BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028N15

Length=747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080124.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    349   1e-115   Sesamum indicum [beniseed]
gb|KHG08643.1|  hypothetical protein F383_12346                         344   5e-114   Gossypium arboreum [tree cotton]
gb|KJB42336.1|  hypothetical protein B456_007G150200                    343   6e-114   Gossypium raimondii
gb|KJB42339.1|  hypothetical protein B456_007G150200                    343   7e-114   Gossypium raimondii
ref|XP_007050148.1|  NAD(P)-binding Rossmann-fold superfamily pro...    341   1e-113   
gb|KJB42335.1|  hypothetical protein B456_007G150200                    344   1e-113   Gossypium raimondii
emb|CDP03802.1|  unnamed protein product                                344   2e-113   Coffea canephora [robusta coffee]
ref|XP_003542442.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    342   9e-113   Glycine max [soybeans]
ref|XP_007050147.1|  NAD(P)-binding Rossmann-fold superfamily pro...    341   1e-112   
ref|XP_007050145.1|  NAD(P)-binding Rossmann-fold superfamily pro...    341   1e-112   
ref|XP_007144408.1|  hypothetical protein PHAVU_007G153700g             340   3e-112   Phaseolus vulgaris [French bean]
ref|XP_010264829.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    340   3e-112   Nelumbo nucifera [Indian lotus]
gb|ACJ84721.1|  unknown                                                 338   2e-111   Medicago truncatula
ref|XP_004247128.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    338   2e-111   
ref|XP_010548735.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    338   3e-111   Tarenaya hassleriana [spider flower]
ref|XP_006355892.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    337   4e-111   Solanum tuberosum [potatoes]
ref|XP_010036149.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    337   6e-111   Eucalyptus grandis [rose gum]
gb|ACU23211.1|  unknown                                                 336   1e-110   Glycine max [soybeans]
ref|XP_008459972.1|  PREDICTED: LOW QUALITY PROTEIN: NADH dehydro...    336   1e-110   Cucumis melo [Oriental melon]
gb|EYU46388.1|  hypothetical protein MIMGU_mgv1a007681mg                336   1e-110   Erythranthe guttata [common monkey flower]
gb|AFK48198.1|  unknown                                                 336   2e-110   Lotus japonicus
ref|XP_010936110.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    335   2e-110   Elaeis guineensis
ref|XP_002271401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    335   2e-110   Vitis vinifera
ref|XP_009586626.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    335   3e-110   Nicotiana tomentosiformis
ref|XP_011024495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    334   9e-110   Populus euphratica
ref|XP_009395307.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    334   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN46368.1|  hypothetical protein Csa_6G087960                       333   1e-109   Cucumis sativus [cucumbers]
gb|EPS69627.1|  hypothetical protein M569_05135                         332   2e-109   Genlisea aurea
ref|XP_004495054.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    332   3e-109   Cicer arietinum [garbanzo]
ref|XP_007201067.1|  hypothetical protein PRUPE_ppa006705mg             332   3e-109   
ref|XP_010540921.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    332   4e-109   Tarenaya hassleriana [spider flower]
gb|ABK94679.1|  unknown                                                 332   4e-109   Populus trichocarpa [western balsam poplar]
ref|XP_008372401.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    332   4e-109   Malus domestica [apple tree]
ref|XP_002301843.1|  hypothetical protein POPTR_0002s25720g             332   5e-109   Populus trichocarpa [western balsam poplar]
ref|XP_009335235.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    332   8e-109   Pyrus x bretschneideri [bai li]
ref|XP_008382707.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    328   4e-107   
ref|XP_004954373.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    327   8e-107   Setaria italica
ref|XP_009370595.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    327   8e-107   Pyrus x bretschneideri [bai li]
ref|XP_002453037.1|  hypothetical protein SORBIDRAFT_04g037200          327   1e-106   Sorghum bicolor [broomcorn]
gb|ACF85773.1|  unknown                                                 325   4e-106   Zea mays [maize]
dbj|BAG95473.1|  unnamed protein product                                322   4e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011458045.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    324   5e-106   Fragaria vesca subsp. vesca
ref|XP_006648113.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    322   1e-105   
ref|NP_001048516.1|  Os02g0816800                                       323   2e-105   
gb|EEC74241.1|  hypothetical protein OsI_09443                          323   3e-105   Oryza sativa Indica Group [Indian rice]
gb|AFW74028.1|  NADH-ubiquinone oxidoreductase subunit                  324   4e-105   
ref|NP_001149069.1|  LOC100282690                                       322   7e-105   
ref|XP_009370589.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    322   8e-105   Pyrus x bretschneideri [bai li]
ref|XP_006854436.1|  hypothetical protein AMTR_s00039p00218660          321   1e-104   Amborella trichopoda
gb|KDP26455.1|  hypothetical protein JCGZ_17613                         318   1e-103   Jatropha curcas
ref|XP_003570393.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    317   3e-103   
ref|XP_010940664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    316   8e-103   
ref|XP_008789505.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    314   5e-102   Phoenix dactylifera
gb|EMT17104.1|  putative NADH dehydrogenase (ubiquinone) 1 alpha ...    309   3e-101   
gb|EMS47161.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcomple...    309   4e-101   Triticum urartu
ref|XP_010091822.1|  hypothetical protein L484_015891                   311   7e-101   Morus notabilis
ref|XP_002526534.1|  NADH-ubiquinone oxidoreductase 39 kD subunit...    310   1e-100   
dbj|BAJ86608.1|  predicted protein                                      310   2e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010684864.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    309   6e-100   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAH20309.1|  AT2G20360                                              303   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565469.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomp...    305   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884196.1|  catalytic/ coenzyme binding protein                302   3e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_004140669.1|  PREDICTED: ABC transporter C family member 5...    323   3e-97    
gb|KJB42340.1|  hypothetical protein B456_007G150200                    301   3e-97    Gossypium raimondii
ref|XP_010489051.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    302   4e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010415893.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    301   6e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010467837.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    300   3e-96    Camelina sativa [gold-of-pleasure]
emb|CDY13877.1|  BnaA09g43790D                                          298   7e-96    Brassica napus [oilseed rape]
emb|CDY39772.1|  BnaA09g10240D                                          297   2e-95    Brassica napus [oilseed rape]
emb|CDY31970.1|  BnaA07g00250D                                          297   2e-95    Brassica napus [oilseed rape]
ref|XP_006443722.1|  hypothetical protein CICLE_v10020464mg             297   2e-95    
emb|CDX81965.1|  BnaC08g36360D                                          297   2e-95    
ref|XP_009112664.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    296   5e-95    Brassica rapa
ref|XP_002321296.2|  hypothetical protein POPTR_0014s18680g             295   8e-95    
ref|XP_009117495.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    295   1e-94    Brassica rapa
gb|KFK40412.1|  hypothetical protein AALP_AA3G370500                    293   1e-93    Arabis alpina [alpine rockcress]
emb|CDY05746.1|  BnaC07g00570D                                          293   1e-93    
emb|CDY03308.1|  BnaC09g10400D                                          293   1e-93    
ref|XP_006408954.1|  hypothetical protein EUTSA_v10002002mg             292   3e-93    Eutrema salsugineum [saltwater cress]
ref|XP_009102039.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    290   1e-92    Brassica rapa
ref|XP_008235764.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    288   4e-92    Prunus mume [ume]
gb|KDO37085.1|  hypothetical protein CISIN_1g047628mg                   275   6e-88    Citrus sinensis [apfelsine]
gb|ABK24353.1|  unknown                                                 270   6e-85    Picea sitchensis
gb|KJB42337.1|  hypothetical protein B456_007G150200                    256   7e-80    Gossypium raimondii
gb|KJB42338.1|  hypothetical protein B456_007G150200                    255   1e-79    Gossypium raimondii
gb|EEE58042.1|  hypothetical protein OsJ_08874                          246   1e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763970.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    190   5e-55    Nicotiana sylvestris
ref|XP_001765756.1|  predicted protein                                  174   9e-48    
ref|XP_002976090.1|  hypothetical protein SELMODRAFT_104564             171   2e-47    
ref|XP_002968287.1|  hypothetical protein SELMODRAFT_89106              171   4e-47    
ref|XP_001757609.1|  predicted protein                                  167   2e-45    
ref|XP_005651289.1|  NAD(P)-binding protein                             161   2e-43    Coccomyxa subellipsoidea C-169
ref|XP_009803384.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    147   3e-40    Nicotiana sylvestris
emb|CEF99374.1|  NAD(P)-binding domain                                  147   5e-38    Ostreococcus tauri
gb|EEC74184.1|  hypothetical protein OsI_09314                          146   9e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_001420142.1|  predicted protein                                  143   2e-36    Ostreococcus lucimarinus CCE9901
ref|XP_003059930.1|  predicted protein                                  138   8e-35    Micromonas pusilla CCMP1545
gb|KJB42341.1|  hypothetical protein B456_007G150200                    137   2e-34    Gossypium raimondii
ref|XP_002504449.1|  predicted protein                                  137   5e-34    Micromonas commoda
ref|XP_007510295.1|  predicted protein                                  136   1e-33    Bathycoccus prasinos
ref|WP_026986147.1|  3-beta hydroxysteroid dehydrogenase                132   1e-32    Fodinicurvata fenggangensis
ref|XP_005850526.1|  hypothetical protein CHLNCDRAFT_34039              132   2e-32    Chlorella variabilis
ref|WP_022729668.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      130   3e-32    Fodinicurvata sediminis
ref|XP_006296717.1|  hypothetical protein CARUB_v10014190mg             125   3e-30    
ref|WP_038036038.1|  3-beta hydroxysteroid dehydrogenase                125   3e-30    
ref|WP_027287982.1|  3-beta hydroxysteroid dehydrogenase                125   4e-30    Rhodovibrio salinarum
ref|XP_011401632.1|  NADH dehydrogenase [ubiquinone] 1 alpha subc...    125   6e-30    Auxenochlorella protothecoides
dbj|GAK45366.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcompl...    122   3e-29    Tepidicaulis marinus
ref|WP_024512948.1|  3-beta hydroxysteroid dehydrogenase                122   5e-29    Bradyrhizobium sp. ARR65
ref|WP_036555293.1|  3-beta hydroxysteroid dehydrogenase                121   6e-29    Nisaea denitrificans
ref|WP_029621248.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    122   7e-29    Rhizobium/Agrobacterium group
gb|EKE10168.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomple...    120   2e-28    uncultured bacterium
ref|WP_019199324.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      120   3e-28    Bradyrhizobiaceae
ref|WP_039195170.1|  3-beta hydroxysteroid dehydrogenase                120   3e-28    Aureimonas altamirensis
ref|WP_035694954.1|  3-beta hydroxysteroid dehydrogenase                120   4e-28    Aurantimonas coralicida
ref|WP_040326025.1|  3-beta hydroxysteroid dehydrogenase                119   4e-28    
gb|EAS48786.1|  NADH-ubiquinone oxidoreductase                          119   7e-28    Aurantimonas manganoxydans SI85-9A1
ref|WP_024514903.1|  3-beta hydroxysteroid dehydrogenase                119   7e-28    Bradyrhizobium sp. Tv2a-2
ref|WP_029585516.1|  3-beta hydroxysteroid dehydrogenase                118   1e-27    Bradyrhizobium sp. URHD0069
ref|WP_008943960.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      118   1e-27    Oceanibaculum indicum
ref|WP_011661958.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      118   2e-27    Rhodopseudomonas palustris
sp|Q0DWQ7.1|CCB12_ORYSJ  RecName: Full=Cyclin-B1-2; AltName: Full...    118   2e-27    Oryza sativa Japonica Group [Japonica rice]
ref|WP_011508790.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   3e-27    Nitrobacter hamburgensis
ref|WP_035569694.1|  3-beta hydroxysteroid dehydrogenase                117   3e-27    Hyphomonas adhaerens
ref|WP_027845124.1|  3-beta hydroxysteroid dehydrogenase                117   3e-27    
ref|WP_041768854.1|  3-beta hydroxysteroid dehydrogenase                117   4e-27    
ref|WP_007529376.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      117   4e-27    Rhizobium mesoamericanum
ref|WP_041345268.1|  3-beta hydroxysteroid dehydrogenase                117   4e-27    Nitrobacter winogradskyi
ref|WP_038279873.1|  3-beta hydroxysteroid dehydrogenase                117   5e-27    alpha proteobacterium Mf 1.05b.01
gb|AEV35208.1|  NADH dehydrogenase (ubiquinone)                         116   5e-27    Pseudovibrio sp. FO-BEG1
ref|WP_035693857.1|  3-beta hydroxysteroid dehydrogenase                116   5e-27    
ref|WP_015663304.1|  hypothetical protein                               116   6e-27    Bradyrhizobium oligotrophicum
ref|WP_009757683.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      116   6e-27    Ahrensia sp. R2A130
ref|WP_043948096.1|  3-beta hydroxysteroid dehydrogenase                116   6e-27    Candidatus Phaeomarinobacter ectocarpi
ref|WP_041801299.1|  3-beta hydroxysteroid dehydrogenase                116   6e-27    Rhodopseudomonas palustris
ref|WP_039540296.1|  3-beta hydroxysteroid dehydrogenase                116   7e-27    Ruegeria sp. ANG-R
ref|WP_020043898.1|  hypothetical protein                               116   7e-27    
gb|ABA03434.1|  NAD-dependent epimerase/dehydratase                     116   8e-27    Nitrobacter winogradskyi Nb-255
gb|ABD86012.1|  NAD-dependent epimerase/dehydratase                     116   8e-27    Rhodopseudomonas palustris BisB18
emb|CCF21999.1|  putative NADH dehydrogenase/NADH dehydrogenase (...    115   1e-26    Rhizobium sp. NT-26
ref|WP_037036496.1|  3-beta hydroxysteroid dehydrogenase                115   1e-26    
gb|EEA95143.1|  NADH dehydrogenase (ubiquinone) 1 alpha subcomple...    115   1e-26    Pseudovibrio sp. JE062
ref|WP_027297804.1|  3-beta hydroxysteroid dehydrogenase                115   1e-26    Rhodospirillales bacterium URHD0088
ref|WP_037159370.1|  3-beta hydroxysteroid dehydrogenase                115   1e-26    Rhizobium sp. YS-1r
ref|WP_035069164.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    
ref|WP_038548505.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Neorhizobium galegae
ref|WP_029057708.1|  3-beta hydroxysteroid dehydrogenase                115   2e-26    Stappia stellulata
ref|WP_009028277.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   2e-26    Bradyrhizobium sp. ORS 375
ref|WP_006310143.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      115   2e-26    Agrobacterium sp. ATCC 31749
