTIGYIDPEYACTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILS+AD+NTVMEAVD EVSVTC DL H+ KTFQLALLCTKR PSERPTMHEV RVL
Sbjct  854  LHQLILSRADDNTVMEAVDPEVSVTCMDLGHIRKTFQLALLCTKRNPSERPTMHEVSRVL  913

Query  374  TsllpppplkpclppskSINYAQFLVGKGQ------------TENQQDGNSSDA------  249
                        L     ++YAQF V K Q             +  ++ +SSDA      
Sbjct  914  ---HSLLHPATALKKLSPVDYAQFFVEKKQHGVRQLQEEQQEVQRLRENHSSDAAAAEAP  970

Query  248  -QWLVRFREAISKNTL  204
             QW  +FRE ISK+++
Sbjct  971  SQWFDQFREVISKSSV  986



>ref|XP_002322426.1| PTH-1 family protein [Populus trichocarpa]
 gb|EEF06553.1| PTH-1 family protein [Populus trichocarpa]
Length=870

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 131/177 (74%), Gaps = 25/177 (14%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI + KTH ST+V+GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKK VDN+SN
Sbjct  719  AKCIPTTKTHASTFVMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNESN  778

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L QLILS+AD+NTVMEAVD EVSVTC DL+HV K+FQLALLCTKR PSERPTM +V R  
Sbjct  779  LQQLILSRADDNTVMEAVDPEVSVTCMDLTHVKKSFQLALLCTKRHPSERPTMQDVSR--  836

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
                             +++  Q L         Q+ NSSDA W +RF+E +SKNTL
Sbjct  837  --------------QQPTLHQPQLL---------QENNSSDAHWFMRFKEVVSKNTL  870



>gb|AGL91675.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=958

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 129/179 (72%), Gaps = 8/179 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTG K VDNDSN
Sbjct  771  AKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDSN  830

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+S+AD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR P +RPTMHEV RVL
Sbjct  831  LHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVL  890

Query  374  -----TsllpppplkpclppskSINYAQFLVGKGQTENQQ---DGNSSDAQWLVRFREA  222
                       P        SK ++Y ++L       +     D +SSD QW VRF E 
Sbjct  891  LSLMPAPAAAKPSSYATTDASKKVDYTRYLAAAAPNADHDMGGDNSSSDEQWFVRFGEG  949



>gb|AGL91674.1| erecta-like leucine-rich-repeat receptor-like kinase [Triticum 
aestivum]
Length=981

 Score =   222 bits (565),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 131/179 (73%), Gaps = 9/179 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTG K VDNDSN
Sbjct  773  AKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDSN  832

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+S+AD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR P +RPTMHEV RVL
Sbjct  833  LHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARVL  892

Query  374  -----TsllpppplkpclppskSINYAQFLVGKG--QTENQQDGNSS--DAQWLVRFRE  225
                       P        SK ++Y ++L       TE+   G++S  D QW VRF E
Sbjct  893  LSLMPAPAAAKPSSYAATDASKKVDYTRYLAAAAAPNTEHDMGGDNSSPDEQWFVRFGE  951



>ref|XP_007221096.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
 gb|EMJ22295.1| hypothetical protein PRUPE_ppa017398mg [Prunus persica]
Length=992

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 134/179 (75%), Gaps = 2/179 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I +AKTH STYVLGTIGYIDPEYARTSRLTEKSDVYSFG+VLLELLTGKK VD +SN
Sbjct  814  AKSIPAAKTHASTYVLGTIGYIDPEYARTSRLTEKSDVYSFGVVLLELLTGKKAVDKESN  873

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD NTVME +D EVSVTC DLSHV KTFQLALLC KR P ERP MHEV RVL
Sbjct  874  LHQLILSKADTNTVMETLDPEVSVTCMDLSHVRKTFQLALLCLKRNPIERPFMHEVARVL  933

Query  374  Tsllpppplkp--clppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP PP K          +   Q    +     QQ+ NSSDAQW  RF E ISKNTL
Sbjct  934  VSLLPAPPTKHFDKGQQQPKLQQQQQPQQQQHHPVQQESNSSDAQWFERFGEVISKNTL  992



>ref|XP_006858024.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
 gb|ERN19491.1| hypothetical protein AMTR_s00069p00198500 [Amborella trichopoda]
Length=977

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 142/187 (76%), Gaps = 10/187 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCISSAKTH STYV+GTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  791  AKCISSAKTHASTYVMGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  850

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVME+VDSEVSVTCTD + + KTFQLALLCTK  PSERPTM EV RVL
Sbjct  851  LHQLILSKADDNTVMESVDSEVSVTCTDHNLLRKTFQLALLCTKCQPSERPTMQEVSRVL  910

Query  374  Tsllpppplkpclpps----kSINYAQFL-----VGKGQTENQQDGNS-SDAQWLVRFRE  225
             SLLPPPP     P S      + Y+Q++     V K         NS +D  W VRF E
Sbjct  911  LSLLPPPPTSTTKPSSTSSRLVMTYSQYIDEYSDVKKEAVAGNLTHNSTTDPHWFVRFGE  970

Query  224  AISKNTL  204
             IS+NTL
Sbjct  971  VISQNTL  977



>ref|XP_002864777.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41036.1| hypothetical protein ARALYDRAFT_496399 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 136/178 (76%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  795  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  855  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  914

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDA-QWLVRFREAISKNTL  204
             SLLP   +   LP             K Q EN+   + ++A QW V+FRE ISK+++
Sbjct  915  LSLLPSLQVAKKLPSHDQS------TKKPQQENEVRNHDAEASQWFVQFREVISKSSI  966



>ref|NP_001190595.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 gb|AED97584.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=918

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSR+ EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  747  AKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEAN  806

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  807  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  866

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ-QDGNSSDAQWLVRFREAISKNTL  204
               L   P         S++++     K Q EN+ ++ ++  +QW V+FRE ISK+++
Sbjct  867  ---LSLVPSLQVAKKLPSLDHS---TKKLQQENEVRNPDAEASQWFVQFREVISKSSI  918



>gb|AAP69763.1| ERECTA-like kinase 1 [Arabidopsis thaliana]
Length=966

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSR+ EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  795  AKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEAN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  855  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  914

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ-QDGNSSDAQWLVRFREAISKNTL  204
               L   P         S++++     K Q EN+ ++ ++  +QW V+FRE ISK+++
Sbjct  915  ---LSLVPSLQVAKKLPSLDHS---TKKLQQENEVRNPDAEASQWFVQFREVISKSSI  966



>ref|NP_201029.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
 sp|C0LGW6.1|ERL1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL1; AltName: Full=Protein ERECTA-like kinase 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|ACN59401.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97583.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Arabidopsis 
thaliana]
Length=966

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSR+ EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  795  AKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEAN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  855  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  914

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ-QDGNSSDAQWLVRFREAISKNTL  204
               L   P         S++++     K Q EN+ ++ ++  +QW V+FRE ISK+++
Sbjct  915  ---LSLVPSLQVAKKLPSLDHS---TKKLQQENEVRNPDAEASQWFVQFREVISKSSI  966



>gb|EPS66497.1| hypothetical protein M569_08274, partial [Genlisea aurea]
Length=941

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 135/176 (77%), Gaps = 3/176 (2%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC++ AKTH STYVLGTIGYIDP+YARTSRLTEKSDVYSFGIVL+ELLTGKK VDND N
Sbjct  769  AKCLAPAKTHASTYVLGTIGYIDPDYARTSRLTEKSDVYSFGIVLMELLTGKKAVDNDLN  828

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQL+L+KAD NT+ME VD EVSVTC D SH+ K FQLALLCTKRLPSERPTM++V  VL
Sbjct  829  LHQLVLAKADGNTLMETVDPEVSVTCMDSSHIKKVFQLALLCTKRLPSERPTMNDVSSVL  888

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNT  207
             S+LP PP K  L   +   + +     G  E+ Q    ++ +W VRF E ISKN+
Sbjct  889  KSMLPAPPQKKQLSVQQP--HCKDAAAGGHEEDLQMKRDAE-EWYVRFGEVISKNS  941



>ref|XP_006279954.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
 gb|EOA12852.1| hypothetical protein CARUB_v10025821mg [Capsella rubella]
Length=970

 Score =   213 bits (543),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 135/178 (76%), Gaps = 5/178 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  797  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  857  LHQLILSKADDNTVMEAVDPEVTVTCVDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  916

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDA-QWLVRFREAISKNTL  204
             SLLP   +   L         +    K Q E++     ++A +W V+FRE ISK+++
Sbjct  917  LSLLPSLQVAKKLQEPSLDKSTK----KPQQESEVRNREAEASEWFVQFREVISKSSI  970



>emb|CDX86913.1| BnaC03g51830D [Brassica napus]
Length=970

 Score =   213 bits (542),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN+SN
Sbjct  794  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTF+LALLCTKR P ERPTM EV RVL
Sbjct  854  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVL  913

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP   +   LP             + Q + QQ+ +   +QW  +F E ISK+++
Sbjct  914  LSLLPSMQVAKKLPSPDPSKKPTVYGVRDQQKQQQERSEEGSQWFDQFHEVISKSSV  970



>ref|XP_010423244.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X2 [Camelina sativa]
Length=852

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 137/180 (76%), Gaps = 13/180 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  683  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  742

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D  H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  743  LHQMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKRNPLERPTMQEVARVL  802

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSD---AQWLVRFREAISKNTL  204
             SL P PP K    P      A+   G    E +++ +SSD    QW V+FRE ISK++L
Sbjct  803  LSLFPSPPPKKLPSP------ARLQEG----EERRESHSSDTTTPQWFVQFREDISKSSL  852



>ref|XP_010423243.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 isoform X1 [Camelina sativa]
Length=967

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 137/180 (76%), Gaps = 13/180 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  798  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  857

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D  H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  858  LHQMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKRNPLERPTMQEVARVL  917

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSD---AQWLVRFREAISKNTL  204
             SL P PP K    P++            + E +++ +SSD    QW V+FRE ISK++L
Sbjct  918  LSLFPSPPPKKLPSPARL----------QEGEERRESHSSDTTTPQWFVQFREDISKSSL  967



>gb|KFK27954.1| hypothetical protein AALP_AA8G452900 [Arabis alpina]
Length=975

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 136/183 (74%), Gaps = 9/183 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLE+LTGKK VDN++N
Sbjct  796  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLEILTGKKAVDNEAN  855

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SK D+NTVMEAVD EV+VTC DL H+ KTF+LALLCTKR P ERPTM EV RVL
Sbjct  856  LHQLIMSKTDDNTVMEAVDPEVTVTCMDLGHIKKTFKLALLCTKRNPLERPTMLEVSRVL  915

Query  374  -----TsllpppplkpclppskSINYAQFLVGKGQTENQ-QDGNSSDAQWLVRFREAISK  213
                 +  +            K I+Y   +VG+ Q +++ QD  +  +QW V+F E ISK
Sbjct  916  LSLVPSLQVAKKLPSLDPSTKKPIDY---VVGQQQEKSEAQDREAEASQWFVQFHEDISK  972

Query  212  NTL  204
            ++L
Sbjct  973  SSL  975



>ref|XP_009151345.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Brassica rapa]
Length=966

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 11/181 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN+SN
Sbjct  793  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  852

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLIL+KAD+NTVMEAVD EV+VTC DL H+ KTF+LALLCTKR P ERPTM EV RVL
Sbjct  853  LHQLILAKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVL  912

Query  374  Tsllpppplkpcl----ppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNT  207
             SLLP   +   L    P  K  NY       G  E QQ+ +   +QW  +F E ISK++
Sbjct  913  LSLLPSMQVAKKLPSPDPSKKPTNY-------GVREQQQERSEEGSQWFEQFHEVISKSS  965

Query  206  L  204
            +
Sbjct  966  V  966



>ref|XP_009151343.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Brassica rapa]
Length=967

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 11/181 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN+SN
Sbjct  794  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLIL+KAD+NTVMEAVD EV+VTC DL H+ KTF+LALLCTKR P ERPTM EV RVL
Sbjct  854  LHQLILAKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVL  913