ref|WP_038592623.1|  3-beta hydroxysteroid dehydrogenase                114   2e-26    Neorhizobium galegae
ref|WP_007598696.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   3e-26    Rhizobium sp. PDO1-076
ref|WP_028793393.1|  3-beta hydroxysteroid dehydrogenase                114   3e-26    Thalassobaculum salexigens
ref|WP_011923395.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   4e-26    Bradyrhizobium sp. ORS 278
ref|WP_023512751.1|  putative nucleoside-diphosphate-sugar epimerase    114   5e-26    Shinella sp. DD12
ref|WP_003493425.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   5e-26    Agrobacterium tumefaciens
ref|WP_037115283.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    114   5e-26    Rhizobium
ref|WP_040489901.1|  3-beta hydroxysteroid dehydrogenase                114   5e-26    
ref|WP_037065538.1|  3-beta hydroxysteroid dehydrogenase                114   5e-26    Rhizobium leguminosarum
gb|KIE04291.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomple...    113   5e-26    Candidatus Jidaibacter acanthamoeba
ref|WP_039459013.1|  hypothetical protein                               113   5e-26    
ref|WP_037197314.1|  3-beta hydroxysteroid dehydrogenase                114   6e-26    Rhizobium
ref|WP_037079590.1|  3-beta hydroxysteroid dehydrogenase                114   6e-26    Rhizobium vignae
ref|WP_014249039.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      114   6e-26    Azospirillum lipoferum
ref|WP_007799503.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   6e-26    Rhizobium sp. CF122
gb|EAU41592.1|  putative oxidoreductase protein                         114   6e-26    Fulvimarina pelagi HTCC2506
ref|WP_002713828.1|  hypothetical protein                               113   7e-26    Afipia clevelandensis
ref|WP_007813453.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   8e-26    Rhizobium sp. CF142
ref|WP_008596326.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   8e-26    Nitratireductor pacificus
ref|WP_025602653.1|  3-beta hydroxysteroid dehydrogenase                113   8e-26    
ref|WP_012482360.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   8e-26    Rhizobium etli
ref|WP_037100746.1|  3-beta hydroxysteroid dehydrogenase                113   8e-26    Rhizobium alamii
ref|WP_037457841.1|  3-beta hydroxysteroid dehydrogenase                113   9e-26    Skermanella stibiiresistens
ref|WP_016735020.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   9e-26    Rhizobium phaseoli
ref|WP_009449172.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      113   1e-25    Nitratireductor indicus
ref|WP_010970802.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    113   1e-25    Agrobacterium tumefaciens complex
ref|WP_024317749.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    112   1e-25    Rhizobium favelukesii
ref|WP_027581325.1|  3-beta hydroxysteroid dehydrogenase                112   1e-25    Bradyrhizobium sp. Ai1a-2
gb|EGE59004.1|  putative NADH dehydrogenase/NADH dehydrogenase (u...    113   1e-25    Rhizobium etli CNPAF512
ref|WP_042689500.1|  3-beta hydroxysteroid dehydrogenase                112   1e-25    Azospirillum sp. B506
ref|WP_028034557.1|  3-beta hydroxysteroid dehydrogenase                112   2e-25    Chelativorans sp. J32
ref|WP_020011099.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    112   2e-25    Agrobacterium
ref|WP_012589203.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      112   2e-25    Methylocella silvestris
gb|EWM25568.1|  nadh dehydrogenase                                      111   3e-25    Nannochloropsis gaditana
ref|WP_037314823.1|  3-beta hydroxysteroid dehydrogenase                111   3e-25    Ruegeria halocynthiae
ref|WP_038686352.1|  3-beta hydroxysteroid dehydrogenase                111   3e-25    Rhizobium
ref|WP_043924186.1|  3-beta hydroxysteroid dehydrogenase                111   4e-25    Bradyrhizobiaceae bacterium SG-6C
ref|WP_025425609.1|  3-beta hydroxysteroid dehydrogenase                111   4e-25    Ensifer
ref|WP_022713397.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      111   4e-25    Rhizobium mongolense
ref|WP_020042805.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      111   4e-25    Salipiger mucosus
gb|KJF68958.1|  3-beta hydroxysteroid dehydrogenase                     111   4e-25    Rhizobium nepotum 39/7
ref|WP_007674128.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      111   5e-25    alpha proteobacterium BAL199
ref|WP_034804481.1|  3-beta hydroxysteroid dehydrogenase                111   5e-25    Ensifer
ref|WP_017966662.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      111   5e-25    Rhizobium leguminosarum
ref|WP_009604313.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   5e-25    SAR116 cluster alpha proteobacterium HIMB100
gb|EGP09699.1|  NAD-dependent epimerase/dehydratase                     111   6e-25    Bradyrhizobiaceae bacterium SG-6C
ref|WP_028745342.1|  3-beta hydroxysteroid dehydrogenase                110   6e-25    Rhizobium mesoamericanum
ref|WP_037114878.1|  3-beta hydroxysteroid dehydrogenase                110   6e-25    Rhizobium
ref|WP_039846586.1|  3-beta hydroxysteroid dehydrogenase                110   7e-25    
ref|WP_034992883.1|  3-beta hydroxysteroid dehydrogenase                110   7e-25    Beijerinckia mobilis
ref|WP_028164836.1|  3-beta hydroxysteroid dehydrogenase                110   7e-25    Bradyrhizobium elkanii
ref|WP_007763297.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   7e-25    Rhizobium sp. CF080
ref|WP_002717736.1|  hypothetical protein                               110   8e-25    Afipia felis
ref|WP_018116836.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    110   8e-25    Rhizobium
ref|WP_018855187.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   8e-25    Rhizobium sp. 42MFCr.1
ref|WP_018899326.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   8e-25    Rhizobium sp. 2MFCol3.1
ref|WP_017269127.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   8e-25    
ref|WP_011642056.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   9e-25    Maricaulis maris
ref|XP_005971320.1|  PREDICTED: NADH dehydrogenase [ubiquinone] 1...    110   1e-24    
ref|WP_038328123.1|  hypothetical protein                               110   1e-24    
ref|WP_044427727.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    Skermanella aerolata
ref|WP_008972707.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      110   1e-24    Bradyrhizobium sp. STM 3843
ref|WP_034514069.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    Agrobacterium rhizogenes
ref|WP_035581487.1|  3-beta hydroxysteroid dehydrogenase                110   1e-24    Hyphomonas jannaschiana
ref|WP_025029733.1|  3-beta hydroxysteroid dehydrogenase                107   1e-24    Nitratireductor aquibiodomus
ref|WP_027574763.1|  3-beta hydroxysteroid dehydrogenase                109   1e-24    Bradyrhizobium sp. WSM1743
ref|WP_003544730.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   1e-24    Rhizobium leguminosarum
ref|WP_034766843.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Hyphomonas
ref|WP_027674017.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Agrobacterium larrymoorei
ref|WP_037188156.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Rhizobium sp. YR519
ref|WP_037130671.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Rhizobium sp. CF394
ref|WP_036260034.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Methylocapsa aurea
ref|WP_034833137.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Inquilinus limosus
ref|WP_012040577.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   2e-24    Bradyrhizobium sp. BTAi1
ref|WP_003589083.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   2e-24    Rhizobium leguminosarum
ref|WP_023431376.1|  NAD-dependent epimerase/dehydratase                109   2e-24    Lutibaculum baratangense
ref|WP_026613537.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Sinorhizobium/Ensifer group
ref|WP_008524875.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      109   2e-24    Rhizobium sp. Pop5
ref|WP_028750945.1|  3-beta hydroxysteroid dehydrogenase                109   2e-24    Rhizobium leucaenae
ref|WP_007702838.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    109   3e-24    Rhizobium/Agrobacterium group
ref|WP_028096083.1|  3-beta hydroxysteroid dehydrogenase                108   3e-24    Dongia sp. URHE0060
ref|WP_015089185.1|  short chain dehydrogenase family protein           108   3e-24    Candidatus Endolissoclinum faulkneri
ref|WP_015241008.1|  putative nucleoside-diphosphate-sugar epimerase    108   3e-24    Sinorhizobium meliloti
ref|WP_033181246.1|  3-beta hydroxysteroid dehydrogenase                108   3e-24    Rhizobium leguminosarum
ref|WP_015338537.1|  NADH dehydrogenase                                 108   3e-24    Rhizobium tropici
ref|WP_038541460.1|  hypothetical protein                               108   3e-24    
ref|WP_018485276.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   3e-24    Rhizobium leguminosarum
gb|AIF81505.1|  NADH dehydrogenase (ubiquinone)                         108   3e-24    endosymbiont of Acanthamoeba sp. UWC8
ref|WP_035206671.1|  3-beta hydroxysteroid dehydrogenase                108   3e-24    Rhizobium/Agrobacterium group
ref|WP_025063871.1|  3-beta hydroxysteroid dehydrogenase                108   3e-24    Sulfitobacter guttiformis
ref|WP_037089422.1|  3-beta hydroxysteroid dehydrogenase                108   3e-24    Rhizobium/Agrobacterium group
ref|WP_024322235.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    Rhizobium leguminosarum
ref|WP_029873971.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    Rhizobium leguminosarum
ref|WP_044214941.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    Candidatus Endolissoclinum faulkneri
ref|WP_043615439.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    Ensifer sp. ZNC0028
ref|WP_034489081.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    Agrobacterium rhizogenes
ref|WP_006023269.1|  hypothetical protein                               108   4e-24    Afipia broomeae
ref|WP_012067733.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    108   4e-24    Sinorhizobium
ref|WP_037104352.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    Rhizobium sp. OK665
ref|WP_036515289.1|  3-beta hydroxysteroid dehydrogenase                108   4e-24    
ref|WP_024920181.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    108   4e-24    Afipia
gb|AHC74005.1|  NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex 9    108   4e-24    Candidatus Endolissoclinum faulkneri L5
ref|WP_020052566.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    Rhizobium leguminosarum
ref|WP_016552421.1|  NAD-dependent epimerase/dehydratase                108   5e-24    Rhizobium grahamii
ref|WP_025396797.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    Rhizobium leguminosarum
ref|WP_011049451.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    Ruegeria pomeroyi
ref|WP_008127552.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    Phyllobacterium sp. YR531
ref|WP_038460290.1|  hypothetical protein                               108   5e-24    
ref|WP_027510598.1|  3-beta hydroxysteroid dehydrogenase                108   5e-24    Rhizobium sullae
ref|WP_018495693.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    Rhizobium leguminosarum
ref|WP_013845015.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   5e-24    Rhizobiales
ref|WP_038005934.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    108   5e-24    Thalassobacter
ref|WP_029206735.1|  hypothetical protein                               106   6e-24    
ref|WP_027682062.1|  3-beta hydroxysteroid dehydrogenase                108   6e-24    Rhizobium leguminosarum
ref|WP_007007136.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      108   6e-24    Nitratireductor
ref|WP_028758381.1|  3-beta hydroxysteroid dehydrogenase                108   7e-24    Rhizobium
ref|WP_029061954.1|  3-beta hydroxysteroid dehydrogenase                107   7e-24    Labrenzia sp. DG1229
ref|WP_018069993.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   7e-24    Rhizobium leguminosarum
ref|WP_018447885.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   7e-24    Rhizobium
ref|WP_026622062.1|  3-beta hydroxysteroid dehydrogenase                107   8e-24    Ensifer sp. WSM1721
ref|WP_003514695.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   8e-24    Rhizobium/Agrobacterium group
ref|WP_013635346.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   8e-24    Agrobacterium
ref|WP_024576732.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    107   8e-24    Afipia
ref|WP_028286897.1|  3-beta hydroxysteroid dehydrogenase                107   9e-24    Pseudooceanicola nanhaiensis
ref|WP_009796496.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    Nitrobacter sp. Nb-311A
ref|WP_022702351.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    Pseudorhodobacter ferrugineus
ref|WP_017995781.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    Rhizobium leguminosarum
ref|WP_003503853.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    Agrobacterium tumefaciens
ref|WP_027669269.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    Rhizobium leguminosarum
ref|WP_028738716.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    Rhizobium
ref|WP_018093937.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_011650133.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_006933761.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_007633889.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_012759831.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_018244432.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|XP_005706979.1|  NADH dehydrogenase                                 107   1e-23    
ref|WP_011423696.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_006725017.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_028731730.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_003529781.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_004439463.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    107   1e-23    
ref|WP_027989547.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_017962916.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_021102609.1|  NAD-dependent epimerase/dehydratase                107   1e-23    
ref|WP_029959614.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_012654759.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_037247334.1|  3-beta hydroxysteroid dehydrogenase                107   1e-23    
ref|WP_010968509.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   1e-23    
ref|WP_028002286.1|  3-beta hydroxysteroid dehydrogenase                107   2e-23    
ref|WP_020809817.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   2e-23    
ref|WP_044538016.1|  3-beta hydroxysteroid dehydrogenase                107   2e-23    
ref|WP_025417572.1|  3-beta hydroxysteroid dehydrogenase                107   2e-23    
ref|WP_017990036.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      107   2e-23    
ref|WP_044564275.1|  3-beta hydroxysteroid dehydrogenase                107   2e-23    
ref|WP_025055104.1|  3-beta hydroxysteroid dehydrogenase                107   2e-23    
ref|WP_029011978.1|  3-beta hydroxysteroid dehydrogenase                106   2e-23    
ref|WP_008235576.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      106   2e-23    
ref|WP_036484855.1|  3-beta hydroxysteroid dehydrogenase                106   2e-23    
ref|WP_010442913.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      106   2e-23    
ref|WP_026872585.1|  3-beta hydroxysteroid dehydrogenase                106   2e-23    
ref|WP_003570910.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      106   2e-23    
ref|WP_013165148.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      106   2e-23    
ref|WP_019564453.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      106   2e-23    