Query  374  Tsllpppplkpcl----ppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNT  207
             SLLP   +   L    P  K  NY       G  E QQ+ +   +QW  +F E ISK++
Sbjct  914  LSLLPSMQVAKKLPSPDPSKKPTNY-------GVREQQQERSEEGSQWFEQFHEVISKSS  966

Query  206  L  204
            +
Sbjct  967  V  967



>emb|CDY00268.1| BnaA06g21690D [Brassica napus]
Length=967

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 11/181 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN+SN
Sbjct  794  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLIL+KAD+NTVMEAVD EV+VTC DL H+ KTF+LALLCTKR P ERPTM EV RVL
Sbjct  854  LHQLILAKADDNTVMEAVDPEVTVTCMDLGHIRKTFKLALLCTKRNPLERPTMLEVSRVL  913

Query  374  Tsllpppplkpcl----ppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNT  207
             SLLP   +   L    P  K  NY       G  E QQ+ +   +QW  +F E ISK++
Sbjct  914  LSLLPSMQVAKKLPSPDPSKKPTNY-------GVREQQQERSEEGSQWFEQFHEVISKSS  966

Query  206  L  204
            +
Sbjct  967  V  967



>ref|NP_196335.2| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
 sp|Q6XAT2.1|ERL2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERL2; AltName: Full=Protein ERECTA-like kinase 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAP69764.1| ERECTA-like kinase 2 [Arabidopsis thaliana]
 gb|ACN59363.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED91118.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Arabidopsis 
thaliana]
Length=967

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 140/180 (78%), Gaps = 13/180 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  798  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  857

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D  H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  858  LHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVL  917

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSD---AQWLVRFREAISKNTL  204
             SL+P PP K    P+K        V +G  E +++ +SSD    QW V+FRE ISK++L
Sbjct  918  LSLVPSPPPKKLPSPAK--------VQEG--EERRESHSSDTTTPQWFVQFREDISKSSL  967



>emb|CAB87274.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=932

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 140/180 (78%), Gaps = 13/180 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  763  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  822

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D  H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  823  LHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVL  882

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSD---AQWLVRFREAISKNTL  204
             SL+P PP K    P+K        V +G  E +++ +SSD    QW V+FRE ISK++L
Sbjct  883  LSLVPSPPPKKLPSPAK--------VQEG--EERRESHSSDTTTPQWFVQFREDISKSSL  932



>ref|XP_006289323.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
 gb|EOA22221.1| hypothetical protein CARUB_v10002808mg [Capsella rubella]
Length=967

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 136/180 (76%), Gaps = 13/180 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  798  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  857

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D  H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  858  LHQMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVL  917

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSD---AQWLVRFREAISKNTL  204
             SLLP PP K            Q      + E +++ +SSD    QW V+FRE ISK++L
Sbjct  918  LSLLPSPPPKK----------LQSPAKLPEAEERRESHSSDTATPQWFVQFREDISKSSL  967



>ref|XP_010491322.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Camelina sativa]
Length=961

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 139/180 (77%), Gaps = 13/180 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  792  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  851

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D +H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  852  LHQMILSKADDNTVMEAVDAEVSVTCVDSAHIKKTFQLALLCTKRNPLERPTMQEVARVL  911

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSD---AQWLVRFREAISKNTL  204
             SLLP PP K    P      A+   G    E +++ +SSD    QW V+FRE ISK++L
Sbjct  912  LSLLPSPPPKKLPSP------ARLQEG----EERRESHSSDTATPQWFVQFREDISKSSL  961



>ref|XP_010483916.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X2 [Camelina sativa]
Length=964

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 133/178 (75%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  793  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  852

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  853  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  912

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDA-QWLVRFREAISKNTL  204
             SLLP   +   LP               Q E++     ++A QW V+FRE IS +++
Sbjct  913  LSLLPSLQVAKKLPSLDPSTKTP------QHESEVRNREAEASQWFVQFREVISNSSI  964



>ref|XP_010483915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 isoform X1 [Camelina sativa]
Length=965

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 133/178 (75%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  794  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  854  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  913

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDA-QWLVRFREAISKNTL  204
             SLLP   +   LP               Q E++     ++A QW V+FRE IS +++
Sbjct  914  LSLLPSLQVAKKLPSLDPSTKTP------QHESEVRNREAEASQWFVQFREVISNSSI  965



>ref|XP_002873299.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49558.1| hypothetical protein ARALYDRAFT_908657 [Arabidopsis lyrata subsp. 
lyrata]
Length=966

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 138/180 (77%), Gaps = 13/180 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  797  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D  H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  857  LHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALLCTKRNPLERPTMQEVSRVL  916

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSD---AQWLVRFREAISKNTL  204
             SLLP PP K    P+K            + E +++ +SSD    QW V+FRE ISK++L
Sbjct  917  LSLLPSPPPKKLPSPAKL----------QEGEERRECHSSDTTTPQWFVQFREDISKSSL  966



>gb|EMS58253.1| LRR receptor-like serine/threonine-protein kinase ERL2 [Triticum 
urartu]
Length=933

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTG K VDNDSN
Sbjct  766  AKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDSN  825

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+S+AD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR P +RPTMHEV R L
Sbjct  826  LHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVARGL  885



>ref|XP_006399198.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
 gb|ESQ40651.1| hypothetical protein EUTSA_v10012600mg [Eutrema salsugineum]
Length=935

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 135/177 (76%), Gaps = 7/177 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KT+ STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDN++N
Sbjct  766  AKSIPASKTYASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNEAN  825

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH +ILSKAD+NTVMEAVD+EVSVTC D  H+ KTFQLALLCTK+ P ERPTM EV RVL
Sbjct  826  LHHMILSKADDNTVMEAVDAEVSVTCVDSGHIKKTFQLALLCTKQNPLERPTMQEVSRVL  885

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP PP K    P+K       L G  +       +++  QW V+FRE ISK++L
Sbjct  886  LSLLPSPPSKKLTSPAK-------LQGGEERRESHSSDTTSPQWFVQFREVISKSSL  935



>ref|XP_006394418.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
 gb|ESQ31704.1| hypothetical protein EUTSA_v100036151mg, partial [Eutrema salsugineum]
Length=821

 Score =   207 bits (527),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 133/186 (72%), Gaps = 12/186 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  639  AKSIPTSKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  698

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ++LSKAD+NT+ME VD EV+VTC DL H+ KTF+LALLCTKR P ERPTM EV RVL
Sbjct  699  LHQMVLSKADDNTIMETVDPEVTVTCMDLGHLRKTFKLALLCTKRNPLERPTMLEVSRVL  758

Query  374  Tsllppppl---------kpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
             SLLP                    +  +  +    KG+  N ++  S   QW V+FRE 
Sbjct  759  LSLLPSLQAGKKLPSLDPSKKPTEYEDKDQQKQKQEKGEVRNHEEEGS---QWFVQFREV  815

Query  221  ISKNTL  204
            ISKN+L
Sbjct  816  ISKNSL  821



>gb|EMT12712.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=961

 Score =   208 bits (529),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTG K VDNDSN
Sbjct  834  AKCVPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGMKAVDNDSN  893

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVR  381
            LHQLI+S+AD+NTVMEAVDSEVSVTCTD+  V K FQLALLCTKR P +RPTMHEV R
Sbjct  894  LHQLIMSRADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALLCTKRHPIDRPTMHEVAR  951



>ref|XP_010444058.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=968

 Score =   208 bits (529),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 133/178 (75%), Gaps = 7/178 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  797  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  857  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  916

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDA-QWLVRFREAISKNTL  204
             SLLP   +   LP               Q E++     ++A QW V+FRE IS +++
Sbjct  917  LSLLPSLQVAKKLPSLDPSTKTP------QHESEVRNLEAEASQWFVQFREVISNSSI  968



>dbj|BAD16970.1| receptor protein kinase PERK1-like [Oryza sativa Japonica Group]
 dbj|BAG87384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 128/185 (69%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTSTYV+GTIGYIDPEYA TSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  207  AKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  266

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEVVRVL
Sbjct  267  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  326

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                     +    PP L         +N    L G      +   ++SDA+  ++F E 
Sbjct  327  DCLVYPDPPSKPALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEV  386

Query  221  ISKNT  207
            IS+NT
Sbjct  387  ISQNT  391



>gb|AAO26312.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=719

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 134/180 (74%), Gaps = 7/180 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKCI +AKTH STYVLGTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTGKK VDNDSN
Sbjct  544  AKCIPAAKTHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN  603

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV      +    K FQLA +C +R  S+RPTMHEV RVL
Sbjct  604  LHQLILSKADDNTVMEAVDFEVRSPAW-IWGCQKAFQLA-ICAQR--SDRPTMHEVARVL  659

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE---NQQDGNSSDAQWLVRFREAISKNTL  204
             SLLP P LKP L P K ++YA +L      +      D +SSD QW +RF E ISKNTL
Sbjct  660  VSLLPVPSLKPGLVPQKPMDYAHYLAAGPDVKIKRTHDDNSSSDGQWFLRFGEVISKNTL  719



>ref|NP_001048290.1| Os02g0777400 [Oryza sativa Japonica Group]
 dbj|BAF10204.1| Os02g0777400, partial [Oryza sativa Japonica Group]
Length=447

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 128/185 (69%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTSTYV+GTIGYIDPEYA TSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  262  AKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  321

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEVVRVL
Sbjct  322  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  381

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                     +    PP L         +N    L G      +   ++SDA+  ++F E 
Sbjct  382  DCLVYPDPPSKPALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEV  441

Query  221  ISKNT  207
            IS+NT
Sbjct  442  ISQNT  446



>gb|EPS58979.1| hypothetical protein M569_15834, partial [Genlisea aurea]
Length=249

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 123/190 (65%), Gaps = 14/190 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + S+KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKK VDN+ N
Sbjct  60   AKSLCSSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKAVDNECN  119

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LIL+KA NN+VME VD+E++ TC DL  V K FQLALLCTKR PS+RP M EVVRVL
Sbjct  120  LHHLILTKASNNSVMETVDAEITETCGDLGEVKKVFQLALLCTKRQPSDRPNMAEVVRVL  179

Query  374  --------------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLV  237
                           S                +N    L            ++SDAQ  +
Sbjct  180  GTLLPQPITASCDGKSRPAEASPPRGGGGGGYVNEYAKLRTPHLVNCSSSRSTSDAQLFL  239

Query  236  RFREAISKNT  207
            +F E IS+NT
Sbjct  240  KFGEVISQNT  249



>gb|EEC74102.1| hypothetical protein OsI_09151 [Oryza sativa Indica Group]
Length=913

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 129/185 (70%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  728  AKSLCTSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  787

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEVVRVL
Sbjct  788  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  847

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                     +    PP L         +N    L G      +   ++SDA+  ++F E 
Sbjct  848  DCLVYPDPPSKPALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEV  907

Query  221  ISKNT  207
            IS+NT
Sbjct  908  ISQNT  912



>dbj|BAJ87863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=863

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 125/181 (69%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  682  AKSVCISKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  741

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V + FQLALLC+KR PS+RPTMH+VV VL
Sbjct  742  LHHLILSKAADNTVMEMVDPDITATCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVL  801

Query  374  T-----sllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKN  210
            +        P             +N    L G          ++SDA+  ++F EAIS+N
Sbjct  802  SCLVCPEAPPKTASPQSSTAPSYVNEYVSLRGASALSCANSSSASDAELFLKFGEAISQN  861

Query  209  T  207
            T
Sbjct  862  T  862



>dbj|BAA97187.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=938

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 133/178 (75%), Gaps = 11/178 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSR+ EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  771  AKSIPASKTHASTYVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEAN  830

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQL    AD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTKR P ERPTM EV RVL
Sbjct  831  LHQL----ADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEVSRVL  886

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQ-QDGNSSDAQWLVRFREAISKNTL  204
               L   P         S++++     K Q EN+ ++ ++  +QW V+FRE ISK+++
Sbjct  887  ---LSLVPSLQVAKKLPSLDHS---TKKLQQENEVRNPDAEASQWFVQFREVISKSSI  938



>ref|XP_010452673.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERL2 [Camelina sativa]
Length=923

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I + KT+ STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  794  AKSIPATKTYASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRV  378
            LHQ+ILSKAD+NTVMEAVD+EVSVTC D +H+ KTFQLALLCTKR P ERPTM EV RV
Sbjct  854  LHQMILSKADDNTVMEAVDAEVSVTCVDSAHIKKTFQLALLCTKRNPLERPTMQEVARV  912