ref|WP_008961605.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      106   2e-23    
ref|WP_031554361.1|  3-beta hydroxysteroid dehydrogenase                106   2e-23    
ref|WP_033315105.1|  3-beta hydroxysteroid dehydrogenase                106   3e-23    
ref|WP_038378462.1|  3-beta hydroxysteroid dehydrogenase                105   3e-23    
ref|WP_019960527.1|  hypothetical protein                               106   3e-23    
ref|WP_005979714.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      106   3e-23    
ref|WP_036306739.1|  3-beta hydroxysteroid dehydrogenase                106   3e-23    
gb|EEZ33718.1|  NAD-dependent epimerase/dehydratase                     106   3e-23    
ref|WP_009362855.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    106   3e-23    
ref|WP_026756898.1|  3-beta hydroxysteroid dehydrogenase                106   3e-23    
ref|WP_011083542.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    105   3e-23    
ref|WP_018323842.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      105   3e-23    
ref|WP_004108248.1|  putative NADH dehydrogenase/NADH dehydrogena...    105   4e-23    
ref|WP_028172481.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    105   4e-23    
ref|WP_012384305.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      105   4e-23    
ref|WP_018269295.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      105   4e-23    
ref|WP_035219308.1|  3-beta hydroxysteroid dehydrogenase                105   4e-23    
ref|WP_028011551.1|  3-beta hydroxysteroid dehydrogenase                105   4e-23    
ref|WP_012520729.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      105   4e-23    
ref|WP_043140566.1|  3-beta hydroxysteroid dehydrogenase                105   4e-23    
gb|KJF75273.1|  3-beta hydroxysteroid dehydrogenase                     105   5e-23    
ref|WP_024338622.1|  3-beta hydroxysteroid dehydrogenase                105   5e-23    
ref|WP_007206117.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      105   5e-23    
ref|WP_037377954.1|  3-beta hydroxysteroid dehydrogenase                105   6e-23    
ref|WP_028133575.1|  3-beta hydroxysteroid dehydrogenase                105   6e-23    
ref|WP_031269610.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    105   6e-23    
ref|WP_034739428.1|  3-beta hydroxysteroid dehydrogenase                105   7e-23    
gb|ERP88260.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase           105   7e-23    
ref|WP_003520119.1|  NADH-ubiquinone oxidoreductase 39 kd subunit       105   7e-23    
ref|WP_026607026.1|  3-beta hydroxysteroid dehydrogenase                105   8e-23    
ref|WP_006612334.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      104   8e-23    
ref|WP_018455737.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      104   8e-23    
ref|WP_037125547.1|  3-beta hydroxysteroid dehydrogenase                104   9e-23    
ref|WP_008511319.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    104   1e-22    
ref|WP_043231919.1|  3-beta hydroxysteroid dehydrogenase                104   1e-22    
gb|KFC75616.1|  Dehydrogenase                                           104   1e-22    
ref|WP_028179136.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    104   1e-22    
ref|WP_024587909.1|  3-beta hydroxysteroid dehydrogenase                104   1e-22    
ref|WP_026381421.1|  3-beta hydroxysteroid dehydrogenase                104   1e-22    
ref|WP_024846278.1|  3-beta hydroxysteroid dehydrogenase                104   1e-22    
ref|WP_043773282.1|  3-beta hydroxysteroid dehydrogenase                104   1e-22    
ref|WP_009502685.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      104   1e-22    
ref|WP_006192257.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    104   1e-22    
ref|WP_012180246.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      104   1e-22    
gb|EEY31663.1|  NAD-dependent epimerase/dehydratase                     104   1e-22    
ref|WP_003583713.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      104   1e-22    
ref|WP_040408243.1|  3-beta hydroxysteroid dehydrogenase                104   1e-22    
ref|WP_037420965.1|  3-beta hydroxysteroid dehydrogenase                104   1e-22    
gb|KEO64026.1|  3-beta hydroxysteroid dehydrogenase                     104   1e-22    
ref|WP_025198912.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    104   1e-22    
ref|WP_002968608.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    104   1e-22    
ref|WP_012091433.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      104   1e-22    
ref|WP_018389387.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      104   1e-22    
gb|EEP62440.1|  NAD-dependent epimerase/dehydratase                     104   2e-22    
ref|WP_023081286.1|  hypothetical protein                               103   2e-22    
gb|EEH13036.1|  NAD-dependent epimerase/dehydratase                     104   2e-22    
ref|WP_037157381.1|  3-beta hydroxysteroid dehydrogenase                103   2e-22    
ref|WP_006281113.1|  hypothetical protein                               103   2e-22    
ref|WP_006175132.1|  MULTISPECIES: hypothetical protein                 103   2e-22    
ref|WP_011995111.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   2e-22    
gb|EEX89282.1|  NAD-dependent epimerase/dehydratase                     103   2e-22    
ref|WP_022712465.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   2e-22    
ref|WP_027566186.1|  3-beta hydroxysteroid dehydrogenase                103   2e-22    
ref|WP_029929346.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    103   2e-22    
ref|WP_039712493.1|  3-beta hydroxysteroid dehydrogenase                103   2e-22    
ref|WP_009338703.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   2e-22    
ref|WP_037482058.1|  3-beta hydroxysteroid dehydrogenase                103   2e-22    
dbj|BAL73348.1|  oxidoreductase                                         102   2e-22    
ref|WP_010659406.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   2e-22    
ref|WP_020809807.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   2e-22    
ref|WP_035704110.1|  3-beta hydroxysteroid dehydrogenase                103   2e-22    
ref|WP_008262623.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   2e-22    
ref|WP_018323467.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   2e-22    
ref|WP_037436452.1|  3-beta hydroxysteroid dehydrogenase                101   2e-22    
ref|WP_027514755.1|  3-beta hydroxysteroid dehydrogenase                103   2e-22    
ref|WP_027235881.1|  3-beta hydroxysteroid dehydrogenase                103   3e-22    
ref|WP_011540134.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
ref|WP_007088365.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
gb|KJC42006.1|  3-beta hydroxysteroid dehydrogenase                     103   3e-22    
ref|WP_034826583.1|  3-beta hydroxysteroid dehydrogenase                103   3e-22    
ref|WP_023786056.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
gb|KCZ50818.1|  hypothetical protein HY2_13305                          103   3e-22    
ref|WP_011909724.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
ref|WP_018065082.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
ref|WP_004856191.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
ref|WP_007603966.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
ref|WP_008757424.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   3e-22    
ref|WP_044586365.1|  3-beta hydroxysteroid dehydrogenase                103   3e-22    
ref|WP_011582912.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      103   4e-22    
ref|WP_027230840.1|  3-beta hydroxysteroid dehydrogenase                102   4e-22    
ref|WP_039533427.1|  3-beta hydroxysteroid dehydrogenase                102   4e-22    
ref|WP_026942916.1|  3-beta hydroxysteroid dehydrogenase                102   4e-22    
ref|WP_018235129.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   4e-22    
ref|WP_043844369.1|  3-beta hydroxysteroid dehydrogenase                102   4e-22    
ref|WP_041747949.1|  3-beta hydroxysteroid dehydrogenase                102   4e-22    
ref|WP_040850050.1|  3-beta hydroxysteroid dehydrogenase                102   4e-22    
ref|WP_014766773.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   4e-22    
ref|WP_037267370.1|  3-beta hydroxysteroid dehydrogenase                102   4e-22    
ref|WP_006133507.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...    102   4e-22    
ref|WP_007255607.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   5e-22    
ref|WP_040651183.1|  3-beta hydroxysteroid dehydrogenase                102   5e-22    
gb|EAQ24510.1|  NADH ubiquinone oxidoreductase, putative                102   5e-22    
ref|WP_034853660.1|  3-beta hydroxysteroid dehydrogenase                102   5e-22    
ref|WP_007552271.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   5e-22    
ref|WP_025090796.1|  3-beta hydroxysteroid dehydrogenase                102   5e-22    
ref|WP_021587114.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   5e-22    
emb|CEF49462.1|  unnamed protein product                                102   5e-22    
ref|WP_006193633.1|  hypothetical protein                               102   5e-22    
gb|EEW89461.1|  NADH-ubiquinone oxidoreductase                          102   5e-22    
ref|WP_023080904.1|  hypothetical protein                               102   5e-22    
ref|WP_007118555.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   5e-22    
ref|WP_027543723.1|  3-beta hydroxysteroid dehydrogenase                102   6e-22    
ref|WP_018645046.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   6e-22    
ref|WP_008195775.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   6e-22    
ref|WP_014330758.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   7e-22    
ref|WP_012710133.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   7e-22    
ref|WP_037397392.1|  3-beta hydroxysteroid dehydrogenase                100   8e-22    
ref|WP_037450866.1|  3-beta hydroxysteroid dehydrogenase                102   8e-22    
ref|WP_028337947.1|  3-beta hydroxysteroid dehydrogenase                102   9e-22    
ref|WP_021237045.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      102   9e-22    
gb|EEQ96501.1|  NAD-dependent epimerase/dehydratase                     102   9e-22    
dbj|GAK70411.1|  putative NADH dehydrogenase                            102   9e-22    
gb|KJC44605.1|  3-beta hydroxysteroid dehydrogenase                     101   1e-21    
ref|WP_044830089.1|  3-beta hydroxysteroid dehydrogenase                102   1e-21    
ref|WP_007811933.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
ref|WP_007876424.1|  NAD-dependent epimerase/dehydratase                101   1e-21    
ref|WP_006472285.1|  NAD-dependent epimerase/dehydratase                101   1e-21    
ref|WP_019172720.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
ref|WP_023663859.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
ref|WP_009466772.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
ref|WP_035308782.1|  3-beta hydroxysteroid dehydrogenase                101   1e-21    
ref|WP_014876487.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
gb|EJZ35836.1|  oxidoreductase                                          101   1e-21    
ref|WP_013300115.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
ref|WP_039185049.1|  3-beta hydroxysteroid dehydrogenase                101   1e-21    
ref|WP_008143940.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
ref|WP_037431314.1|  3-beta hydroxysteroid dehydrogenase                101   1e-21    
ref|WP_023035739.1|  hypothetical protein                               101   1e-21    
ref|WP_008035619.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      101   1e-21    
ref|WP_028155473.1|  3-beta hydroxysteroid dehydrogenase                101   2e-21    
ref|WP_037205228.1|  3-beta hydroxysteroid dehydrogenase                101   2e-21    
ref|WP_037470301.1|  3-beta hydroxysteroid dehydrogenase                100   2e-21    
ref|WP_004858128.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      100   2e-21    
ref|WP_027528261.1|  3-beta hydroxysteroid dehydrogenase                100   2e-21    
ref|WP_029077220.1|  3-beta hydroxysteroid dehydrogenase                100   2e-21    
ref|WP_007598555.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      100   2e-21    
gb|ADE39486.1|  NAD-dependent epimerase/dehydratase                     100   2e-21    
gb|ABL97602.1|  NADH-ubiquinone oxidoreductase                          100   2e-21    
ref|WP_041861232.1|  3-beta hydroxysteroid dehydrogenase                100   2e-21    
ref|WP_012493885.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      100   2e-21    
ref|WP_035536720.1|  3-beta hydroxysteroid dehydrogenase                100   3e-21    
ref|WP_009570312.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase      100   3e-21    
ref|WP_039192493.1|  3-beta hydroxysteroid dehydrogenase                100   3e-21    
ref|WP_028480647.1|  3-beta hydroxysteroid dehydrogenase                100   3e-21    
ref|WP_027151497.1|  3-beta hydroxysteroid dehydrogenase                100   3e-21    
ref|WP_029204950.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...    100   3e-21    
ref|WP_027283955.1|  3-beta hydroxysteroid dehydrogenase                100   3e-21    
gb|KDA03333.1|  putative NADH-quinone oxidoreductase                    100   3e-21    
ref|WP_022571477.1|  putative nucleoside-diphosphate sugar epimerase    100   4e-21    
gb|KIX16649.1|  3-beta hydroxysteroid dehydrogenase                     100   4e-21    
ref|XP_005537134.1|  NADH dehydrogenase I alpha subcomplex 9, mit...    100   4e-21    
ref|WP_024708865.1|  3-beta hydroxysteroid dehydrogenase                100   4e-21    
ref|WP_033963518.1|  3-beta hydroxysteroid dehydrogenase                100   4e-21    
ref|WP_036556342.1|  3-beta hydroxysteroid dehydrogenase              99.8    5e-21    
ref|WP_025311295.1|  3-beta hydroxysteroid dehydrogenase              99.8    5e-21    
ref|WP_035250386.1|  3-beta hydroxysteroid dehydrogenase              99.8    5e-21    
ref|WP_019977208.1|  hypothetical protein                             99.8    5e-21    
ref|WP_019015136.1|  hypothetical protein                             99.8    5e-21    
ref|WP_027842051.1|  3-beta hydroxysteroid dehydrogenase              99.8    5e-21    
ref|WP_039147810.1|  3-beta hydroxysteroid dehydrogenase              99.8    5e-21    
ref|WP_013950968.1|  NADH dehydrogenase subunit I                     99.4    5e-21    
ref|WP_028092804.1|  3-beta hydroxysteroid dehydrogenase              99.8    5e-21    
ref|WP_040974907.1|  3-beta hydroxysteroid dehydrogenase              99.8    6e-21    
gb|AFK52022.1|  NADH-ubiquinone oxidoreductase 39 kDa subunit pre...  99.8    6e-21    
ref|WP_027136018.1|  hypothetical protein                             99.4    6e-21    
ref|WP_026480477.1|  3-beta hydroxysteroid dehydrogenase              99.8    6e-21    
ref|WP_005618365.1|  3-beta hydroxysteroid dehydrogenase/isomerase    99.8    6e-21    
ref|WP_023796786.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    99.4    6e-21    
ref|WP_011338750.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    99.4    6e-21    
ref|WP_009563193.1|  MULTISPECIES: 3-beta-hydroxy-delta(5)-steroi...  99.4    6e-21    
ref|WP_043871301.1|  3-beta hydroxysteroid dehydrogenase              99.4    6e-21    
ref|WP_041605182.1|  3-beta hydroxysteroid dehydrogenase              99.4    6e-21    
ref|WP_020057796.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    99.4    6e-21    
gb|ACM02407.1|  NAD-dependent epimerase/dehydratase                   99.4    6e-21    
ref|WP_017505465.1|  3-beta-hydroxy-delta(5)-steroid dehydrogenase    99.4    7e-21    
ref|WP_029207369.1|  hypothetical protein                             99.4    7e-21    
ref|WP_033070199.1|  3-beta hydroxysteroid dehydrogenase              99.4    7e-21    