>ref|XP_010458423.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL1 [Camelina sativa]
Length=1007

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I ++KTH STYVLGTIGYIDPEYARTSRL EKSD+YSFGIVLLELLTGKK VDN++N
Sbjct  793  AKSIPASKTHASTYVLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN  852

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKAD+NTVMEAVD EV+VTC DL H+ KTFQLALLCTK  P ERPTM EV RVL
Sbjct  853  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKLNPLERPTMLEVSRVL  912



>ref|XP_009408412.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Musa acuminata subsp. malaccensis]
Length=980

 Score =   201 bits (512),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYSFGIVLLELLTG+KPVDN+SN
Sbjct  795  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGRKPVDNESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKA NN VME VD E+S TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  855  LHQLILSKAANNAVMETVDPEISSTCKDLGDVKKVFQLALLCTKRQPSDRPTMHEVSRVL  914



>gb|ACF80312.1| unknown [Zea mays]
Length=310

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSR+ EKSDVYS+GIVLLELLTGKKPVD++ N
Sbjct  116  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECN  175

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEV RVL
Sbjct  176  LHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  235



>ref|XP_010431630.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=245

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  64   AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  123

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR PS+RPTMH+V RVL
Sbjct  124  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVL  183

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  184  GSFMMSEQPPAVTDTSAALAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  243

Query  209  T  207
            +
Sbjct  244  S  244



>gb|EEE57902.1| hypothetical protein OsJ_08587 [Oryza sativa Japonica Group]
Length=913

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 128/185 (69%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTSTYV+GTIGYIDPEYA TSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  728  AKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  787

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEVVRVL
Sbjct  788  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  847

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                     +    PP L         +N    L G      +   ++SDA+  ++F E 
Sbjct  848  DCLVYPDPPSKPALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEV  907

Query  221  ISKNT  207
            IS+NT
Sbjct  908  ISQNT  912



>ref|XP_003564133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Brachypodium distachyon]
Length=978

 Score =   200 bits (508),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 125/183 (68%), Gaps = 7/183 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  795  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  855  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  914

Query  374  -------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAIS  216
                     L P        P    +N    L G G        ++SDA+  ++F EAIS
Sbjct  915  DCLVRPDPPLKPVQTSSSLQPVPSYVNEYVSLRGAGALSCATSSSTSDAELFLKFGEAIS  974

Query  215  KNT  207
            +NT
Sbjct  975  QNT  977



>ref|XP_010227884.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Brachypodium distachyon]
Length=977

 Score =   199 bits (507),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 125/183 (68%), Gaps = 7/183 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  854  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  913

Query  374  -------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAIS  216
                     L P        P    +N    L G G        ++SDA+  ++F EAIS
Sbjct  914  DCLVRPDPPLKPVQTSSSLQPVPSYVNEYVSLRGAGALSCATSSSTSDAELFLKFGEAIS  973

Query  215  KNT  207
            +NT
Sbjct  974  QNT  976



>gb|AFJ14786.1| ERECTA-like kinase [Oryza sativa Japonica Group]
Length=986

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 128/185 (69%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTSTYV+GTIGYIDPEYA TSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  801  AKSLCTSKTHTSTYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  860

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEVVRVL
Sbjct  861  LHHLILSKAADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  920

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                     +    PP L         +N    L G      +   ++SDA+  ++F E 
Sbjct  921  DCLVYPDPPSKPALPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEV  980

Query  221  ISKNT  207
            IS+NT
Sbjct  981  ISQNT  985



>ref|XP_006649092.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=999

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 127/184 (69%), Gaps = 9/184 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  813  AKSLCTSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  872

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEVVRVL
Sbjct  873  LHHLILSKTADNTVMEMVDPDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  932

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                     +    PP L         +N    L G      +   ++SDA+  ++F E 
Sbjct  933  DCLVYPDPPSKPAQPPALPQSSTVPSYVNEYVSLRGGSTLSCENSSSASDAELFLKFGEV  992

Query  221  ISKN  210
            IS+N
Sbjct  993  ISQN  996



>gb|EEE65279.1| hypothetical protein OsJ_20503 [Oryza sativa Japonica Group]
Length=882

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 121/185 (65%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  697  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  756

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  757  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  816

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                             +         IN    L G           +SDA+  ++F E 
Sbjct  817  DCLVRPDPPPKSAQQLAMPQRPAVPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEV  876

Query  221  ISKNT  207
            IS+NT
Sbjct  877  ISQNT  881



>ref|NP_001132173.1| uncharacterized protein LOC100193598 [Zea mays]
 gb|ACF80913.1| unknown [Zea mays]
Length=492

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 125/193 (65%), Gaps = 16/193 (8%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  300  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  359

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  360  LHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  419

Query  374  ----------------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQW  243
                                    L P   P   ++    L G G        ++SDA+ 
Sbjct  420  DCLVNPEPPPQPQQQQQKAHAHHQLPPQPSPPAYVDEYVSLRGTGALSCANSSSTSDAEL  479

Query  242  LVRFREAISKNTL  204
             ++F EAIS+N +
Sbjct  480  FLKFGEAISQNMV  492



>ref|NP_001281212.1| uncharacterized protein LOC103504710 [Zea mays]
 gb|ACN34449.1| unknown [Zea mays]
Length=360

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSR+ EKSDVYS+GIVLLELLTGKKPVD++ N
Sbjct  166  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECN  225

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEV RVL
Sbjct  226  LHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  285



>ref|XP_009122365.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2 [Brassica rapa]
Length=963

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 125/165 (76%), Gaps = 10/165 (6%)
 Frame = -2

Query  698  TYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSNLHQLILSKADNN  519
            TYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTGKK VDN++NLHQLILSKAD+N
Sbjct  809  TYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGKKAVDNEANLHQLILSKADDN  868

Query  518  TVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVLTsllpppplkpc  339
            TVM+AVD+EVSVTC D  H+ KTFQLAL+CTKR P ERPTM EV RVL SLLP PP K  
Sbjct  869  TVMDAVDAEVSVTCVDSGHIKKTFQLALMCTKRNPMERPTMQEVARVLLSLLPSPPPKKP  928

Query  338  lppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
              P           G  +       +++  QW V+FREAISK++L
Sbjct  929  PSPQ----------GVEERRESHSLDTASPQWFVQFREAISKSSL  963



>gb|EEC80197.1| hypothetical protein OsI_22078 [Oryza sativa Indica Group]
Length=930

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 121/185 (65%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  745  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  804

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  805  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  864

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                             +         IN    L G           +SDA+  ++F E 
Sbjct  865  DCLVRPDPPPKSAQQLAMPQRPAVPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEV  924

Query  221  ISKNT  207
            IS+NT
Sbjct  925  ISQNT  929



>ref|XP_008452789.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Cucumis melo]
Length=991

 Score =   198 bits (504),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 130/187 (70%), Gaps = 13/187 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KT+TSTY++GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTG+K VDN+SN
Sbjct  806  AKSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNESN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSK  NN VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMHEV RV+
Sbjct  866  LHQLILSKTANNAVMETVDPEITATCKDLGAVKKAFQLALLCTKRQPSDRPTMHEVTRVI  925

Query  374  TsllpppplkpclppskSI-----------NYAQFLVGKGQTENQQDGNSSDAQWLVRFR  228
             SLLP        P   +I            YA   +      N    ++SDAQ  V+F 
Sbjct  926  GSLLPSAATPKQTPTITTIPPSAKSSCYKDEYAN--LKTPHVLNCPTMSTSDAQLFVKFG  983

Query  227  EAISKNT  207
            E IS+N+
Sbjct  984  EVISQNS  990



>ref|NP_001057087.1| Os06g0203800 [Oryza sativa Japonica Group]
 dbj|BAD35990.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 dbj|BAF19001.1| Os06g0203800 [Oryza sativa Japonica Group]
Length=978

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 121/185 (65%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  852

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  853  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  912

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                             +         IN    L G           +SDA+  ++F E 
Sbjct  913  DCLVRPDPPPKSAQQLAMPQRPAVPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEV  972

Query  221  ISKNT  207
            IS+NT
Sbjct  973  ISQNT  977



>ref|XP_006656743.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Oryza brachyantha]
Length=979

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 121/185 (65%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  854  LHHLILSKTANNAVMETVDPDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  913

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                             +         IN    L G           +SDA+  ++F E 
Sbjct  914  DCLVHPDPPLKSAQQLAMPQAPTVPSYINEYVSLRGTSVLSCANSSCTSDAELFLKFGEV  973

Query  221  ISKNT  207
            IS+NT
Sbjct  974  ISQNT  978



>emb|CDX99001.1| BnaC09g48340D [Brassica napus]
Length=964

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 125/165 (76%), Gaps = 7/165 (4%)
 Frame = -2

Query  698  TYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSNLHQLILSKADNN  519
            TYVLGTIGYIDPEYART+RL EKSDVYSFG+VLLELLTGKK VD+++NLHQLILSKAD+N
Sbjct  807  TYVLGTIGYIDPEYARTTRLNEKSDVYSFGVVLLELLTGKKAVDDEANLHQLILSKADDN  866

Query  518  TVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVLTsllpppplkpc  339
            TVM+AVD EVSVTC D  H+ KTFQLALLCTKR P ERPTM EV RVL SLLP PP K  
Sbjct  867  TVMDAVDPEVSVTCVDSGHIKKTFQLALLCTKRNPMERPTMQEVARVLLSLLPSPPPKKP  926

Query  338  lppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
                        L G  +    Q  +++  QW V+FREAISK++L
Sbjct  927  PS-------PAKLQGVEERRESQSSDTTSPQWFVQFREAISKSSL  964



>ref|XP_004964942.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Setaria italica]
Length=990

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 125/190 (66%), Gaps = 14/190 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  800  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  859

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD ++  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  860  LHHLILSKTASNEVMETVDPDIGDTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  919

Query  374  T--------------sllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLV  237
                                 PL P       IN    L G G        ++SDA+  +
Sbjct  920  DCLVNPDPPPKPPAHQPSGQSPLPPPSSVPSYINEYVSLRGTGALSCANSTSTSDAELFL  979

Query  236  RFREAISKNT  207
            +F EAIS+NT
Sbjct  980  KFGEAISQNT  989



>ref|XP_002438023.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
 gb|EER89390.1| hypothetical protein SORBIDRAFT_10g006670 [Sorghum bicolor]
Length=982

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 123/184 (67%), Gaps = 9/184 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  797  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VM+ VD ++  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  857  LHHLILSKTASNEVMDTVDPDIGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  916

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                              +P       IN    L G G        ++SDA+  ++F EA
Sbjct  917  DCLVNPDPPPKPSAHQLPQPSPAVPSYINEYVSLRGTGALSCANSTSTSDAELFLKFGEA  976

Query  221  ISKN  210
            IS+N
Sbjct  977  ISQN  980



>ref|XP_004964941.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Setaria italica]
Length=996

 Score =   197 bits (502),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 125/190 (66%), Gaps = 14/190 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  806  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD ++  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  866  LHHLILSKTASNEVMETVDPDIGDTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVL  925

Query  374  T--------------sllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLV  237
                                 PL P       IN    L G G        ++SDA+  +
Sbjct  926  DCLVNPDPPPKPPAHQPSGQSPLPPPSSVPSYINEYVSLRGTGALSCANSTSTSDAELFL  985

Query  236  RFREAISKNT  207
            +F EAIS+NT
Sbjct  986  KFGEAISQNT  995



>emb|CDX70013.1| BnaA10g23620D [Brassica napus]
Length=963

 Score =   196 bits (499),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 124/165 (75%), Gaps = 10/165 (6%)
 Frame = -2

Query  698  TYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSNLHQLILSKADNN  519
            TYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTGKK VDN++NLHQLILSKAD+N
Sbjct  809  TYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGKKAVDNEANLHQLILSKADDN  868

Query  518  TVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVLTsllpppplkpc  339
            TVM+AVD+EVSVTC D  H+ KTFQLAL+C KR P ERPTM EV RVL SLLP PP K  
Sbjct  869  TVMDAVDAEVSVTCVDSGHIKKTFQLALMCAKRNPMERPTMQEVARVLLSLLPSPPPKKP  928

Query  338  lppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKNTL  204
              P           G  +       +++  QW V+FREAISK++L
Sbjct  929  PSPQ----------GVEERRESHSLDTASPQWFVQFREAISKSSL  963



>ref|XP_004141340.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 ref|XP_004157376.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Cucumis sativus]
 gb|KGN55381.1| Erecta [Cucumis sativus]
Length=991

 Score =   196 bits (499),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 130/187 (70%), Gaps = 13/187 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KT+TSTY++GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTG+K VDN+SN
Sbjct  806  AKSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNESN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSK  NN VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMHEV RV+
Sbjct  866  LHQLILSKTANNAVMETVDPEITATCKDLGAVKKAFQLALLCTKRQPSDRPTMHEVTRVI  925

Query  374  TsllpppplkpclppskSI-----------NYAQFLVGKGQTENQQDGNSSDAQWLVRFR  228
             SLLP       +P   +I            YA   +      N    ++SDAQ   +F 
Sbjct  926  GSLLPSAATPKQIPTITTIPPSAKSSCYKDEYAN--LKTPHVLNCPTMSTSDAQLFAKFG  983

Query  227  EAISKNT  207
            E IS+N+
Sbjct  984  EVISQNS  990



>ref|XP_006452986.1| hypothetical protein CICLE_v100073972mg, partial [Citrus clementina]
 gb|ESR66226.1| hypothetical protein CICLE_v100073972mg, partial [Citrus clementina]
Length=400

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 131/186 (70%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K++TSTY++GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTG+K VDN+ N
Sbjct  214  AKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNECN  273

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E+S TC DL  V K FQLALLC+KR P++RPTMHEV RVL
Sbjct  274  LHHLILSKTANNDVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVL  333

Query  374  Tsllpppplkpclpp--skSINYAQFLVGKGQTENQQDGN--------SSDAQWLVRFRE  225
             SL+P P  +       S  ++ A+    K +  N +  +        +SDAQ  ++F E
Sbjct  334  GSLVPAPEPQKQPTSIPSALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGE  393

Query  224  AISKNT  207
             IS+N+
Sbjct  394  VISQNS  399



>ref|XP_010429656.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=381

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  200  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  259

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR PS+RPTMH+V RVL
Sbjct  260  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVL  319

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  320  GSFMMSEQPPAVTDTSAALAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  379

Query  209  T  207
            +
Sbjct  380  S  380



>gb|EMS68149.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=847

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 125/185 (68%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGKKPVDN+ N
Sbjct  662  AKSVCISKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKPVDNECN  721

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V + FQLALLC+KR PS+RPTMH+VV VL
Sbjct  722  LHHLILSKAADNTVMEMVDPDITATCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVL  781

Query  374  T---------sllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
            +             PP           +N    L            ++SDA+  ++F EA
Sbjct  782  SCLVCPEAPPKPAQPPASPQSSTAPSYVNEYVSLRSGSALSCANSSSASDAELFLKFGEA  841

Query  221  ISKNT  207
            IS+NT
Sbjct  842  ISQNT  846



>gb|AGS56396.1| LRR receptor-like serine/threonine-protein kinase, partial [Populus 
tremula]
Length=413

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 125/188 (66%), Gaps = 14/188 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ N
Sbjct  227  AKRLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECN  286

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E++ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  287  LHHLILSKTANNEVMETVDPEITATCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  346

Query  374  TsllpppplkpclppskSI------------NYAQFLVGKGQTENQQDGNSSDAQWLVRF  231
             SL+P          +                YA   +      N    ++SDAQ  ++F
Sbjct  347  GSLVPLITPPKQCTQAPPAPLPSAKVPCYIDEYAN--IKSPHILNCPSMSTSDAQLFLKF  404

Query  230  REAISKNT  207
             E IS+N+
Sbjct  405  GEVISQNS  412



>ref|XP_011069519.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase ERECTA [Sesamum indicum]
Length=992

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KPVDN+SN
Sbjct  806  AKSLCTSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LIL+KA NN+VM+ VD E+S TC DL  V K FQLALLCTK+ P +RPTMHEVVRVL
Sbjct  866  LHHLILTKAANNSVMDTVDPEISETCKDLGEVKKVFQLALLCTKKQPLDRPTMHEVVRVL  925



>ref|XP_010261893.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nelumbo nucifera]
Length=979

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDNDSN
Sbjct  794  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNDSN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLI+SK  NN VME VD E++ TCTDL  V K FQLALLCTK+ PS+RPTMHEV RVL
Sbjct  854  LHQLIMSKTANNAVMETVDPEITATCTDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVL  913



>gb|KJB65469.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=927

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KPVDN+SN
Sbjct  753  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESN  812

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN+VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  813  LHHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVL  872



>gb|KJB65470.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=928

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KPVDN+SN
Sbjct  754  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESN  813

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN+VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  814  LHHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVL  873



>ref|XP_008393579.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=991

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  803  AKNLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  862

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VDS+V+ TCTDL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  863  LHHLILSKTANNAVMETVDSDVTATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  922



>gb|KJB65471.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=971

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KPVDN+SN
Sbjct  797  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN+VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  857  LHHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVL  916



>gb|KJB65472.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=972

 Score =   194 bits (494),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KPVDN+SN
Sbjct  798  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESN  857

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN+VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  858  LHHLILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMHEVTRVL  917



>gb|ABR08864.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08865.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08866.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08867.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08868.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08869.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08870.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08871.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08872.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08873.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08874.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08876.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08877.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08878.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08879.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08880.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08881.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08882.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08883.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08884.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08885.1| erecta, partial [Arabidopsis thaliana]
 gb|ABR08886.1| erecta, partial [Arabidopsis thaliana]
Length=145

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  5    AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  64

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR P++RPTMH+V RVL
Sbjct  65   LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVL  124



>gb|EMT04765.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=939

 Score =   194 bits (493),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 125/185 (68%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  754  AKSVCISKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  813

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V + FQLALLC+KR PS+RPTMH+VV VL
Sbjct  814  LHHLILSKAADNTVMEMVDPDITATCKDLGEVKRMFQLALLCSKRQPSDRPTMHDVVHVL  873

Query  374  T---------sllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
            +             PP           +N    L            ++SDA+  ++F +A
Sbjct  874  SCLVCPEAPPKPAQPPASPQSSTAPSYVNEYVSLRSGSALSCANSSSASDAELFLKFGKA  933

Query  221  ISKNT  207
            IS+NT
Sbjct  934  ISQNT  938



>ref|NP_001235257.1| ERECTA [Glycine max]
 gb|ACM89555.1| ERECTA [Glycine max]
Length=467

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 126/188 (67%), Gaps = 14/188 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  281  AKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  340

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  N VME VD +++ TC DL  V K +QLALLCTKR P++RPTMHEV RVL
Sbjct  341  LHHLILSKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVL  400

Query  374  TsllpppplkpclppskSIN------------YAQFLVGKGQTENQQDGNSSDAQWLVRF  231
             SL+        L      +            YA   +      N    ++SDAQ  ++F
Sbjct  401  GSLVLSNTPPKQLAALPPASNPSAKVPCYVDEYAN--LKTPHLVNCPSMSTSDAQLFLKF  458

Query  230  REAISKNT  207
             E IS+N+
Sbjct  459  GEVISQNS  466



>ref|XP_010669304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Beta vulgaris subsp. vulgaris]
Length=992

 Score =   193 bits (491),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 130/185 (70%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+K VD++SN
Sbjct  807  AKSVCASKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDDESN  866

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA NN VME VD E++ TC DL +V K FQLALLCTK+ P +RPTMHEV RVL
Sbjct  867  LHHLILSKATNNAVMETVDPEITATCKDLGNVKKVFQLALLCTKKQPGDRPTMHEVTRVL  926

Query  374  TsllpppplkpclppskSINYAQFL---------VGKGQTENQQDGNSSDAQWLVRFREA  222
            TSL+P  P+K              +         +      N    ++SDAQ  ++F E 
Sbjct  927  TSLIPETPVKQVALTPLPPLPPSHMPSYMNEYANLKSPHMVNCPTMSTSDAQLFLKFGEV  986

Query  221  ISKNT  207
            IS+N+
Sbjct  987  ISQNS  991



>gb|ABR08875.1| erecta, partial [Arabidopsis thaliana]
Length=145

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  5    AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  64

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  + K FQLALLCTKR P++RPTMH+V RVL
Sbjct  65   LHHLIMSKTGNNEVMEMADPDITSTCKDLGVMKKVFQLALLCTKRQPNDRPTMHQVTRVL  124



>ref|XP_010273915.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Nelumbo nucifera]
Length=965

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 125/189 (66%), Gaps = 13/189 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDNDSN
Sbjct  771  AKSLCISKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNDSN  830

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQL++SK  NN VME VD E+S TC DL  V K FQLALLCTK+  S+RPTMHEV R+L
Sbjct  831  LHQLVMSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCTKKQASDRPTMHEVTRIL  890

Query  374  --------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN-----SSDAQWLVR  234
                    T  L               N + ++    + +N    N     +SDAQ  ++
Sbjct  891  GSLVPSEETKCLHQQFALQAPVSPTKTNVSSYMDEYAKLKNPHMVNCASLSTSDAQLFLK  950

Query  233  FREAISKNT  207
            F E IS+ T
Sbjct  951  FGEVISQTT  959



>ref|XP_010273914.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Nelumbo nucifera]
Length=988

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 125/189 (66%), Gaps = 13/189 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDNDSN
Sbjct  794  AKSLCISKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNDSN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQL++SK  NN VME VD E+S TC DL  V K FQLALLCTK+  S+RPTMHEV R+L
Sbjct  854  LHQLVMSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCTKKQASDRPTMHEVTRIL  913

Query  374  --------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN-----SSDAQWLVR  234
                    T  L               N + ++    + +N    N     +SDAQ  ++
Sbjct  914  GSLVPSEETKCLHQQFALQAPVSPTKTNVSSYMDEYAKLKNPHMVNCASLSTSDAQLFLK  973

Query  233  FREAISKNT  207
            F E IS+ T
Sbjct  974  FGEVISQTT  982



>ref|XP_008647408.1| PREDICTED: uncharacterized protein LOC100193598 isoform X2 [Zea 
mays]
Length=993

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 124/191 (65%), Gaps = 16/191 (8%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  801  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  860

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  861  LHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  920

Query  374  ----------------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQW  243
                                    L P   P   ++    L G G        ++SDA+ 
Sbjct  921  DCLVNPEPPPQPQQQQQKAHAHHQLPPQPSPPAYVDEYVSLRGTGALSCANSSSTSDAEL  980

Query  242  LVRFREAISKN  210
             ++F EAIS+N
Sbjct  981  FLKFGEAISQN  991



>ref|XP_008647407.1| PREDICTED: uncharacterized protein LOC100193598 isoform X1 [Zea 
mays]
 gb|ACN29076.1| unknown [Zea mays]
 gb|AFW76645.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=994

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 124/191 (65%), Gaps = 16/191 (8%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  802  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  861

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  862  LHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  921

Query  374  ----------------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQW  243
                                    L P   P   ++    L G G        ++SDA+ 
Sbjct  922  DCLVNPEPPPQPQQQQQKAHAHHQLPPQPSPPAYVDEYVSLRGTGALSCANSSSTSDAEL  981

Query  242  LVRFREAISKN  210
             ++F EAIS+N
Sbjct  982  FLKFGEAISQN  992



>ref|XP_009802873.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana sylvestris]
Length=990

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KT+TSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  805  AKSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  864

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH +IL+KA NN VME VD E++ TC DL  V K FQLALLCTKR P+ERPTMHEV RVL
Sbjct  865  LHHMILTKAANNAVMETVDPEITATCKDLGDVKKVFQLALLCTKRQPAERPTMHEVARVL  924



>ref|XP_010526027.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Tarenaya hassleriana]
Length=982

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 123/181 (68%), Gaps = 7/181 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K V+N+SN
Sbjct  803  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVENESN  862

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D E++ TC DL  V K FQLALLCTKR P ERPTMH+V RVL
Sbjct  863  LHHLIMSKTGNNAVMEMADPEITTTCKDLGEVKKVFQLALLCTKRQPGERPTMHQVTRVL  922