>ref|XP_011080124.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Sesamum indicum]
Length=400

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATI++PA MIGTEDR+LNPWA FAK Y FLPL+G G+TKIQPVYV DVASAI+A+
Sbjct  207  RELPEATIMRPAAMIGTEDRVLNPWAHFAKKYSFLPLLGDGSTKIQPVYVVDVASAIVAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGPEI+T+HQLAELMYD+IREWP YVKVPFPIAKAIATPRE+LL K
Sbjct  267  LKDDGSSMGKVYELGGPEIYTLHQLAELMYDMIREWPHYVKVPFPIAKAIATPREVLLNK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFP+PTP+IFNLD IEAL+TDTLVSENAL FEDLGIVP KLKGYPVE+LIQYRKGGPQY
Sbjct  327  VPFPMPTPTIFNLDQIEALSTDTLVSENALKFEDLGIVPCKLKGYPVEFLIQYRKGGPQY  386

Query  190  GSTVSEKISPDSY  152
            GSTVSEK++P S+
Sbjct  387  GSTVSEKVTPQSW  399



>gb|KHG08643.1| hypothetical protein F383_12346 [Gossypium arboreum]
Length=370

 Score =   344 bits (882),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQPVYV DVASAI+A+
Sbjct  177  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQPVYVVDVASAIVAA  236

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV VP P+AKAIA PRE+LLKK
Sbjct  237  LKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVAKAIAMPREVLLKK  296

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  297  VPFPLPNPDIFNLDQIHAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGPQF  356

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++PDSYP
Sbjct  357  GSTVSEKVNPDSYP  370



>gb|KJB42336.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=345

 Score =   343 bits (879),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQPVYV DVASAI+A+
Sbjct  152  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQPVYVVDVASAIVAA  211

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PIAKAIA PRE+LLKK
Sbjct  212  LKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKAIAMPREVLLKK  271

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  272  VPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGPQF  331

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++PDSYP
Sbjct  332  GSTVSEKVNPDSYP  345



>gb|KJB42339.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=356

 Score =   343 bits (879),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQPVYV DVASAI+A+
Sbjct  163  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQPVYVVDVASAIVAA  222

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PIAKAIA PRE+LLKK
Sbjct  223  LKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKAIAMPREVLLKK  282

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  283  VPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGPQF  342

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++PDSYP
Sbjct  343  GSTVSEKVNPDSYP  356



>ref|XP_007050148.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX94305.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 4 [Theobroma 
cacao]
Length=313

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT++KPA+MIGTEDRI+N WAQF K Y FLPLIG G+TKIQPVYV DVASAI+A+
Sbjct  120  RELPEATVMKPAIMIGTEDRIMNRWAQFVKKYSFLPLIGDGSTKIQPVYVVDVASAIVAA  179

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEIFTVH+LAELM+D+IREWPRYVKVP P+AKAIA PRE+LLKK
Sbjct  180  LKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPVAKAIAMPREVLLKK  239

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  240  VPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEYLIQYRKGGPQF  299

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++P+ +P
Sbjct  300  GSTVSEKVNPEYWP  313



>gb|KJB42335.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=400

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQPVYV DVASAI+A+
Sbjct  207  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQPVYVVDVASAIVAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PIAKAIA PRE+LLKK
Sbjct  267  LKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKAIAMPREVLLKK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  327  VPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGPQF  386

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++PDSYP
Sbjct  387  GSTVSEKVNPDSYP  400



>emb|CDP03802.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 16/210 (8%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEAT+++PA MIGTEDR+LNPWA F KNYGFLPLIG GTTKIQPVYV DVASAI+A+
Sbjct  209  QEFPEATVMRPAAMIGTEDRVLNPWAHFVKNYGFLPLIGEGTTKIQPVYVIDVASAIVAA  268

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAK------------  407
            LKDDG+ MGKVYELGGPEIFTVH+LAELM+DVIREWPRYVK+PFP+AK            
Sbjct  269  LKDDGSCMGKVYELGGPEIFTVHELAELMFDVIREWPRYVKIPFPVAKASYIPLSFCCYS  328

Query  406  ----AIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKG  239
                AIA PRE+LLKKVPFP+PTPSIFNLD IEALTTDTLVS++ALTF+DLGI PHKLKG
Sbjct  329  CLLSAIAMPREVLLKKVPFPMPTPSIFNLDAIEALTTDTLVSKDALTFDDLGIAPHKLKG  388

Query  238  YPVEYLIQYRKGGPQYGSTVSEKISPDSYP  149
            YPVE+LIQYRKGGP+YGSTVSEK+SP+S+P
Sbjct  389  YPVEFLIQYRKGGPKYGSTVSEKVSPESWP  418



>ref|XP_003542442.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Glycine max]
 gb|KHN48948.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Glycine soja]
Length=396

 Score =   342 bits (876),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATILKPAVMIGTEDRILNPWA FAK YGFLPL G G+TKIQPVYV DVA+A+ + 
Sbjct  203  RELPEATILKPAVMIGTEDRILNPWAHFAKKYGFLPLFGDGSTKIQPVYVIDVAAALTSL  262

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPEIFTVH+LA++M+D IREWPRYVKVPFPIAKA+ATPRE+LL K
Sbjct  263  LKDDGTSMGKIYELGGPEIFTVHELADVMFDTIREWPRYVKVPFPIAKALATPREILLNK  322

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P I NLD I+ALTTDT+VSENALTF DLGIVPHKLKGYP+E+LI YRKGGPQ+
Sbjct  323  VPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKGYPIEFLISYRKGGPQF  382

Query  190  GSTVSEKISPDSYP  149
            GST+SE+++PDS+P
Sbjct  383  GSTISERVTPDSWP  396



>ref|XP_007050147.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX94304.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=392

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT++KPA+MIGTEDRI+N WAQF K Y FLPLIG G+TKIQPVYV DVASAI+A+
Sbjct  199  RELPEATVMKPAIMIGTEDRIMNRWAQFVKKYSFLPLIGDGSTKIQPVYVVDVASAIVAA  258

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEIFTVH+LAELM+D+IREWPRYVKVP P+AKAIA PRE+LLKK
Sbjct  259  LKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPVAKAIAMPREVLLKK  318

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  319  VPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEYLIQYRKGGPQF  378

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++P+ +P
Sbjct  379  GSTVSEKVNPEYWP  392



>ref|XP_007050145.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007050146.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94302.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX94303.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=400

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT++KPA+MIGTEDRI+N WAQF K Y FLPLIG G+TKIQPVYV DVASAI+A+
Sbjct  207  RELPEATVMKPAIMIGTEDRIMNRWAQFVKKYSFLPLIGDGSTKIQPVYVVDVASAIVAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEIFTVH+LAELM+D+IREWPRYVKVP P+AKAIA PRE+LLKK
Sbjct  267  LKDDGTSMGKAYELGGPEIFTVHELAELMHDMIREWPRYVKVPLPVAKAIAMPREVLLKK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  327  VPFPLPNPDIFNLDQIHAFATDTIVSENALTFTDLGIVPHKLKGYPVEYLIQYRKGGPQF  386

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++P+ +P
Sbjct  387  GSTVSEKVNPEYWP  400



>ref|XP_007144408.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
 gb|ESW16402.1| hypothetical protein PHAVU_007G153700g [Phaseolus vulgaris]
Length=394

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATILKPAVMIGTEDRILNPWA FAK Y F+PL G G+TKIQPVYV DVA+A+   
Sbjct  203  RELPEATILKPAVMIGTEDRILNPWAHFAKKYSFIPLFGNGSTKIQPVYVVDVAAALTTV  262

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGP+IFTVH LAELMY+ IREWPRYVKVPFPIAKA+ATPRE+LL K
Sbjct  263  LKDDGTSMGKTYELGGPDIFTVHDLAELMYETIREWPRYVKVPFPIAKALATPREILLNK  322

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I+ALTTDT+VSENALTF DLGIVPHKLKGYP+E+LI YRKGGPQ+
Sbjct  323  VPFPLPNPDIFNLDKIQALTTDTIVSENALTFNDLGIVPHKLKGYPIEFLISYRKGGPQF  382

Query  190  GSTVSEKISPDS  155
            GST+SE+ISPD+
Sbjct  383  GSTISERISPDA  394



>ref|XP_010264829.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
 ref|XP_010264830.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nelumbo nucifera]
Length=397

 Score =   340 bits (872),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATI++PAVMIGTEDRILN WAQF K + FLPL+G G+T+IQPVYV DVA+AI+A+
Sbjct  205  RELPEATIMRPAVMIGTEDRILNRWAQFVKKWSFLPLVGDGSTRIQPVYVVDVAAAILAA  264

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGKVYELGGPE+FTVH+LAELM+D IREWPRYVKVPFPIAKA+A+PRE LL K
Sbjct  265  LKDDGTSMGKVYELGGPEVFTVHELAELMFDTIREWPRYVKVPFPIAKALASPREFLLNK  324

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP IFNLD I ALT DT+VSENALTF DLGIVPHKLKGYPVEYLI YRKGGPQ+
Sbjct  325  VPFPLPTPDIFNLDQINALTVDTVVSENALTFNDLGIVPHKLKGYPVEYLISYRKGGPQF  384

Query  190  GSTVSEKISPD  158
            GST+SE++SPD
Sbjct  385  GSTISERVSPD  395



>gb|ACJ84721.1| unknown [Medicago truncatula]
 gb|AFK38059.1| unknown [Medicago truncatula]
 gb|KEH42458.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Medicago truncatula]
Length=396