Query  374  -----TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISKN  210
                 TS+                 YA   +    + N    ++SDAQ  +RF E IS+N
Sbjct  923  GSLAPTSVPVAVASTTQPGSCYVDEYAN--LKAPHSLNCPSMSASDAQLFLRFGEVISQN  980

Query  209  T  207
            +
Sbjct  981  S  981



>ref|XP_002452905.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
 gb|EES05881.1| hypothetical protein SORBIDRAFT_04g034820 [Sorghum bicolor]
Length=893

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 124/185 (67%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVD++ N
Sbjct  708  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDDECN  767

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRV-  378
            LH LILSKA  NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEV RV 
Sbjct  768  LHHLILSKAAENTVMEMVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  827

Query  377  --------LTsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                    L     P  L+        ++    L G          ++SDA+  ++F E 
Sbjct  828  DSLVCPGPLPKQAQPQALEKSSTAPSYVSEYVGLRGGSALSCANSSSASDAELFMKFGEV  887

Query  221  ISKNT  207
            IS++T
Sbjct  888  ISRST  892



>emb|CAN74952.1| hypothetical protein VITISV_025649 [Vitis vinifera]
Length=756

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + S+K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  564  AKVLCSSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  623

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEV RVL
Sbjct  624  LHHLILSKTTNNAVMETVDPDITATCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVL  683



>ref|XP_004955237.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Setaria italica]
Length=975

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 124/185 (67%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  + THTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVD++ N
Sbjct  790  AKSLCVSLTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDDECN  849

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA +NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEVVRVL
Sbjct  850  LHHLILSKAADNTVMEMVDPDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVL  909

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                          P   +        ++    L G          ++SDA+  ++F E 
Sbjct  910  DSLVCPDPPPKQAQPQGSEQSATAPSYVSEYVSLRGGTALSCANSSSASDAELFMKFGEV  969

Query  221  ISKNT  207
            IS+NT
Sbjct  970  ISRNT  974



>gb|AFW76643.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1034

 Score =   193 bits (490),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 124/191 (65%), Gaps = 16/191 (8%)
 Frame = -2

Query  734   AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
             AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  842   AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  901

Query  554   LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
             LH LILSK  +N VME VD +V  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  902   LHHLILSKTASNEVMETVDPDVGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  961

Query  374   ----------------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQW  243
                                     L P   P   ++    L G G        ++SDA+ 
Sbjct  962   DCLVNPEPPPQPQQQQQKAHAHHQLPPQPSPPAYVDEYVSLRGTGALSCANSSSTSDAEL  1021

Query  242   LVRFREAISKN  210
              ++F EAIS+N
Sbjct  1022  FLKFGEAISQN  1032



>emb|CDP13474.1| unnamed protein product [Coffea canephora]
Length=992

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 125/188 (66%), Gaps = 14/188 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + + KTHTSTY++GTIGYIDPEYA TSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  804  AKSLCTTKTHTSTYIMGTIGYIDPEYAGTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRV-  378
            LH LIL+KA NN VM  VD E+S TC DL  V K FQLALLC++R PSERPTMHEV RV 
Sbjct  864  LHYLILTKAANNAVMGTVDPEISATCNDLGEVKKVFQLALLCSRRQPSERPTMHEVARVL  923

Query  377  -----------LTsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRF  231
                       LT+      L     P     YA   +   Q  N    ++SDAQ  ++F
Sbjct  924  GSLMPSSTPKMLTTNPTANLLPSAKVPCYMDEYAN--LKTPQLVNCSSMSTSDAQLFLKF  981

Query  230  REAISKNT  207
             E IS+N+
Sbjct  982  GEVISQNS  989



>ref|XP_009362801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   192 bits (487),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTST ++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  804  AKNLCPSKTHTSTCIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VDSE++ TCTDL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  864  LHHLILSKTANNAVMETVDSEITATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  923



>ref|XP_007012431.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY30050.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=983

 Score =   192 bits (487),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ N
Sbjct  797  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSK  NN VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  857  LHQLILSKTANNAVMETVDPEITATCKDLGAVKKAFQLALLCTKRHPSDRPTMHEVTRVL  916

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL+P           +        V   + E          N    ++SDAQ  ++F E
Sbjct  917  GSLMPLDTPPKQPSSMQPSPLPSTKVTCYKDEYANLKTPHLVNCPSMSTSDAQLFLKFGE  976

Query  224  AISKNT  207
             IS+N+
Sbjct  977  VISRNS  982



>gb|AFW73725.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=722

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSR+ EKSDVYS+GIVLLELLTGKKPVD++ N
Sbjct  528  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECN  587

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEV RVL
Sbjct  588  LHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  647



>ref|XP_011081595.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Sesamum indicum]
Length=973

 Score =   191 bits (486),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 131/190 (69%), Gaps = 17/190 (9%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  788  AKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  847

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LIL+KA +N VM+ VD E+  TC DL  V K FQLALLCTKR P +RPTMHEVVRVL
Sbjct  848  LHHLILTKAASNAVMDTVDPEILETCKDLGEVKKVFQLALLCTKRQPLDRPTMHEVVRVL  907

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN-------------SSDAQWLVR  234
             +L+PPP  K   P       AQ    + Q    +  N             +SDAQ  ++
Sbjct  908  GTLVPPPEAKLSTPTIS----AQLQSARAQCYMDEYANLKTPHLVNCSSMSTSDAQLFLK  963

Query  233  FREAISKNTL  204
            F E IS+N++
Sbjct  964  FGEVISQNSV  973



>gb|AFW73726.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=721

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSR+ EKSDVYS+GIVLLELLTGKKPVD++ N
Sbjct  527  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECN  586

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEV RVL
Sbjct  587  LHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  646



>emb|CBI20727.3| unnamed protein product [Vitis vinifera]
Length=986

 Score =   191 bits (486),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + S+K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  794  AKVLCSSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEV RVL
Sbjct  854  LHHLILSKTTNNAVMETVDPDITATCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVL  913



>ref|XP_002280069.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Vitis vinifera]
Length=994

 Score =   191 bits (486),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + S+K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  802  AKVLCSSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  861

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEV RVL
Sbjct  862  LHHLILSKTTNNAVMETVDPDITATCKDLGAVKKVFQLALLCTKKQPSDRPTMHEVTRVL  921



>ref|XP_008220576.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Prunus mume]
Length=991

 Score =   191 bits (485),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++K++TSTY++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+K VDN+SN
Sbjct  802  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNESN  861

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD EV+ TCTDL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  862  LHHLILSKTANNAVMETVDPEVTATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  921



>ref|XP_008220575.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Prunus mume]
Length=992

 Score =   191 bits (485),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++K++TSTY++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+K VDN+SN
Sbjct  803  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNESN  862

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD EV+ TCTDL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  863  LHHLILSKTANNAVMETVDPEVTATCTDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  922



>dbj|BAD94220.1| putative receptor-like protein kinase [Arabidopsis thaliana]
Length=441

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  260  AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  319

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR P++RPTMH+V RVL
Sbjct  320  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVL  379

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  380  GSFMLSEQPPAATDTSATLAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  439

Query  209  T  207
            +
Sbjct  440  S  440



>gb|KDO73637.1| hypothetical protein CISIN_1g0023491mg, partial [Citrus sinensis]
Length=764

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 133/186 (72%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K++TSTY++GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTG+K VDN+ N
Sbjct  578  AKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNECN  637

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E+S TC DL  V K FQLALLC+KR P++RPTMHEV RVL
Sbjct  638  LHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVL  697

Query  374  Tsllpp--pplkpclppskSINYAQFLVGKGQTENQQDGN--------SSDAQWLVRFRE  225
             SL+P   P  +P   PS  ++ A+    K +  N +  +        +SDAQ  ++F E
Sbjct  698  GSLVPAPEPQKQPTSIPSALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGE  757

Query  224  AISKNT  207
             IS+N+
Sbjct  758  VISQNS  763



>ref|XP_009337156.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Pyrus x bretschneideri]
Length=992

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 130/190 (68%), Gaps = 16/190 (8%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  804  AKNLCHSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK ++N VME VD E+  TCTDL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  864  LHHLILSKTESNAVMETVDPEILPTCTDLGQVKKVFQLALLCTKRQPTDRPTMHEVTRVL  923

Query  374  TsllpppplkpclppskSIN--------------YAQFLVGKGQTENQQDGNSSDAQWLV  237
             SL+P P       P+   +              YA   V      N    ++SDAQ  +
Sbjct  924  ASLMPSPAPPKQPTPANPPSSQLPITKVPCYVDEYAN--VKTPHLLNCPSMSTSDAQLFL  981

Query  236  RFREAISKNT  207
            +F E IS+N+
Sbjct  982  KFGEVISQNS  991



>ref|XP_009605434.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Nicotiana tomentosiformis]
Length=991

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KT+TSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  806  AKSLCTSKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  865

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH +IL+KA NN VME  D E++ TC DL  V K FQLALLCTKR P+ERPTMHEV RVL
Sbjct  866  LHHVILTKAANNAVMETADPEITATCKDLGDVKKVFQLALLCTKRQPAERPTMHEVARVL  925



>gb|KDP34024.1| hypothetical protein JCGZ_07595 [Jatropha curcas]
Length=986

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 128/188 (68%), Gaps = 14/188 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ N
Sbjct  794  AKSLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E++ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  854  LHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVTRVL  913

Query  374  ------------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRF  231
                        T+  PPPPL          +YA   +      N    ++SDAQ  ++F
Sbjct  914  GSLLPSVPIKQCTTPAPPPPLPSAKVSCYMDDYAN--LKTPHMVNCPSMSTSDAQLFLKF  971

Query  230  REAISKNT  207
             E IS+N+
Sbjct  972  GEVISQNS  979



>ref|XP_002516144.1| erecta, putative [Ricinus communis]
 gb|EEF46146.1| erecta, putative [Ricinus communis]
Length=980

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 125/186 (67%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ N
Sbjct  794  AKSLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E+S TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  854  LHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  913

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL+P         P+         V     E          N    ++SDAQ  ++F E
Sbjct  914  GSLVPSTTPPKQCMPAPPAPIPSAKVSCYMDEYANLKTPHMVNCPSMSTSDAQLFLKFGE  973

Query  224  AISKNT  207
             IS+N+
Sbjct  974  VISQNS  979



>ref|XP_008393446.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Malus domestica]
Length=992

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 130/189 (69%), Gaps = 14/189 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  804  AKTLCHSKTHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK ++N VME VD E+  TCTDL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  864  LHHLILSKTESNAVMETVDPEILPTCTDLGPVKKVFQLALLCTKRQPTDRPTMHEVTRVL  923

Query  374  TsllpppplkpclppskSINYAQFLVGK-------------GQTENQQDGNSSDAQWLVR  234
             SL+P P        +   + +Q  + K                 N    ++SDAQ  ++
Sbjct  924  ASLMPXPAPPKQPTXANPPS-SQLPITKXPCYVDEYVNLKTPHMLNCPSMSTSDAQLFLK  982

Query  233  FREAISKNT  207
            F E IS+N+
Sbjct  983  FGEVISQNS  991



>ref|XP_008786642.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X3 [Phoenix dactylifera]
Length=960

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGKK VDN+ N
Sbjct  774  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKAVDNECN  833

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKA  N VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  834  LHQLILSKAATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVL  893



>gb|AIR08789.1| receptor-like kinase ERECTA [Medicago sativa]
Length=978

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 128/186 (69%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +   K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  792  AKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  851

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V+ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  852  LHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVL  911

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL+P       L P +  ++    V     E          N    ++SDAQ  ++F E
Sbjct  912  GSLMPSVAPAKQLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGE  971

Query  224  AISKNT  207
             IS+N+
Sbjct  972  VISQNS  977



>ref|XP_007225368.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
 gb|EMJ26567.1| hypothetical protein PRUPE_ppa000847mg [Prunus persica]
Length=983

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++K++TSTY++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+K VDN+SN
Sbjct  794  AKSLCTSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD EV+ TC DL+ V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  854  LHHLILSKTANNAVMETVDPEVTATCMDLAAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  913



>ref|XP_008786640.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X2 [Phoenix dactylifera]
Length=985

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGKK VDN+ N
Sbjct  799  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKAVDNECN  858

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKA  N VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  859  LHQLILSKAATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVL  918



>ref|XP_008786639.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA isoform X1 [Phoenix dactylifera]
Length=1007

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+G+VLLELLTGKK VDN+ N
Sbjct  821  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGVVLLELLTGKKAVDNECN  880

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSKA  N VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  881  LHQLILSKAATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVL  940



>ref|XP_011019342.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Populus euphratica]
Length=980

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 127/188 (68%), Gaps = 14/188 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ N
Sbjct  794  AKRLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E++ TCTDL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  854  LHHLILSKTANNEVMETVDPEITATCTDLGAVKKVFQLALLCTKRQPADRPTMHEVTRVL  913

Query  374  TsllpppplkpclppskSI------------NYAQFLVGKGQTENQQDGNSSDAQWLVRF  231
             SL+PP         +                YA   +      N    ++SDAQ  ++F
Sbjct  914  GSLVPPITPPKQCTQAPPAPLPSAKAPCYIDEYAN--IKSPHILNCPSMSTSDAQLFLKF  971

Query  230  REAISKNT  207
             E IS+N+
Sbjct  972  GEVISQNS  979



>gb|KEH39916.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=956

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 128/186 (69%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +   K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  770  AKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  829

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V+ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  830  LHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVL  889

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL+P       L P +  ++    V     E          N    ++SDAQ  ++F E
Sbjct  890  GSLMPSVAPAKQLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGE  949

Query  224  AISKNT  207
             IS+N+
Sbjct  950  VISQNS  955



>gb|AFW73724.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=999

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSR+ EKSDVYS+GIVLLELLTGKKPVD++ N
Sbjct  805  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRINEKSDVYSYGIVLLELLTGKKPVDDECN  864

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  NTVME VD +++ TC DL  V K FQLALLC+KR PS+RPTMHEV RVL
Sbjct  865  LHHLILSKAAENTVMETVDQDITDTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVARVL  924



>ref|XP_006353850.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Solanum tuberosum]
Length=990

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KT+TSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  804  AKSLCISKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH +IL+KA NN VME VD E++ TC DL+ V K FQLALLC+KR P+ERPTMHEV RVL
Sbjct  864  LHHMILTKAANNAVMETVDPEITGTCKDLADVKKVFQLALLCSKRQPAERPTMHEVARVL  923



>gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 128/186 (69%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +   K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  799  AKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  858

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V+ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  859  LHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVL  918

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL+P       L P +  ++    V     E          N    ++SDAQ  ++F E
Sbjct  919  GSLMPSVAPAKQLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGE  978

Query  224  AISKNT  207
             IS+N+
Sbjct  979  VISQNS  984



>ref|XP_003588942.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Medicago 
truncatula]
Length=978

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 128/186 (69%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +   K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  792  AKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  851

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V+ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  852  LHHLILSKTASNAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPADRPTMHEVSRVL  911

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL+P       L P +  ++    V     E          N    ++SDAQ  ++F E
Sbjct  912  GSLMPSVAPAKQLTPLQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGE  971

Query  224  AISKNT  207
             IS+N+
Sbjct  972  VISQNS  977



>gb|KJB07391.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07392.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
 gb|KJB07393.1| hypothetical protein B456_001G019800 [Gossypium raimondii]
Length=983

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 123/186 (66%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KPVDN+S+
Sbjct  797  AKSLCISKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESS  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA N+ VME  D E++ TC DL  V K FQLALLCTKR P +RPTMHEV RVL
Sbjct  857  LHHLILSKAANDAVMETTDPEITATCKDLGAVKKVFQLALLCTKRHPLDRPTMHEVTRVL  916

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL P  P                 V     E          N    ++SDAQ  + F E
Sbjct  917  GSLRPLEPPAKQPTTIPPAPLPSTKVTSYMDEYANLKTPHLVNCPSMSTSDAQLFINFGE  976

Query  224  AISKNT  207
             IS+N+
Sbjct  977  VISRNS  982



>ref|XP_004245043.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Solanum lycopersicum]
Length=990

 Score =   189 bits (480),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KT+TSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  804  AKSLCISKTYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LIL+KA N+ VME VD E++ TC DL+ V K FQLALLC+KR P+ERPTMHEV RVL
Sbjct  864  LHHLILTKAANDAVMETVDPEITCTCKDLADVKKVFQLALLCSKRQPAERPTMHEVARVL  923



>dbj|BAK61880.1| LRR receptor-like serine/threonine-protein kinase [Citrus unshiu]
Length=933

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 133/186 (72%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K++TSTY++GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTG+K VDN+ N
Sbjct  747  AKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNECN  806

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E+S TC DL  V K FQLALLC+KR P++RPTMHEV RVL
Sbjct  807  LHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVL  866

Query  374  Tsllpp--pplkpclppskSINYAQFLVGKGQTENQQDGN--------SSDAQWLVRFRE  225
             SL+P   P  +P   PS  ++ A+    K +  N +  +        +SDAQ  ++F E
Sbjct  867  GSLVPAPEPQKQPTSIPSALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGE  926

Query  224  AISKNT  207
             IS+N+
Sbjct  927  VISQNS  932



>gb|AGL91671.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=939

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  756  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  815

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  816  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  875



>gb|EMS63677.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Triticum 
urartu]
Length=922

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  739  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  798

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  799  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  858



>ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X3 [Cicer arietinum]
Length=959

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +   K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  775  AKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  834

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V+ TC DL  + K +QLALLCTKR P++RPTMHEV RVL
Sbjct  835  LHHLILSKTADNAVMETVDPDVTATCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVL  894

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN--------SSDAQWLVRFREAI  219
             SL+P       L P      A+      +  N +  +        +SDAQ  ++F E I
Sbjct  895  ASLVPLTTPPKQLTPPLPAISAKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVI  954

Query  218  SKNT  207
            S+N+
Sbjct  955  SQNS  958



>ref|XP_010917192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Elaeis guineensis]
Length=986

 Score =   189 bits (480),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 125/185 (68%), Gaps = 9/185 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKK VDN+ N
Sbjct  801  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKAVDNECN  860

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQLILSK   N VME VD +++ TC DL  V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  861  LHQLILSKTATNAVMETVDPDITSTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVTRVL  920

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDG---------NSSDAQWLVRFREA  222
              L+ P P     PP              +  N ++          ++SDAQ  ++F E 
Sbjct  921  GCLVQPTPPPKHSPPLPLPAPPSVPSYIDEYANLKNPTTLTCTASLSTSDAQLFLKFGEV  980

Query  221  ISKNT  207
            IS+NT
Sbjct  981  ISQNT  985



>dbj|BAJ96098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score =   189 bits (479),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  852

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  853  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  912



>gb|AFC88469.1| ERECTA [Triticum aestivum]
Length=977

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  854  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  913



>ref|XP_006474503.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Citrus sinensis]
Length=981

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 133/186 (72%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K++TSTY++GTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTG+K VDN+ N
Sbjct  795  AKSLCVSKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGRKAVDNECN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E+S TC DL  V K FQLALLC+KR P++RPTMHEV RVL
Sbjct  855  LHHLILSKTANNAVMETVDPEISATCKDLGAVKKVFQLALLCSKRQPTDRPTMHEVSRVL  914

Query  374  Tsllpp--pplkpclppskSINYAQFLVGKGQTENQQ--------DGNSSDAQWLVRFRE  225
             SL+P   P  +P   PS  ++ A+    K +  N +          ++SDAQ  ++F E
Sbjct  915  GSLVPAPEPQKQPTSIPSALLSSAKVPCYKDEYANLKTPHMLNCPSMSTSDAQLFLKFGE  974

Query  224  AISKNT  207
             IS+N+
Sbjct  975  VISQNS  980



>gb|AFJ38187.2| receptor-like serine/threonine protein kinase 2 [Triticum aestivum]
Length=976

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  854  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  913



>gb|AFJ38186.2| receptor-like serine/threonine protein kinase 1 [Triticum aestivum]
 gb|AGL91673.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=975

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  852

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  853  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  912



>gb|AGL91672.1| erecta leucine-rich-repeat receptor-like kinase [Triticum aestivum]
Length=976

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  794  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  854  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  913



>ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Cicer arietinum]
Length=980

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +   K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  796  AKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  855

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V+ TC DL  + K +QLALLCTKR P++RPTMHEV RVL
Sbjct  856  LHHLILSKTADNAVMETVDPDVTATCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVL  915

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN--------SSDAQWLVRFREAI  219
             SL+P       L P      A+      +  N +  +        +SDAQ  ++F E I
Sbjct  916  ASLVPLTTPPKQLTPPLPAISAKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVI  975

Query  218  SKNT  207
            S+N+
Sbjct  976  SQNS  979



>gb|EMT11370.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Aegilops 
tauschii]
Length=1019

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ N
Sbjct  745  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN  804

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  805  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  864



>ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Cicer arietinum]
Length=984

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +   K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  800  AKSLCPTKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  859

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  +N VME VD +V+ TC DL  + K +QLALLCTKR P++RPTMHEV RVL
Sbjct  860  LHHLILSKTADNAVMETVDPDVTATCKDLGAIKKVYQLALLCTKRQPADRPTMHEVARVL  919

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN--------SSDAQWLVRFREAI  219
             SL+P       L P      A+      +  N +  +        +SDAQ  ++F E I
Sbjct  920  ASLVPLTTPPKQLTPPLPAISAKLPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVI  979

Query  218  SKNT  207
            S+N+
Sbjct  980  SQNS  983



>ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
 gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris]
Length=958

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 125/186 (67%), Gaps = 10/186 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  772  AKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  831

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LIL+KA  N VME VD +++ TC DL  V K +QLALLCTKR P++RPTMHEV RVL
Sbjct  832  LHHLILAKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVL  891

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTE----------NQQDGNSSDAQWLVRFRE  225
             SL+P              +     V     E          N    ++SDAQ  ++F E
Sbjct  892  GSLVPSNTPPKQPAALPPASNPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGE  951

Query  224  AISKNT  207
             IS+N+
Sbjct  952  VISQNS  957



>gb|KJB65473.1| hypothetical protein B456_010G096300 [Gossypium raimondii]
Length=978

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 6/126 (5%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+KPVDN+SN
Sbjct  798  AKSLCISKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKPVDNESN  857

Query  554  LHQL------ILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMH  393
            LH L      ILSK  NN+VME VD E++ TC DL  V K FQLALLCTKR PS+RPTMH
Sbjct  858  LHHLYLYAYQILSKTANNSVMETVDPEITDTCKDLGAVKKVFQLALLCTKRQPSDRPTMH  917

Query  392  EVVRVL  375
            EV RVL
Sbjct  918  EVTRVL  923



>ref|XP_006381995.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
 gb|ERP59792.1| hypothetical protein POPTR_0006s23680g [Populus trichocarpa]
Length=890

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ N
Sbjct  704  AKRLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECN  763

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E++ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  764  LHHLILSKTANNEVMETVDPEITATCKDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  823



>gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  794  AKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  N VME VD +++ TC DL  V K +QLALLCTKR P++RPTMHEV RVL
Sbjct  854  LHHLILSKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVL  913



>ref|XP_010429655.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=982

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  801  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  860

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR PS+RPTMH+V RVL
Sbjct  861  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVL  920

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  921  GSFMMSEQPPAVTDTSAALAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  980

Query  209  T  207
            +
Sbjct  981  S  981



>dbj|BAK07025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=977

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTGKKPVDN+ +
Sbjct  793  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECD  852

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH  ILSK  +N VME VD +++ TC DL  V K FQLALLCTK+ PS+RPTMHEVVRVL
Sbjct  853  LHHSILSKTASNAVMETVDPDIADTCQDLGEVKKVFQLALLCTKKQPSDRPTMHEVVRVL  912



>ref|XP_003522304.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X1 [Glycine max]
 gb|KHN29675.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=985

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 126/189 (67%), Gaps = 13/189 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  796  AKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  855

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  N+ VME VD +++ TC D+  V K FQLALLCTK+ P +RPTMHEV RVL
Sbjct  856  LHHLILSKTANDGVMETVDPDITATCKDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRVL  915