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATI KPAVMIGTEDRILN WA FAK YGF+PL+G G TKIQPVYV DVA+A+  +
Sbjct  203  RELPEATIFKPAVMIGTEDRILNRWAHFAKKYGFIPLMGNGNTKIQPVYVVDVAAALTTA  262

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPEIFTVHQLAE+MYDVIREWPRYV VP PIAKA+ATPREL L K
Sbjct  263  LKDDGTSMGKIYELGGPEIFTVHQLAEIMYDVIREWPRYVNVPLPIAKALATPRELFLNK  322

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            +PFPLP P +FNLD I A   DT+VSENALTF DLGIVPHKLKGYP+E+LIQYRKGGPQ+
Sbjct  323  LPFPLPKPEMFNLDQIHAYAADTVVSENALTFNDLGIVPHKLKGYPIEFLIQYRKGGPQF  382

Query  190  GSTVSEKISPDSYP  149
            GST+SEK+SPD++P
Sbjct  383  GSTISEKVSPDAWP  396



>ref|XP_004247128.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Solanum lycopersicum]
Length=401

 Score =   338 bits (867),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATIL+P+VMIGTEDRILNPWA FAK YGFLPLIGGG+TKIQPV+V DVASAI++S
Sbjct  208  RELPEATILRPSVMIGTEDRILNPWAFFAKKYGFLPLIGGGSTKIQPVFVADVASAIVSS  267

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKD+GTSMGKVYELGGP+I+T+H LAELM+D+IREWPRYV VPFPIAKAIA+PRE LL K
Sbjct  268  LKDNGTSMGKVYELGGPDIYTMHDLAELMFDMIREWPRYVNVPFPIAKAIASPREFLLNK  327

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VP P+P P+IFNLD I+AL TD +VS++ALTFEDLG+ PHK+KGYPVE+LIQYRKGGP Y
Sbjct  328  VPTPMPVPTIFNLDAIKALATDNVVSKDALTFEDLGLAPHKVKGYPVEFLIQYRKGGPNY  387

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK+SP+SYP
Sbjct  388  GSTVSEKMSPESYP  401



>ref|XP_010548735.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTEDRILNPWAQF K Y FLPLIG GTTKIQPVYV DVA A+I +LK
Sbjct  211  LPEATIMRPATMIGTEDRILNPWAQFVKKYSFLPLIGDGTTKIQPVYVVDVAGAVIQALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG SMGK YELGGPE+FT+H+LAELMYD+IREWPRYVKVPFPIAKA+A+PRE++L KVP
Sbjct  271  DDGISMGKTYELGGPEVFTIHELAELMYDMIREWPRYVKVPFPIAKALASPREVMLNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLPTP IFNLD I ALTTDTLVS+NALTF+DLGIVPHKLKGYPVEYLIQYRKGGPQ+GS
Sbjct  331  FPLPTPQIFNLDQINALTTDTLVSDNALTFQDLGIVPHKLKGYPVEYLIQYRKGGPQFGS  390

Query  184  TVSEKISPDSYP  149
            TVSEK+  D  P
Sbjct  391  TVSEKVPTDFDP  402



>ref|XP_006355892.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Solanum tuberosum]
Length=401

 Score =   337 bits (865),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATI++PAVMIGTEDRILNPWA FAK YGFLPLIGGG+TKIQPV+V DVASAI++S
Sbjct  208  RELPEATIMRPAVMIGTEDRILNPWAFFAKKYGFLPLIGGGSTKIQPVFVADVASAIVSS  267

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKD+GTSMGKVYELGGP+I+T+H LAELM+D+IREWPRYV VPFPIAKAIA+PRE LL K
Sbjct  268  LKDNGTSMGKVYELGGPDIYTMHDLAELMFDMIREWPRYVNVPFPIAKAIASPREFLLNK  327

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VP P+P P+IFNLD I+A  TD +VS++ALTFEDLG+ PHK+KGYPVE+LIQYRKGGP Y
Sbjct  328  VPTPMPVPTIFNLDAIKAFATDNIVSKDALTFEDLGLAPHKVKGYPVEFLIQYRKGGPNY  387

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK+SP+SYP
Sbjct  388  GSTVSEKMSPESYP  401



>ref|XP_010036149.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Eucalyptus grandis]
 gb|KCW47684.1| hypothetical protein EUGRSUZ_K01422 [Eucalyptus grandis]
Length=394

 Score =   337 bits (863),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATIL+PAVMIGTEDRILN WA FAK Y FLPLIGGG+TKIQPVYV DVA+A++++
Sbjct  201  RELPEATILRPAVMIGTEDRILNTWAHFAKKYSFLPLIGGGSTKIQPVYVFDVAAAVVSA  260

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGK+YELGGP++FTV +LAELMYD+IREWPRYV VPFPIAKA A PRELLLKK
Sbjct  261  LKDDGSSMGKIYELGGPDVFTVRELAELMYDMIREWPRYVSVPFPIAKAFAMPRELLLKK  320

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I ALT DT+VS++ALTF DLGIVPHK+KGYPVE+LI YRKGGP +
Sbjct  321  VPFPLPNPDIFNLDQINALTEDTVVSKDALTFNDLGIVPHKVKGYPVEFLISYRKGGPNF  380

Query  190  GSTVSEKISPDSYP  149
            GSTVSE++SPD+YP
Sbjct  381  GSTVSERVSPDAYP  394



>gb|ACU23211.1| unknown [Glycine max]
Length=396

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATILKPAVMIGTEDRILNPWA FAK YGFLPL G G+TKIQPVYV DVA+A+ + 
Sbjct  203  RELPEATILKPAVMIGTEDRILNPWAHFAKKYGFLPLFGDGSTKIQPVYVIDVAAALTSL  262

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPEIFTVH+LA++M+D IREWPRYVKVPFPIAKA+ATPRE+LL K
Sbjct  263  LKDDGTSMGKIYELGGPEIFTVHELADVMFDTIREWPRYVKVPFPIAKALATPREILLNK  322

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P I NLD I+ALTTDT+VSENALTF DLGIVPHKLK YP+E+LI YRKGGPQ+
Sbjct  323  VPFPLPVPEILNLDKIQALTTDTVVSENALTFNDLGIVPHKLKEYPIEFLISYRKGGPQF  382

Query  190  GSTVSEKISPDSYP  149
            GST+SE+++PD +P
Sbjct  383  GSTISERVTPDFWP  396



>ref|XP_008459972.1| PREDICTED: LOW QUALITY PROTEIN: NADH dehydrogenase [ubiquinone] 
1 alpha subcomplex subunit 9, mitochondrial [Cucumis melo]
Length=402

 Score =   336 bits (862),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +  PEATIL+PA MIGTEDRI+NPWA F K YGF+PL G G+TKIQPVYV DVA+ I+++
Sbjct  209  KAFPEATILRPATMIGTEDRIMNPWAHFLKKYGFIPLFGDGSTKIQPVYVVDVAAGIVSA  268

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTS+GKVYELGGPEI+TVH LAELMYD+IREWPRY+KVPFPIAKAIATPRE+LL K
Sbjct  269  LKDDGTSIGKVYELGGPEIYTVHDLAELMYDMIREWPRYLKVPFPIAKAIATPREILLNK  328

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I ALT DT+VSE ALTF DLGI+PHKLKGYP+E+LI YRKGGPQ+
Sbjct  329  VPFPLPTPSIFNLDQILALTQDTVVSEKALTFNDLGIIPHKLKGYPIEFLISYRKGGPQF  388

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK+SPDS+P
Sbjct  389  GSTVSEKVSPDSFP  402



>gb|EYU46388.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
 gb|EYU46389.1| hypothetical protein MIMGU_mgv1a007681mg [Erythranthe guttata]
Length=399

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT+++PAVMIGTEDRILNPWA FAK Y F+PL+G G+TKIQPVYV DVASAIIA+
Sbjct  207  RELPEATVVRPAVMIGTEDRILNPWAHFAKKYSFIPLMGDGSTKIQPVYVVDVASAIIAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGP+I+T+HQLAELM++ IRE+P YVK+PFPIAKAI+TPRELLLKK
Sbjct  267  LKDDGSSMGKVYELGGPDIYTMHQLAELMFETIREYPHYVKIPFPIAKAISTPRELLLKK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P+IFNLD+IE+L+TDT+VSENALTFEDLGI P KLKGYPVE+LIQYRKGGP Y
Sbjct  327  VPFPLPVPTIFNLDLIESLSTDTVVSENALTFEDLGIAPRKLKGYPVEFLIQYRKGGPNY  386

Query  190  GSTVSEKISP  161
            GSTVSEKISP
Sbjct  387  GSTVSEKISP  396



>gb|AFK48198.1| unknown [Lotus japonicus]
Length=396

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATILKPA MIGTEDRILN WA FAK Y FLPL G G+TKIQPVYV DVA+A+ A+
Sbjct  203  RELPEATILKPATMIGTEDRILNRWAHFAKKYSFLPLFGDGSTKIQPVYVVDVANALTAA  262

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGKVYELGGPE++T+H+LAELMY+VIREWPRYVKVPFPIAKA+A+PRELL+ K
Sbjct  263  LKDDGTSMGKVYELGGPEVYTMHELAELMYEVIREWPRYVKVPFPIAKALASPRELLINK  322

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            +PFPLPTP+IFNLD I ALTTDT+VSENALTF DLGI P KLKGYP E+LI YRKGGPQ+
Sbjct  323  LPFPLPTPNIFNLDQIRALTTDTVVSENALTFNDLGINPQKLKGYPTEFLISYRKGGPQF  382

Query  190  GSTVSEKISPDSYP  149
            GST+SE++SPD++P
Sbjct  383  GSTISERVSPDAWP  396



>ref|XP_010936110.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            R  PEATI+KP +MIGTEDRILN WAQFAK + FLPLIG G+TKIQPVYV DVA+AIIAS
Sbjct  206  RVFPEATIMKPGIMIGTEDRILNRWAQFAKKWSFLPLIGDGSTKIQPVYVVDVAAAIIAS  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGK+YELGGPE+FTVHQLAELMYD+IREWPRYVK+PFPIAKA+A+PRE LLKK
Sbjct  266  LKDDGSSMGKIYELGGPELFTVHQLAELMYDMIREWPRYVKIPFPIAKALASPREFLLKK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I ALT DTLVSENALTF DLGIVPHKLKGYPVEYLI YRKGGP Y
Sbjct  326  VPFPLPNPDIFNLDQINALTVDTLVSENALTFSDLGIVPHKLKGYPVEYLICYRKGGPAY  385

Query  190  GSTVSEKISPDSY  152
            GSTVSE+++   +
Sbjct  386  GSTVSERVTGSEF  398



>ref|XP_002271401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Vitis vinifera]
 emb|CBI37199.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATI++PAVMIGTEDRILN WAQFAK YGFLPL G G+TK QPVYV DVA+AI+A+
Sbjct  206  RELPEATIMRPAVMIGTEDRILNRWAQFAKKYGFLPLYGDGSTKFQPVYVIDVAAAIMAA  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGKVYELGGPEIFT+H+LA +MYD IREWPRYVKVPFPIAKA+  PRE+LL K
Sbjct  266  LKDDGTSMGKVYELGGPEIFTMHELAAVMYDTIREWPRYVKVPFPIAKAMTLPREILLNK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP +FNLD+I A T+DT+VSENALTF+DLGIVPHKLKGYP+E+L+ YRKGGPQ+
Sbjct  326  VPFPLPTPGLFNLDLINAFTSDTVVSENALTFDDLGIVPHKLKGYPIEFLLSYRKGGPQF  385

Query  190  GSTVSEKISPDSYP  149
            GST+SE++ P+++P
Sbjct  386  GSTISERVDPEAFP  399



>ref|XP_009586626.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586627.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586628.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586629.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009586630.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana tomentosiformis]
Length=397

 Score =   335 bits (859),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PAVMIGTEDRILNPWA FAK YGF+PL G G+TKIQPV+V DVASAI+ASLK
Sbjct  206  LPEATIMRPAVMIGTEDRILNPWAHFAKKYGFIPLFGDGSTKIQPVFVADVASAIVASLK  265

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D+G SMGKVYELGGP+++T+H+LAELM+D+IREWPRYV VPFPIAKAIA+PRE LLKKVP
Sbjct  266  DNGISMGKVYELGGPDVYTMHELAELMFDMIREWPRYVNVPFPIAKAIASPREFLLKKVP  325

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
             P+PTP+IFNLD IEA+TTD +VS++ALTFEDLG+ PHK+KGYPVE+LIQYRKGGP YGS
Sbjct  326  APMPTPTIFNLDAIEAITTDNIVSKDALTFEDLGLAPHKVKGYPVEFLIQYRKGGPNYGS  385

Query  184  TVSEKISPDSYP  149
            TVSE++SP+SYP
Sbjct  386  TVSERVSPESYP  397



>ref|XP_011024495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Populus euphratica]
Length=399

 Score =   334 bits (856),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT++KPAVMIGTEDRILN WA FAK Y FLPLIG G+TKIQPVYV DVA+AIIA+
Sbjct  206  REMPEATVMKPAVMIGTEDRILNRWAHFAKKYSFLPLIGDGSTKIQPVYVVDVAAAIIAA  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGPEIFTVH+LA+LMYDVIREWPRYVKVPFPIAKA+ATPR +L+ K
Sbjct  266  LKDDGSSMGKVYELGGPEIFTVHELADLMYDVIREWPRYVKVPFPIAKALATPRAVLINK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP+IFNLD I ALT +++VSENALTF DLGIVPHKLKGYP+E+LI YRKGGPQ+
Sbjct  326  VPFPLPTPNIFNLDEINALTINSVVSENALTFSDLGIVPHKLKGYPIEFLISYRKGGPQF  385

Query  190  GSTVSEKISPDSYP  149
            GST+SE++SPDS+P
Sbjct  386  GSTISERVSPDSFP  399



>ref|XP_009395307.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Musa acuminata subsp. malaccensis]
Length=397

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            R+ PEATI+KP +MIGTEDRILN WAQFAK + FLPLIG G+TKIQPVYV DVA+AI+AS
Sbjct  207  RQFPEATIMKPGIMIGTEDRILNRWAQFAKKWSFLPLIGDGSTKIQPVYVIDVAAAIMAS  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGPE++T+HQLAELMYD+IREWPRYVK+PFPIAKAIATPRELLLKK
Sbjct  267  LKDDGSSMGKVYELGGPEVYTLHQLAELMYDMIREWPRYVKIPFPIAKAIATPRELLLKK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I + T DT+VS+NALTF+DLGIVPHKLKGYPVEYLI YRKGGP +
Sbjct  327  VPFPLPNPDIFNLDQINSFTVDTVVSDNALTFKDLGIVPHKLKGYPVEYLISYRKGGPSF  386

Query  190  GSTVSEKISPD  158
            GSTVSE+++ +
Sbjct  387  GSTVSERVTAE  397



>gb|KGN46368.1| hypothetical protein Csa_6G087960 [Cucumis sativus]
Length=401

 Score =   333 bits (855),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +  PEATIL+PA MIGTEDRILNPWA FAK YGF+PL G G+TKIQPVYV DVA  I+++
Sbjct  208  KAFPEATILRPATMIGTEDRILNPWAHFAKKYGFIPLFGNGSTKIQPVYVVDVAGGIVSA  267

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTS+GKVYELGGPEI++VH LAELM+DVIREWP Y+KVPFPIAKAIATPRE+LL K
Sbjct  268  LKDDGTSIGKVYELGGPEIYSVHDLAELMFDVIREWPHYLKVPFPIAKAIATPREILLNK  327

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP+IFNLD I ALT DT+VSE ALTF DLGIVPHKLKGYPVE+LI YRKGGPQ+
Sbjct  328  VPFPLPTPAIFNLDQILALTQDTVVSEKALTFNDLGIVPHKLKGYPVEFLISYRKGGPQF  387

Query  190  GSTVSEKISPDSYP  149
            GSTVSE+++PDS+P
Sbjct  388  GSTVSERVNPDSFP  401



>gb|EPS69627.1| hypothetical protein M569_05135, partial [Genlisea aurea]
Length=360

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            REIPEATIL+PA M+GTEDRILNPWAQF KN+ FLPLIG G+T+IQPVYV DVASAI+++
Sbjct  167  REIPEATILRPAAMVGTEDRILNPWAQFVKNFSFLPLIGNGSTRIQPVYVVDVASAIVSA  226

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG SMGKVYELGGP+I+TVH+LAELM+D IREWPRY+ VP+PIAKAIA PRE  LKK
Sbjct  227  LKDDGRSMGKVYELGGPDIYTVHELAELMFDTIREWPRYLNVPYPIAKAIAVPREFFLKK  286

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP IFNLD I+  ++DTLVSENAL F+DLGI P KLKGYPVEYLIQYRKGGPQY
Sbjct  287  VPFPLPTPKIFNLDQIKEFSSDTLVSENALKFQDLGIAPRKLKGYPVEYLIQYRKGGPQY  346

Query  190  GSTVSEKISPDSY  152
            GSTVSEK  P S+
Sbjct  347  GSTVSEKELPRSW  359



>ref|XP_004495054.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Cicer arietinum]
Length=396

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATIL+PAVMIGTEDRILN WA +AK YGFLPL+G G TKIQPVYV DVA+A+ A+
Sbjct  203  RELPEATILRPAVMIGTEDRILNQWAHYAKKYGFLPLMGNGNTKIQPVYVVDVAAALTAA  262

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEIFTVH+LA++M+DVIREWPRYV VP PIAKA+ATPRELLL K
Sbjct  263  LKDDGTSMGKTYELGGPEIFTVHELADIMFDVIREWPRYVNVPLPIAKALATPRELLLNK  322

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P +FNLD I A  TDT+VSENALTF DLGIVPHKLKGYP+EYLI +RKGGP++
Sbjct  323  VPFPLPKPEMFNLDQIHAFATDTVVSENALTFNDLGIVPHKLKGYPIEYLISHRKGGPRF  382

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK+SP+ +P
Sbjct  383  GSTVSEKVSPEDWP  396



>ref|XP_007201067.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
 gb|EMJ02266.1| hypothetical protein PRUPE_ppa006705mg [Prunus persica]
Length=399

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT+L+PAV+IGTEDRILN WA FAK YGFLPLIG G+TKIQPVYV DVA AI+A+
Sbjct  206  RELPEATVLRPAVLIGTEDRILNRWAFFAKKYGFLPLIGDGSTKIQPVYVVDVAGAIVAA  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGKVYELGGPE+FTVHQLAELM++ IREWP YVKVP PIAKAIA PRE+LL K
Sbjct  266  LKDDGTSMGKVYELGGPEVFTVHQLAELMFETIREWPHYVKVPLPIAKAIAAPREILLNK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFN D I A  TDT+VSEN+LTF DLG+VPHKLKGYPVE+LIQYRKGGP Y
Sbjct  326  VPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYPVEFLIQYRKGGPNY  385

Query  190  GSTVSEKISPDSYP  149
            GSTVSE++SPD++P
Sbjct  386  GSTVSERVSPDAWP  399



>ref|XP_010540921.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Tarenaya hassleriana]
Length=402

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTED+ILNPWAQF K Y FLPLIG GTTKIQPVYV DVA A++ +LK
Sbjct  211  LPEATIMRPATMIGTEDKILNPWAQFVKKYSFLPLIGDGTTKIQPVYVVDVAGAVVQALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGPE+FT+H+LAELM+D+IREWPRYVKVPFPIAK +A+PRE+LL K+P
Sbjct  271  DDGSSMGKTYELGGPEVFTIHELAELMFDMIREWPRYVKVPFPIAKVMASPREVLLNKLP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLPTP IFNLD I ALTTDTLVS NALTF+DLGI PHKLKGYPVEYLIQYRKGGPQ+GS
Sbjct  331  FPLPTPQIFNLDQINALTTDTLVSGNALTFQDLGIAPHKLKGYPVEYLIQYRKGGPQFGS  390

Query  184  TVSEKISPDSYP  149
            TVSEK+  D YP
Sbjct  391  TVSEKVPTDFYP  402



>gb|ABK94679.1| unknown [Populus trichocarpa]
Length=399

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT++KPAVMIGTEDRILN WA FAK Y FLPLIG G+TKIQPVYV DVA+AIIA+
Sbjct  206  REMPEATVMKPAVMIGTEDRILNRWAHFAKKYSFLPLIGDGSTKIQPVYVVDVAAAIIAA  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGPEIFTVH+LA+LM+DVIREWPRYVKVPFPIAKA+ATPR +L+ K
Sbjct  266  LKDDGSSMGKVYELGGPEIFTVHELADLMHDVIREWPRYVKVPFPIAKALATPRAVLINK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I ALT D++VSENALTF DLGIVPHKLKGYP+E+LI YRKGGPQ+
Sbjct  326  VPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYPIEFLISYRKGGPQF  385

Query  190  GSTVSEKISPDSYP  149
            GST+SE++SPDS+P
Sbjct  386  GSTISERVSPDSFP  399



>ref|XP_008372401.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Malus domestica]
Length=399

 Score =   332 bits (851),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  727  EIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASL  548
            E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPLIG G+TK QPVYV DVA AI+A+L
Sbjct  207  ELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLIGDGSTKFQPVYVVDVAGAIVAAL  266

Query  547  KDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            KDDGTSMGK+YELGGPE+FT+HQLAELM+D IREWPRYVKVP PIAKA+  PRE+LL KV
Sbjct  267  KDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKAMGAPREILLNKV  326

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYG  188
            PFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP+EYLIQ+RKGGP YG
Sbjct  327  PFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEYLIQFRKGGPNYG  386

Query  187  STVSEKISPDSYP  149
            STVSE++SPD++P
Sbjct  387  STVSERVSPDAWP  399



>ref|XP_002301843.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
 gb|EEE81116.1| hypothetical protein POPTR_0002s25720g [Populus trichocarpa]
Length=399

 Score =   332 bits (851),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT++KPAVMIGTEDRILN WA FAK Y FLPLIG G+TKIQPVYV DVA+AIIA+
Sbjct  206  REMPEATVMKPAVMIGTEDRILNRWAHFAKKYSFLPLIGDGSTKIQPVYVVDVAAAIIAA  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGPEIFTVH+LA+LM+DVIREWPRYVKVPFPIAKA+ATPR +L+ K
Sbjct  266  LKDDGSSMGKVYELGGPEIFTVHELADLMHDVIREWPRYVKVPFPIAKALATPRAVLINK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I ALT D++VSENALTF DLGIVPHKLKGYP+E+LI YRKGGPQ+
Sbjct  326  VPFPLPAPKIFNLDEINALTIDSVVSENALTFNDLGIVPHKLKGYPIEFLISYRKGGPQF  385

Query  190  GSTVSEKISPDSYP  149
            GST+SE++SPDS+P
Sbjct  386  GSTISERVSPDSFP  399



>ref|XP_009335235.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pyrus x bretschneideri]
Length=399

 Score =   332 bits (850),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  727  EIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASL  548
            E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPLIG G+TK QPVYV DVA AI+A+L
Sbjct  207  ELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLIGDGSTKFQPVYVVDVAGAIVAAL  266

Query  547  KDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            KDDGTSMGKVYELGGPE+FT+HQLAELM+D IREWPRYVKVP PIAKA+  PRE+LL KV
Sbjct  267  KDDGTSMGKVYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKAMGAPREILLNKV  326

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYG  188
            PFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP+E+LIQ+RKGGP YG
Sbjct  327  PFPLPNPEIFNRDQILAQETDTLVSENALTFNDLGLVPHKLKGYPIEFLIQFRKGGPNYG  386

Query  187  STVSEKISPDSYP  149
            STVSE++SPD++P
Sbjct  387  STVSERVSPDAWP  399



>ref|XP_008382707.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Malus domestica]
Length=437

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -3

Query  727  EIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASL  548
            E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPLIG G+TK QPVYV DVA AI+A+L
Sbjct  245  ELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLIGDGSTKFQPVYVVDVAGAIVAAL  304

Query  547  KDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            KDDGTSMGKVYELGGPE FT+HQLAELM+D IREWPRYVKVP PIAKA+  PRE+LL KV
Sbjct  305  KDDGTSMGKVYELGGPEXFTMHQLAELMFDTIREWPRYVKVPLPIAKAMGAPREILLNKV  364

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYG  188
            PFPLP P IFN D I A  TDTLVSENAL+F DLG+VPHKLKGYP+E+LIQ+RKGGP YG
Sbjct  365  PFPLPNPEIFNRDQILAQATDTLVSENALSFNDLGLVPHKLKGYPIEFLIQFRKGGPNYG  424

Query  187  STVSEKISPDSYP  149
            STVSE++SPD++P
Sbjct  425  STVSERVSPDAWP  437



>ref|XP_004954373.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Setaria italica]
Length=408

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG++KIQPVYV DVA+AI+ S
Sbjct  216  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSSKIQPVYVIDVAAAIVNS  275

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+A+AIA+PRE+LL K
Sbjct  276  LKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARAIASPREMLLNK  335

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I A + D LVSE+ALTFEDLGI+P KLKGYPVEYL+ YRKGGP +
Sbjct  336  VPFPLPTPSIFNLDQINAFSVDNLVSEDALTFEDLGIMPQKLKGYPVEYLLSYRKGGPAF  395

Query  190  GSTVSEKI  167
            GSTVSEK+
Sbjct  396  GSTVSEKM  403



>ref|XP_009370595.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  727  EIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASL  548
            E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPL+G G+TK QPVYV DVA AI+A+L
Sbjct  207  ELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLVGDGSTKFQPVYVVDVAGAIVAAL  266

Query  547  KDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            KDDGTSMGK+YELGGPE+FT+HQLAELM+D IREWPRYVKVP PIAKAI  PRE+LL KV
Sbjct  267  KDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKAIGAPREILLNKV  326

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYG  188
            PFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP+E+LIQ+RKGGP YG
Sbjct  327  PFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEFLIQFRKGGPNYG  386

Query  187  STVSEKISPDSYP  149
            STVSE+ SP ++P
Sbjct  387  STVSERGSPHAWP  399



>ref|XP_002453037.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
 gb|EES06013.1| hypothetical protein SORBIDRAFT_04g037200 [Sorghum bicolor]
Length=408

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQPVYV DVA+AI+ S
Sbjct  216  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQPVYVIDVAAAIVNS  275

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+A+AIA+PRE+LL K
Sbjct  276  LKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARAIASPREMLLNK  335

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I A   D LVSE+ALTFEDLGI+P KLKGYPVE+L+ YRKGGP +
Sbjct  336  VPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLGIMPQKLKGYPVEFLVSYRKGGPSF  395

Query  190  GSTVSEKI  167
            GSTVSEK+
Sbjct  396  GSTVSEKM  403



>gb|ACF85773.1| unknown [Zea mays]
 gb|ACR35734.1| unknown [Zea mays]
Length=407

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQPVYV DVA+AI+ S
Sbjct  215  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQPVYVIDVAAAIVNS  274

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+A+AIA+PRE+LL K
Sbjct  275  LKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARAIASPREMLLNK  334

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I A   D LVSE+ALTFEDL I+P KLKGYPVEYL+ YRKGGP +
Sbjct  335  VPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEYLVSYRKGGPSF  394

Query  190  GSTVSEKI  167
            GSTVSEK+
Sbjct  395  GSTVSEKM  402



>dbj|BAG95473.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score =   322 bits (824),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+  G+TKIQPVYV DVA+AI+ S
Sbjct  119  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVDSGSTKIQPVYVVDVAAAIVNS  178

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP PIA+AIA+PRE+LL K
Sbjct  179  LKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPIARAIASPREMLLNK  238

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGYPVE+L+ YRKGGP +
Sbjct  239  VPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEFLVCYRKGGPAF  298

Query  190  GSTVSEKI  167
            GSTVSEKI
Sbjct  299  GSTVSEKI  306



>ref|XP_011458045.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Fragaria vesca subsp. vesca]
Length=397

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PAVMIGTEDRILN WA  +K YGFLPLIG G+TKIQPVYV DVA AI+++L+
Sbjct  206  LPEATVMRPAVMIGTEDRILNRWAFVSKKYGFLPLIGDGSTKIQPVYVADVAGAIVSALQ  265

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDGTSMGKVYELGGP+++TVHQLAELM+D+IREWP YVK+P PIAKAIA PRE+LLKKVP
Sbjct  266  DDGTSMGKVYELGGPDVYTVHQLAELMFDMIREWPHYVKIPIPIAKAIAMPREILLKKVP  325

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP P IFNLD I A   DT+VSENALTF DLGI+PHK+KGYP+E+LIQYRKGGP +GS
Sbjct  326  FPLPNPEIFNLDQILAQAPDTVVSENALTFNDLGILPHKIKGYPIEFLIQYRKGGPNFGS  385

Query  184  TVSEKISPDSYP  149
            TVSEK+SPDSYP
Sbjct  386  TVSEKVSPDSYP  397



>ref|XP_006648113.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Oryza brachyantha]
Length=360

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+ FLPL+ GGTTKIQPVYV DVA+AI+ S
Sbjct  168  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWSFLPLVDGGTTKIQPVYVVDVAAAIVNS  227

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP P+A+AI++PRE+LL K
Sbjct  228  LKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYINVPLPVARAISSPREMLLNK  287

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP+PSIFNLD I A + D LVSENALTF DLGI+PHKLKGYPVE+L+ YRKGGP +
Sbjct  288  VPFPLPSPSIFNLDQINAFSVDNLVSENALTFADLGIMPHKLKGYPVEFLVCYRKGGPAF  347

Query  190  GSTVSEKI  167
            GSTVSEKI
Sbjct  348  GSTVSEKI  355



>ref|NP_001048516.1| Os02g0816800 [Oryza sativa Japonica Group]
 dbj|BAD21515.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAD22016.1| putative NADH dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF10430.1| Os02g0816800 [Oryza sativa Japonica Group]
Length=408

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+  G+TKIQPVYV DVA+AI+ S
Sbjct  216  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVDSGSTKIQPVYVVDVAAAIVNS  275

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP PIA+AIA+PRE+LL K
Sbjct  276  LKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPIARAIASPREMLLNK  335

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGYPVE+L+ YRKGGP +
Sbjct  336  VPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEFLVCYRKGGPAF  395

Query  190  GSTVSEKI  167
            GSTVSEKI
Sbjct  396  GSTVSEKI  403



>gb|EEC74241.1| hypothetical protein OsI_09443 [Oryza sativa Indica Group]
Length=408

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+  G+TKIQPVYV DVA+AI+ S
Sbjct  216  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVDSGSTKIQPVYVVDVAAAIVNS  275

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP PIA+AIA+PRE+LL K
Sbjct  276  LKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLPIARAIASPREMLLNK  335

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGYPVE+L+ YRKGGP +
Sbjct  336  VPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGYPVEFLVCYRKGGPAF  395

Query  190  GSTVSEKI  167
            GSTVSEKI
Sbjct  396  GSTVSEKI  403



>gb|AFW74028.1| NADH-ubiquinone oxidoreductase subunit [Zea mays]
Length=460

 Score =   324 bits (831),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQPVYV DVA+AI+ S
Sbjct  268  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQPVYVIDVAAAIVNS  327

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPEI+TVH+LAELMY+ IREWPRYV VP P+A+AIA+PRE+LL K
Sbjct  328  LKDDGTSMGKIYELGGPEIYTVHELAELMYETIREWPRYVNVPLPVARAIASPREMLLNK  387

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I A   D LVSE+ALTFEDL I+P KLKGYPVEYL+ YRKGGP +
Sbjct  388  VPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEYLVSYRKGGPSF  447

Query  190  GSTVSEKI  167
            GSTVSEK+
Sbjct  448  GSTVSEKM  455



>ref|NP_001149069.1| LOC100282690 [Zea mays]
 gb|ACG34074.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Zea mays]
Length=407

 Score =   322 bits (824),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTEDRILN WAQFAKN+GFLPL+GGG+TKIQPVYV DVA+AI+ S
Sbjct  215  KEFPEATIMRPATMIGTEDRILNRWAQFAKNWGFLPLVGGGSTKIQPVYVIDVAAAIVNS  274

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YEL GPEI+TVH+LAELMY+ IREWPRYV VP P+A+AIA+PRE+LL K
Sbjct  275  LKDDGTSMGKIYELEGPEIYTVHELAELMYETIREWPRYVNVPLPVARAIASPREMLLNK  334

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I A   D LVSE+ALTFEDL I+P KLKGYPVEYL+ YRKGGP +
Sbjct  335  VPFPLPTPSIFNLDQINAFAVDNLVSEDALTFEDLSIMPQKLKGYPVEYLVSYRKGGPSF  394

Query  190  GSTVSEKI  167
            GSTVSEK+
Sbjct  395  GSTVSEKM  402



>ref|XP_009370589.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial isoform X1 [Pyrus x bretschneideri]
Length=422

 Score =   322 bits (825),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 165/186 (89%), Gaps = 0/186 (0%)
 Frame = -3

Query  727  EIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASL  548
            E+PEATIL+PAVM+GTEDRILN WA FAK YGFLPL+G G+TK QPVYV DVA AI+A+L
Sbjct  207  ELPEATILRPAVMVGTEDRILNRWAFFAKKYGFLPLVGDGSTKFQPVYVVDVAGAIVAAL  266

Query  547  KDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            KDDGTSMGK+YELGGPE+FT+HQLAELM+D IREWPRYVKVP PIAKAI  PRE+LL KV
Sbjct  267  KDDGTSMGKIYELGGPEVFTMHQLAELMFDTIREWPRYVKVPLPIAKAIGAPREILLNKV  326

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYG  188
            PFPLP P IFN D I A  TDTLVSENALTF DLG+VPHKLKGYP+E+LIQ+RKGGP YG
Sbjct  327  PFPLPNPEIFNRDQILAQATDTLVSENALTFSDLGLVPHKLKGYPIEFLIQFRKGGPNYG  386

Query  187  STVSEK  170
            STVSE+
Sbjct  387  STVSER  392



>ref|XP_006854436.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
 gb|ERN15903.1| hypothetical protein AMTR_s00039p00218660 [Amborella trichopoda]
Length=397

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            R+ PEATI+KPAVMIGTEDRILN WAQF K + FLPLIG G+TKIQPVYV D A+AIIAS
Sbjct  204  RQFPEATIMKPAVMIGTEDRILNRWAQFVKKWSFLPLIGDGSTKIQPVYVVDAAAAIIAS  263

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGPE+FTVHQLAELMYD IREWPRYVKVPFPIAKA+A+PRE+LL+K
Sbjct  264  LKDDGTSMGKTYELGGPEVFTVHQLAELMYDTIREWPRYVKVPFPIAKALASPREILLRK  323

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP +FNLD I +LT DT+VSE ALTFE+LGIVP KLKGYP+E+LI YRKGGPQY
Sbjct  324  VPFPLPTPDVFNLDYINSLTVDTVVSEKALTFENLGIVPRKLKGYPIEFLISYRKGGPQY  383

Query  190  GSTVSEKISPDSY  152
            GSTVSE+++   Y
Sbjct  384  GSTVSERVTGPEY  396



>gb|KDP26455.1| hypothetical protein JCGZ_17613 [Jatropha curcas]
Length=396

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            REIPEAT+LKPAVMIGTEDRILN WA FAK Y FLPL G G+TKIQPVYV DVA+A+IA+
Sbjct  203  REIPEATVLKPAVMIGTEDRILNRWAHFAKKYSFLPLFGDGSTKIQPVYVVDVAAAVIAA  262

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGKVYELGGPEIFTVH+LAELM+D IREWPRYVK+PFPIAKA+A PRE+LL K
Sbjct  263  LKDDGTSMGKVYELGGPEIFTVHELAELMFDTIREWPRYVKIPFPIAKALAMPREVLLNK  322

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP+I NLD I AL+ DT+VS++ALTF DLGIVPHKLKGYPVE+LI YRKGGPQ+
Sbjct  323  VPFPLPTPNILNLDEINALSVDTVVSKDALTFHDLGIVPHKLKGYPVEFLISYRKGGPQF  382

Query  190  GSTVSEKISPDSYP  149
            GSTVSE++SPDS+P
Sbjct  383  GSTVSERVSPDSFP  396



>ref|XP_003570393.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brachypodium distachyon]
Length=412

 Score =   317 bits (813),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA +IGTEDRILN WA +AKN+GFLPL+GGG+TKIQPVYV DVA+AI+ S
Sbjct  216  KEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLMGGGSTKIQPVYVVDVAAAIVNS  275

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGP+I+TVH LAELM++ IREWPRYV VPFPIA+AIA+PRE+LL K
Sbjct  276  LKDDGTSMGKTYELGGPDIYTVHDLAELMFETIREWPRYVNVPFPIARAIASPREMLLNK  335

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I AL+ D LVSENALTF DL I PHKLKGYPVE+L+ YRKGGP +
Sbjct  336  VPFPLPTPSIFNLDQINALSVDNLVSENALTFADLEIRPHKLKGYPVEFLVCYRKGGPSF  395

Query  190  GSTVSEKI-SPDSYP  149
            GSTVSEK+ S D  P
Sbjct  396  GSTVSEKMGSSDVAP  410



>ref|XP_010940664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Elaeis guineensis]
Length=398

 Score =   316 bits (810),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE PEATI+KP  +IGTEDRILN WAQFAK + FLPLIG G+TKIQP+YV D A+AIIAS
Sbjct  206  REFPEATIMKPGTLIGTEDRILNRWAQFAKKWSFLPLIGDGSTKIQPIYVVDAAAAIIAS  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGP++FT+HQLAELMYD+IREWPRYVKVPFPIAKA+A+PRE LL K
Sbjct  266  LKDDGSSMGKVYELGGPDVFTLHQLAELMYDMIREWPRYVKVPFPIAKALASPREFLLNK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A T DT+VSENALT  DLGIVPHKLKGYPVEYLI YRKGGP Y
Sbjct  326  VPFPLPNPDIFNLDQINAFTVDTVVSENALTLSDLGIVPHKLKGYPVEYLICYRKGGPAY  385

Query  190  GSTVSEKISPDSY  152
            GSTVSE+I+   +
Sbjct  386  GSTVSERITRSDF  398



>ref|XP_008789505.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Phoenix dactylifera]
Length=398

 Score =   314 bits (804),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE PEATI+KP  +IGTEDRILN WAQF K + FLPLIG G+TKIQPVYV D A+AIIAS
Sbjct  206  REFPEATIMKPGTLIGTEDRILNRWAQFIKKWSFLPLIGDGSTKIQPVYVVDAAAAIIAS  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGKVYELGGP++FTVHQLAELMYD+IREWPRYVKVPFP+AKA+A+PRE LL K
Sbjct  266  LKDDGSSMGKVYELGGPDVFTVHQLAELMYDMIREWPRYVKVPFPVAKALASPREFLLNK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I ALT DT+VSENALT  DLGIVPHKLKGYPVEYLI YRKGGP Y
Sbjct  326  VPFPLPNPDIFNLDQINALTVDTVVSENALTLSDLGIVPHKLKGYPVEYLICYRKGGPAY  385