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN-------------SSDAQWLVR  234
             SL+P          ++ +        K Q    +  N             +SDAQ  ++
Sbjct  916  ASLVPSITPPKQTDQTQVVLSDSQPSAKMQCYKDEYANLTTPHLVNCPSMSTSDAQLFLK  975

Query  233  FREAISKNT  207
            F E IS+N+
Sbjct  976  FGEVISQNS  984



>ref|XP_006578096.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like isoform X2 [Glycine max]
Length=992

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 126/189 (67%), Gaps = 13/189 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  803  AKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  862

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  N+ VME VD +++ TC D+  V K FQLALLCTK+ P +RPTMHEV RVL
Sbjct  863  LHHLILSKTANDGVMETVDPDITATCKDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRVL  922

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN-------------SSDAQWLVR  234
             SL+P          ++ +        K Q    +  N             +SDAQ  ++
Sbjct  923  ASLVPSITPPKQTDQTQVVLSDSQPSAKMQCYKDEYANLTTPHLVNCPSMSTSDAQLFLK  982

Query  233  FREAISKNT  207
            F E IS+N+
Sbjct  983  FGEVISQNS  991



>ref|XP_010417421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=975

 Score =   186 bits (473),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  794  AKSLCLSKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR PS+RPTMH+V RVL
Sbjct  854  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVL  913

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  914  GSFMLSEQPPAVTDTSAALAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  973

Query  209  T  207
            +
Sbjct  974  S  974



>ref|XP_004303459.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Fragaria vesca subsp. vesca]
Length=983

 Score =   186 bits (472),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 122/189 (65%), Gaps = 15/189 (8%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTST V+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+ N
Sbjct  796  AKSLCISKTHTSTCVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNECN  855

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  NN VME VD E++ TC DL  V K FQLALLCTKR P++RPTMHEV RVL
Sbjct  856  LHHLILSKTANNAVMETVDPEITSTCMDLGAVKKVFQLALLCTKRQPTDRPTMHEVTRVL  915

Query  374  -------------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVR  234
                         T       L     P     YA   +      N    ++SDAQ  ++
Sbjct  916  GSLVPSPTQPKQATLNPLSITLSSVKAPCYMDEYAN--LKTPHMLNCPSMSTSDAQLFLK  973

Query  233  FREAISKNT  207
            F E IS+N+
Sbjct  974  FGEVISQNS  982



>ref|XP_010474472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Camelina sativa]
Length=796

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 123/175 (70%), Gaps = 5/175 (3%)
 Frame = -2

Query  716  AKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSNLHQLIL  537
            +KTHTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SNLH LI+
Sbjct  621  SKTHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIM  680

Query  536  SKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVLTsllpp  357
            SK  NN VME  D +++ TC DL  V K FQLALLCTKR PS+RPTMH+V RVL S +  
Sbjct  681  SKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVLGSFMLS  740

Query  356  pplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKNT  207
                     S ++  + ++     +    + N    ++SDAQ  +RF + IS+N+
Sbjct  741  EQPPAVTDTSAALAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNS  795



>ref|XP_006296065.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
 gb|EOA28963.1| hypothetical protein CARUB_v10025215mg [Capsella rubella]
Length=976

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  795  AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR PS+RPTMH+V RVL
Sbjct  855  LHHLIMSKTANNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVL  914

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  915  GSFMLSEQPPAATDTSAALAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  974

Query  209  T  207
            +
Sbjct  975  S  975



>ref|XP_006581305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN32167.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=984

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 127/189 (67%), Gaps = 13/189 (7%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  795  AKSLCPSKTHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  N+ VME VD +++ TC D+  V K FQLALLCTK+ P +RPTMHEV RVL
Sbjct  855  LHHLILSKTANDGVMETVDPDITTTCRDMGAVKKVFQLALLCTKKQPVDRPTMHEVTRVL  914

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGN-------------SSDAQWLVR  234
             SL+P   L      ++ +        K Q    +  N             +SDAQ  ++
Sbjct  915  GSLVPSITLPKQTDSTQVLLPDSQSSAKMQCYKDEYANLKTPHLVNCPSMSTSDAQLFLK  974

Query  233  FREAISKNT  207
            F E IS+N+
Sbjct  975  FGEVISQNS  983



>ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA-like [Glycine max]
 gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine 
soja]
Length=980

 Score =   185 bits (470),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTS LTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  794  AKSLCPSKSHTSTYIMGTIGYIDPEYARTSHLTEKSDVYSYGIVLLELLTGRKAVDNESN  853

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSKA  N VME VD +++ TC DL  V K +QLALLCTKR P++RPTMHEV RVL
Sbjct  854  LHHLILSKAATNAVMETVDPDITATCKDLGAVKKVYQLALLCTKRQPADRPTMHEVTRVL  913



>gb|EYU20292.1| hypothetical protein MIMGU_mgv1a026417mg, partial [Erythranthe 
guttata]
Length=953

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 129/187 (69%), Gaps = 12/187 (6%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + ++KTHTST V+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTGKK VD++ N
Sbjct  769  AKRLCASKTHTSTCVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGKKAVDDELN  828

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH +IL+KA NN VM+ VD E+S TC DL  V K FQLALLCTKR   ERPTMHEVVRVL
Sbjct  829  LHHMILTKAANNEVMDTVDPEISETCNDLGEVKKVFQLALLCTKRQLMERPTMHEVVRVL  888

Query  374  TsllpppplkpclppskSI----------NYAQFLVGKGQTENQQDGNSSDAQWLVRFRE  225
             +L+P       + PS  I           YA   +      N    ++SDA+  ++F E
Sbjct  889  RTLVPREDKSSTVLPSDQITSTKAQCYMDEYAN--LKTPHLVNCSSMSTSDAELFLKFGE  946

Query  224  AISKNTL  204
             ISKN++
Sbjct  947  VISKNSV  953



>ref|XP_006849687.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
 gb|ERN11268.1| hypothetical protein AMTR_s00024p00237440 [Amborella trichopoda]
Length=995

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K HTSTYV+GTIGYIDPEYARTSRL EKSDVYS+GIVLLELLTG K VDN+SN
Sbjct  804  AKSLLWSKAHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGMKAVDNESN  863

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH +ILSKA +NTVM+ VD E+  TC DL+ V K FQLALLCTKR PS+RPTMHEV RVL
Sbjct  864  LHHVILSKAASNTVMDTVDPEILDTCKDLNAVKKVFQLALLCTKRQPSDRPTMHEVTRVL  923



>ref|XP_010047401.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Eucalyptus grandis]
 gb|KCW79310.1| hypothetical protein EUGRSUZ_C00732 [Eucalyptus grandis]
Length=988

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK + + K+HTST ++GTIGYIDPEYARTSRLTEKSDVYS+G+VLLELLTG+K VDN+SN
Sbjct  795  AKTLCTTKSHTSTSIMGTIGYIDPEYARTSRLTEKSDVYSYGVVLLELLTGRKAVDNESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  ++ VME VD +V+ TC DL  V K FQLALLCTKR PSERPTMHEV RVL
Sbjct  855  LHHLILSKTASDAVMETVDPDVTATCKDLGAVKKVFQLALLCTKRQPSERPTMHEVARVL  914



>ref|XP_002880777.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57036.1| hypothetical protein ARALYDRAFT_481491 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  795  AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR P++RPTMH+V RVL
Sbjct  855  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVL  914

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  915  GSFMLSEQPPAATDTSATLAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  974

Query  209  T  207
            +
Sbjct  975  S  975



>ref|NP_180201.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
 sp|Q42371.1|ERECT_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
ERECTA; AltName: Full=Protein QUANTITATIVE RESISTANCE TO 
PLECTOSPHAERELLA 1; AltName: Full=Protein QUANTITATIVE RESISTANCE 
TO RALSTONIA SOLANACEARUM 1; AltName: Full=Protein TRANSPIRATION 
EFFICIENCY 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC49302.1| ERECTA [Arabidopsis thaliana]
 dbj|BAA11869.1| receptor protein kinase [Arabidopsis thaliana]
 gb|AAC14518.1| putative receptor-like protein kinase, ERECTA [Arabidopsis thaliana]
 gb|AAK59615.1| putative receptor protein kinase, ERECTA [Arabidopsis thaliana]
 gb|ACN59296.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEC07825.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Arabidopsis 
thaliana]
Length=976

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 5/181 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  795  AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR P++RPTMH+V RVL
Sbjct  855  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVL  914

Query  374  TsllpppplkpclppskSINYAQFL-----VGKGQTENQQDGNSSDAQWLVRFREAISKN  210
             S +           S ++  + ++     +    + N    ++SDAQ  +RF + IS+N
Sbjct  915  GSFMLSEQPPAATDTSATLAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQN  974

Query  209  T  207
            +
Sbjct  975  S  975



>gb|EYU32328.1| hypothetical protein MIMGU_mgv1a000790mg [Erythranthe guttata]
Length=985

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 127/206 (62%), Gaps = 46/206 (22%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTST+++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG K VDNDSN
Sbjct  797  AKSLCVSKTHTSTFLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGLKAVDNDSN  856

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L  LIL+K  NN+VM+ V  E+S TC DL  V K FQLALLCTKRLP +RP+MHEVVRVL
Sbjct  857  LLHLILTKTANNSVMDTVAREISETCKDLGEVKKVFQLALLCTKRLPLDRPSMHEVVRVL  916

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDG-----------------------  264
                           +  +N  +   GK   +N Q G                       
Sbjct  917  N--------------TMVVNLPE---GKSFGQNIQSGPLLPSTKIQCYMDEYANLKTPHL  959

Query  263  ------NSSDAQWLVRFREAISKNTL  204
                  ++SDAQ  ++F E IS+N++
Sbjct  960  VNCSSMSTSDAQLFLKFGEVISQNSV  985



>gb|KFK32516.1| hypothetical protein AALP_AA6G252800 [Arabis alpina]
Length=981

 Score =   182 bits (463),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 124/183 (68%), Gaps = 6/183 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTS LTEKSDVYS+GIVLLELLT +K VD+DSN
Sbjct  799  AKSLCVSKSHTSTYVMGTIGYIDPEYARTSHLTEKSDVYSYGIVLLELLTRRKAVDDDSN  858

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL  V K FQLALLCTKR PS+RPTMH+V RVL
Sbjct  859  LHHLIMSKTGNNAVMEMADPDITSTCKDLGMVKKVFQLALLCTKRQPSDRPTMHQVTRVL  918

Query  374  TsllpppplkpclppskSINYAQFLVGK------GQTENQQDGNSSDAQWLVRFREAISK  213
             S + P         + +       V +        + N    ++SDA+  +RF + IS+
Sbjct  919  GSFMLPEQPTAAAAAASTTLAGSCYVDEYANLKTPHSVNCSSMSASDAELFLRFGQVISQ  978

Query  212  NTL  204
            N++
Sbjct  979  NSV  981



>ref|XP_010098375.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
 gb|EXB74899.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Morus 
notabilis]
Length=1011

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K++TSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VDN+SN
Sbjct  822  AKSLCISKSYTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESN  881

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCT-DLSHVSKTFQLALLCTKRLPSERPTMHEVVRV  378
            LH LILSK  NN VME VD E++ TC  DL  V K FQLALLC KR P++RPTMHEV RV
Sbjct  882  LHHLILSKTANNAVMETVDPEITATCKEDLGAVRKVFQLALLCAKRQPTDRPTMHEVTRV  941

Query  377  LT  372
            L+
Sbjct  942  LS  943



>ref|XP_006408746.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
 gb|ESQ50199.1| hypothetical protein EUTSA_v10001898mg [Eutrema salsugineum]
Length=977

 Score =   181 bits (460),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 6/183 (3%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLT +K VD++SN
Sbjct  795  AKSLCVSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN  854

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  NN VME  D +++ TC DL+ V K FQLALLCTK+ PS+RPTMH+V RVL
Sbjct  855  LHHLIMSKTGNNAVMEMADPDITSTCKDLAVVKKVFQLALLCTKKQPSDRPTMHQVTRVL  914

Query  374  TsllpppplkpclppskSINYAQFLVGK-GQTENQQDGN-----SSDAQWLVRFREAISK  213
             S +           + +   A   + +    +N  + N     +SDA+  +RF + IS+
Sbjct  915  GSFMLSEQPPAAAAATSTTLTASCYIDEYANLKNPHNVNCSSMSASDAELFLRFGQVISQ  974

Query  212  NTL  204
            N++
Sbjct  975  NSV  977



>ref|XP_009117015.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 ref|XP_009117016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERECTA [Brassica rapa]
 gb|AGL91676.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDY11488.1| BnaA09g40540D [Brassica napus]
Length=987

 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VD++ N
Sbjct  799  AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDDEFN  858

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  +N VME  D +++ TC DL+ V K FQLALLCTKR P++RPTMH+VVRVL
Sbjct  859  LHHLIMSKTVSNAVMEMADPDITSTCKDLAVVKKVFQLALLCTKRQPNDRPTMHQVVRVL  918



>gb|AGL91677.1| erecta leucine-rich-repeat receptor-like kinase [Brassica napus]
 emb|CDX76712.1| BnaC08g32980D [Brassica napus]
Length=987

 Score =   180 bits (456),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTYV+GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K VD++ N
Sbjct  799  AKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDDEFN  858

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LI+SK  +N VME  D +++ TC DL+ V K FQLALLCTKR P++RPTMH+VVRVL
Sbjct  859  LHHLIMSKTVSNAVMEMADPDITSTCKDLAVVKKVFQLALLCTKRQPNDRPTMHQVVRVL  918



>ref|XP_007136889.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
 gb|ESW08883.1| hypothetical protein PHAVU_009G082500g [Phaseolus vulgaris]
Length=958

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 130/196 (66%), Gaps = 28/196 (14%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +K+HTSTY++GTIGYIDPEYARTSRLTEKSDVYS+GIVLLELLTG+K V+N+SN
Sbjct  772  AKSLCPSKSHTSTYIMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVENESN  831

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LH LILSK  ++ VME VD ++S TC ++  V K FQLALLCTK+ P +RPTMHEV RVL
Sbjct  832  LHHLILSKTASDAVMETVDPDISATCKEMIAVKKVFQLALLCTKKQPVDRPTMHEVTRVL  891

Query  374  TsllpppplkpclppskSINYAQFLV------GKGQTENQQDGN-------------SSD  252
                        +PP +S+   Q L+       K Q+   +  N             +SD
Sbjct  892  G---------SLVPPKESVPTMQVLIPPSRPSAKTQSYKDEYANLKAPHLVNCPSISTSD  942

Query  251  AQWLVRFREAISKNTL  204
            AQ  ++F E IS+N++
Sbjct  943  AQLFLKFGEVISQNSV  958



>ref|XP_002981099.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
 gb|EFJ17800.1| hypothetical protein SELMODRAFT_114051 [Selaginella moellendorffii]
Length=976

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I SA THTSTYV+GTIGYIDPEYARTSRL EKSDVYSFGIVLLEL+T +K VD++ N
Sbjct  784  AKSICSASTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELITRQKAVDDEKN  843

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ +LS  +N +VME VD EV  TCTD + + K  +LALLC ++ P++RPTMH+VV V+
Sbjct  844  LHQWVLSHVNNKSVMEIVDQEVKDTCTDPNAIQKLIRLALLCAQKFPAQRPTMHDVVNVI  903



>ref|XP_002982573.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
 gb|EFJ16326.1| hypothetical protein SELMODRAFT_155267 [Selaginella moellendorffii]
Length=977

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I SA THTSTYV+GTIGYIDPEYARTSRL EKSDVYSFGIVLLEL+T +K VD++ N
Sbjct  785  AKSICSASTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELITRQKAVDDEKN  844

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ +LS  +N +VME VD EV  TCTD + + K  +LALLC ++ P++RPTMH+VV V+
Sbjct  845  LHQWVLSHVNNKSVMEIVDQEVKDTCTDPNAIQKLIRLALLCAQKFPAQRPTMHDVVNVI  904



>ref|XP_002975149.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
 gb|EFJ23934.1| hypothetical protein SELMODRAFT_102522, partial [Selaginella 
moellendorffii]
Length=944

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I   KTHTST+VLGTIGYIDPEYARTSRL EKSDVYS+GIVLLEL+TG K VD++ N
Sbjct  767  AKSICPTKTHTSTFVLGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELITGLKAVDDERN  826

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ +LS  +NNTVME +D+E+  TC D+  V K  +LALLC ++  ++RP MH+V  VL
Sbjct  827  LHQWVLSHVNNNTVMEVIDAEIKDTCQDIGTVQKMIRLALLCAQKQAAQRPAMHDVANVL  886



>ref|XP_002977553.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
 gb|EFJ21557.1| hypothetical protein SELMODRAFT_107124, partial [Selaginella 
moellendorffii]
Length=944

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I   KTHTST+VLGTIGYIDPEYARTSRL EKSDVYS+GIVLLEL+TG K VD++ N
Sbjct  767  AKSICPTKTHTSTFVLGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELITGLKAVDDERN  826

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            LHQ +LS  +NNTVME +D+E+  TC D+  V K  +LALLC ++  ++RP MH+V  VL
Sbjct  827  LHQWVLSHVNNNTVMEVIDAEIKDTCQDIGTVQKMIRLALLCAQKQAAQRPAMHDVANVL  886



>gb|AAL50210.1| ER1-like receptor kinase, partial [Camelina sativa]
Length=144

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -2

Query  659  YARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSNLHQLILSKADNNTVMEAVDSEVSVT  480
            YARTSRLTEKSDVYS+GIVLLELLT +K VD++SNLH LI+SK  NN VME  D +++ T
Sbjct  1    YARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITST  60

Query  479  CTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            C DL  V K FQLALLCTKR PS+RPTMH+V RVL
Sbjct  61   CKDLGVVKKVFQLALLCTKRQPSDRPTMHQVTRVL  95



>ref|XP_001770079.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ65061.1| ERL1c AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=948

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I  A+THTST+V+GTIGYIDPEYA+TSRL EKSDVYSFGI+LLE+LT KK VD++ N
Sbjct  757  AKNIQPARTHTSTHVMGTIGYIDPEYAQTSRLNEKSDVYSFGILLLEILTNKKAVDDEVN  816

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L   ++S+ +  T+   +D  V+ TC DL  + KT +LALLC+K  PS RP+M++V +VL
Sbjct  817  LLNWVMSRLEGKTMQNVIDPYVTATCQDLDSLEKTLKLALLCSKDNPSHRPSMYDVSQVL  876



>ref|XP_001755991.1| ERL1d AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ79276.1| ERL1d AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=864

 Score =   146 bits (368),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I  A+THTST+VLGTIGYIDPEYA+TSRL EKSDVYSFGIVLLE+L  KK VD++ N
Sbjct  740  AKNIQPARTHTSTHVLGTIGYIDPEYAQTSRLNEKSDVYSFGIVLLEILANKKAVDDEVN  799

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L   ++S+ +  T+ + +D  V  TC D+  + KT +LALLC+K  PS RP+M++V +VL
Sbjct  800  LLDWVMSQLEGKTMQDVIDPHVRATCKDVDALEKTLKLALLCSKLNPSHRPSMYDVSQVL  859



>ref|XP_001783127.1| ERL1a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ52064.1| ERL1a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=946

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I +A+THTST++LGTIGYIDPEYA+TSRL  KSDVYSFGIVLLELLT K  VD++ N
Sbjct  766  AKNIQAARTHTSTHILGTIGYIDPEYAQTSRLNVKSDVYSFGIVLLELLTNKMAVDDEVN  825

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L   ++SK +  T+ + +   V  TC DL  + KT +LALLC+K  PS RP+M++V +VL
Sbjct  826  LLDWVMSKLEGKTIQDVIHPHVRATCQDLDALEKTLKLALLCSKLNPSHRPSMYDVSQVL  885



>gb|AAL68842.1|AF466199_1 putative receptor protein kinase [Sorghum bicolor]
Length=921

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 104/184 (57%), Gaps = 15/184 (8%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK +  +KTHTSTYV+GTIGYIDPEYARTSRL EKSDVY     L     G       S 
Sbjct  742  AKSLCVSKTHTSTYVMGTIGYIDPEYARTSRLNEKSDVYR----LWHCSAGAADWQEASG  797

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
              Q ILSK  +N VM+ VD ++  TC DL  V K FQLALLCTKR PS+RPTMHEVVRVL
Sbjct  798  --QRILSKTASNEVMDTVDPDIGDTCKDLGEVKKLFQLALLCTKRQPSDRPTMHEVVRVL  855

Query  374  ---------TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREA  222
                              +P       IN    L G G        ++SDA+  ++F EA
Sbjct  856  DCLVNPDPPPKPSAHQLPQPSPAVPSYINEYVSLRGTGALSCANSTSTSDAELFLKFGEA  915

Query  221  ISKN  210
            IS+N
Sbjct  916  ISQN  919



>ref|XP_001763775.1| ERL2a AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ71417.1| ERL2a AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=948

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I   +THTST+VLGTIGYIDPEYA+TSRL EKSDVYSFGIVLLELL GKK VD++ N
Sbjct  767  AKNIQPTRTHTSTFVLGTIGYIDPEYAQTSRLNEKSDVYSFGIVLLELLMGKKAVDDEVN  826

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L   + SK ++  ++E VD  V  TC  ++H+ K  +LALLC K+ PS+RPTM++V +VL
Sbjct  827  LLDWVRSKIEDKNLLEFVDPYVRATCPSMNHLEKALKLALLCAKQTPSQRPTMYDVAQVL  886

Query  374  T  372
            +
Sbjct  887  S  887



>ref|XP_001770421.1| ERL2b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ64758.1| ERL2b AtERECTA-like receptor S/T protein kinase protein, partial 
[Physcomitrella patens]
Length=947

 Score =   137 bits (346),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I   +THTST+VLGTIGYIDPEYA+TSRL EKSDVYSFGIVLLELL GKK VD++ N
Sbjct  767  AKNIQPTRTHTSTFVLGTIGYIDPEYAQTSRLNEKSDVYSFGIVLLELLMGKKAVDDEVN  826

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
            L   + SK +   ++E VD  V  TC  + H+ K  +LALLC K+ PS+RPTM++V +VL
Sbjct  827  LLDWVRSKIEQKNLLEFVDPYVRSTCPSMDHLEKALKLALLCAKQTPSQRPTMYDVAQVL  886

Query  374  T  372
            +
Sbjct  887  S  887



>ref|XP_001755734.1| ERL1b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ79407.1| ERL1b AtERECTA-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=907

 Score =   135 bits (340),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 83/174 (48%), Positives = 109/174 (63%), Gaps = 17/174 (10%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AK I +A+THTST+VLGTIGYIDPEYA+TSRL EKSDVYSFGIVLLELLT +  VD++  
Sbjct  749  AKNIQAARTHTSTHVLGTIGYIDPEYAQTSRLNEKSDVYSFGIVLLELLTSRMAVDDE--  806

Query  554  LHQLILSKADNNTVMEAVDSEVSVTCTDLSHVSKTFQLALLCTKRLPSERPTMHEVVRVL  375
                ++SK    T+ + VD     TC +L+ + KT +LALLC+K  PS RP+M++V +VL
Sbjct  807  ----VMSKLLGKTMQDVVDPHARATCQNLNALEKTLKLALLCSKLNPSHRPSMYDVSQVL  862

Query  374  TsllpppplkpclppskSINYAQFLVGKGQTENQQDGNSSDAQWLVRFREAISK  213
             SLLP    +                      NQ+  +SS    L +F+EAIS+
Sbjct  863  LSLLPVQIEEESPTLKSPF-----------PANQRRKSSSGDTLLHQFKEAISR  905



>gb|AFW86034.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1007

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = -2

Query  734  AKCISSAKTHTSTYVLGTIGYIDPEYARTSRLTEKSDVYSFGIVLLELLTGKKPVDNDSN  555
            AKC+ +AK+H STYVLGTIGYIDPEYARTSRL EKSDVYSFG+VLLELLTG+K VDN+SN
Sbjct  797  AKCVPAAKSHASTYVLGTIGYIDPEYARTSRLNEKSDVYSFGVVLLELLTGRKAVDNESN  856

Query  554  LHQLI  540
            LHQL+
Sbjct  857  LHQLV  861



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515