Query  190  GSTVSEKISPDSY  152
            G+TVSE+++   +
Sbjct  386  GATVSERVTRSDF  398



>gb|EMT17104.1| putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 
9, mitochondrial [Aegilops tauschii]
Length=315

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA +IGTEDRILN WA +AKN+GFLPL GGG+TK QPVYV DVA+AI+ S
Sbjct  119  KEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLFGGGSTKFQPVYVVDVAAAIVNS  178

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGP+I+TVH LAE+M++ IRE+PRYV +PFPIAKA+A+PRE+LL K
Sbjct  179  LKDDGTSMGKTYELGGPDIYTVHDLAEMMFETIREYPRYVNIPFPIAKAMASPREMLLNK  238

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I+ALT D LVSENAL+F DL I PHKLKGYP E+L+ YRKGGP +
Sbjct  239  VPFPLPTPSIFNLDHIKALTVDNLVSENALSFADLEIKPHKLKGYPTEFLVCYRKGGPSF  298

Query  190  GSTVSEKI-SPDSYP  149
            GSTVSEK+ S D  P
Sbjct  299  GSTVSEKMGSADVAP  313



>gb|EMS47161.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Triticum urartu]
Length=315

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA +IGTEDRILN WA +AKN+GFLPL GGG+TK QPVYV DVA+AI+ S
Sbjct  119  KEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLFGGGSTKFQPVYVVDVAAAIVNS  178

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGP+I+TVH LAE+M++ IRE+PRYV +PFPIAKA+A+PRE+LL K
Sbjct  179  LKDDGTSMGKTYELGGPDIYTVHDLAEMMFETIREYPRYVNLPFPIAKAMASPREMLLNK  238

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I+ALT D LVSENAL+F DL I PHKLKGYP E+L+ YRKGGP +
Sbjct  239  VPFPLPTPSIFNLDQIKALTVDNLVSENALSFADLEIKPHKLKGYPTEFLVCYRKGGPSF  298

Query  190  GSTVSEKI-SPDSYP  149
            GSTVSEK+ S D  P
Sbjct  299  GSTVSEKMGSADVAP  313



>ref|XP_010091822.1| hypothetical protein L484_015891 [Morus notabilis]
 gb|EXB46030.1| hypothetical protein L484_015891 [Morus notabilis]
Length=399

 Score =   311 bits (797),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATI+KPA+MIGTEDRI+N WAQ AK Y FLPLIG G+TKIQPVYV DVA+AI+A+
Sbjct  206  RELPEATIMKPAIMIGTEDRIMNRWAQIAKKYSFLPLIGDGSTKIQPVYVVDVAAAIVAA  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGPE+FTVH+LAELMY+ IREWPRY+KVPFPIAKAIATPRE+LL K
Sbjct  266  LKDDGTSMGKIYELGGPEVFTVHELAELMYETIREWPRYLKVPFPIAKAIATPREILLNK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A TTDT+VSENALTF DL I+PHKLKGYP+E+L  YRKGGPQ+
Sbjct  326  VPFPLPKPDIFNLDQILAQTTDTVVSENALTFNDLEIMPHKLKGYPIEFLACYRKGGPQF  385

Query  190  GSTVSEKISPDSYP  149
            GST+SE++SPD++P
Sbjct  386  GSTISERVSPDAWP  399



>ref|XP_002526534.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
 gb|EEF35812.1| NADH-ubiquinone oxidoreductase 39 kD subunit, putative [Ricinus 
communis]
Length=394

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            REIPEAT++KPA MIGTEDRILN WA F K Y FLPL G G+TK+QPVYV DVA+AIIA+
Sbjct  207  REIPEATVMKPAAMIGTEDRILNKWAHFVKKYSFLPLFGDGSTKLQPVYVVDVAAAIIAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGK+YELGGPEI TVH+LAE+M+D+IREWPRYVKVPFPIAKAIATPRE+L+ K
Sbjct  267  LKDDGSSMGKIYELGGPEILTVHELAEIMFDMIREWPRYVKVPFPIAKAIATPREVLINK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP+IFNLD I ALT DT+VSENALTF DLGI+PHKLKGYPVEYLI YRKGGPQ+
Sbjct  327  VPFPLPTPNIFNLDEIIALTMDTVVSENALTFHDLGIMPHKLKGYPVEYLISYRKGGPQF  386

Query  190  GST  182
            GST
Sbjct  387  GST  389



>dbj|BAJ86608.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96242.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88789.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA +IGTEDRILN WA +AKN+GFLPL GGG+TK QPVYV DVA+AI+ S
Sbjct  217  KEFPEATIMRPATLIGTEDRILNRWAMYAKNWGFLPLFGGGSTKFQPVYVVDVAAAIVNS  276

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK YELGGP+++TVH LAE+MY+ IRE+PRYV +PFPIAKA+A+PRE+LL K
Sbjct  277  LKDDGTSMGKTYELGGPDVYTVHDLAEMMYETIREYPRYVNLPFPIAKAMASPREMLLNK  336

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTPSIFNLD I+AL+ D LVSENALTF DL I PHKLKGYP E+L+ YRKGGP +
Sbjct  337  VPFPLPTPSIFNLDQIKALSVDNLVSENALTFADLEIKPHKLKGYPTEFLVCYRKGGPSF  396

Query  190  GSTVSEKISPD  158
            GSTVSEK+  +
Sbjct  397  GSTVSEKMGSE  407



>ref|XP_010684864.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   309 bits (791),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATI++P++M+GTEDRILNPWAQF K Y FLPLIG G+TKIQP +V DVA AI+A+
Sbjct  202  RELPEATIMRPSIMVGTEDRILNPWAQFVKKYSFLPLIGDGSTKIQPAFVVDVAGAIVAA  261

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMGK YELGGP++FT+HQLAELMY+ IRE+P YVK+P  IAK ++TPRELLL K
Sbjct  262  LKDDGSSMGKTYELGGPDVFTIHQLAELMYETIREYPHYVKIPSLIAKGVSTPRELLLNK  321

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP+P+IFNLD I AL+ DT+VS+ ALTF DL I PHKL+GYPVEYL  YRKGGPQ+
Sbjct  322  VPFPLPSPTIFNLDQIHALSVDTVVSDKALTFADLDIAPHKLRGYPVEYLSCYRKGGPQF  381

Query  190  GSTVSEKISPD  158
            GST+SE++S D
Sbjct  382  GSTISERVSTD  392



>dbj|BAH20309.1| AT2G20360 [Arabidopsis thaliana]
Length=335

 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AI+A+LK
Sbjct  144  LPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAALK  203

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  204  DDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIAKAMAAPRDFMVNKVP  263

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+NAL F+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  264  FPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  323

Query  184  TVSEKISPDSYP  149
            TVSEKI  D YP
Sbjct  324  TVSEKIPTDFYP  335



>ref|NP_565469.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
 sp|Q9SK66.2|NDUA9_ARATH RecName: Full=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK59545.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAK93749.1| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAD21752.2| putative NADH-ubiquinone oxireductase [Arabidopsis thaliana]
 gb|AAT68351.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AAX23820.1| hypothetical protein At2g20360 [Arabidopsis thaliana]
 gb|AEC06997.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 [Arabidopsis 
thaliana]
Length=402

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AI+A+LK
Sbjct  211  LPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  271  DDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIAKAMAAPRDFMVNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+NAL F+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  331  FPLPSPQIFNLDQINALTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  390

Query  184  TVSEKISPDSYP  149
            TVSEKI  D YP
Sbjct  391  TVSEKIPTDFYP  402



>ref|XP_002884196.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60455.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=402

 Score =   302 bits (773),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AI+A+LK
Sbjct  211  LPEATVMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  271  DDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVKLPFPIAKAMAAPRDFMVNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+ AL F+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  331  FPLPSPQIFNLDQINALTTDTLVSDKALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  390

Query  184  TVSEKISPDSYP  149
            TVSEKI  D YP
Sbjct  391  TVSEKIPTDFYP  402



>ref|XP_004140669.1| PREDICTED: ABC transporter C family member 5-like [Cucumis sativus]
 ref|XP_004157617.1| PREDICTED: ABC transporter C family member 5-like [Cucumis sativus]
Length=1752

 Score =   323 bits (827),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 173/200 (87%), Gaps = 10/200 (5%)
 Frame = -3

Query  718   EATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTT----------KIQPVYVTDVA  569
             +ATIL+PA MIGTEDRILNPWA FAK YGF+PL G G+T          +IQPVYV DVA
Sbjct  1553  KATILRPATMIGTEDRILNPWAHFAKKYGFIPLFGNGSTNYPNHQCYLCRIQPVYVVDVA  1612

Query  568   SAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPR  389
               I+++LKDDGTS+GKVYELGGPEI++VH LAELM+DVIREWP Y+KVPFPIAKAIATPR
Sbjct  1613  GGIVSALKDDGTSIGKVYELGGPEIYSVHDLAELMFDVIREWPHYLKVPFPIAKAIATPR  1672

Query  388   ELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYR  209
             E+LL KVPFPLPTP+IFNLD I ALT DT+VSE ALTF DLGIVPHKLKGYPVE+LI YR
Sbjct  1673  EILLNKVPFPLPTPAIFNLDQILALTQDTVVSEKALTFNDLGIVPHKLKGYPVEFLISYR  1732

Query  208   KGGPQYGSTVSEKISPDSYP  149
             KGGPQ+GSTVSE+++PDS+P
Sbjct  1733  KGGPQFGSTVSERVNPDSFP  1752



>gb|KJB42340.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=383

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 160/194 (82%), Gaps = 17/194 (9%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQPVYV DVASAI+A+
Sbjct  207  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQPVYVVDVASAIVAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMG                  LMY+ IREWPRYV +P PIAKAIA PRE+LLKK
Sbjct  267  LKDDGSSMG-----------------NLMYETIREWPRYVNIPLPIAKAIAMPREVLLKK  309

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGPQ+
Sbjct  310  VPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGPQF  369

Query  190  GSTVSEKISPDSYP  149
            GSTVSEK++PDSYP
Sbjct  370  GSTVSEKVNPDSYP  383



>ref|XP_010489051.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AI+A+LK
Sbjct  212  LPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAALK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYV +PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPIAKAMAAPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I  LTTDTLVS+NAL F+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSYP  149
            TVSEKI  D YP
Sbjct  392  TVSEKIPTDFYP  403



>ref|XP_010415893.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Camelina sativa]
Length=403

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AI+A+LK
Sbjct  212  LPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAALK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYV +PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPIAKAMAAPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I  LTTDTLVS+NAL F+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINTLTTDTLVSDNALKFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSYP  149
            TVSEKI  D YP
Sbjct  392  TVSEKIPTDFYP  403



>ref|XP_010467837.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Camelina sativa]
Length=403

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AI+A LK
Sbjct  212  LPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAVLK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H+LAE+MYD+IREWPRYV +PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKTYELGGPDVFTTHELAEIMYDMIREWPRYVNLPFPIAKAMAAPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I  LTTDTLVS+NA  F+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINTLTTDTLVSDNAFKFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSYP  149
            TVSEKI  D YP
Sbjct  392  TVSEKIPTDFYP  403



>emb|CDY13877.1| BnaA09g43790D [Brassica napus]
Length=403

 Score =   298 bits (764),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  212  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQPVYVVDVAAAIVAALK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK+YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKIYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  392  TVSEKIPTDFY  402



>emb|CDY39772.1| BnaA09g10240D [Brassica napus]
Length=403

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  212  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQPVYVVDVAAAIVAALK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  392  TVSEKIPTDFY  402



>emb|CDY31970.1| BnaA07g00250D [Brassica napus]
Length=402

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  211  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  271  DDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  331  FPLPSPQIFNLDQINALTTDTLVSDEALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  390

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  391  TVSEKIPTDFY  401



>ref|XP_006443722.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006443723.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 ref|XP_006479428.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like isoform X1 [Citrus sinensis]
 gb|ESR56962.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
 gb|ESR56963.1| hypothetical protein CICLE_v10020464mg [Citrus clementina]
Length=400

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+P ATI++PA MIGTEDR+LN WAQF K + F PL G G+T+IQPVYV DVA+A+ A+
Sbjct  207  RELPWATIMRPAAMIGTEDRLLNKWAQFVKKFNFFPLFGDGSTRIQPVYVVDVAAAVTAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGP+IFTVH+LAELMYD IRE+P YVKVPFP+AKA+A PRE+LLKK
Sbjct  267  LKDDGTSMGKIYELGGPDIFTVHELAELMYDTIREYPHYVKVPFPVAKAVAMPREILLKK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P +FNLD I A T+DT+VS+NALTF+DLGIVPHKLKGYP EYLI YRKGGP++
Sbjct  327  VPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYPTEYLIWYRKGGPKF  386

Query  190  GSTVSEKISPDSYP  149
            GSTVSE+I+P+++P
Sbjct  387  GSTVSERINPEAWP  400



>emb|CDX81965.1| BnaC08g36360D [Brassica napus]
Length=403

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  212  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQPVYVVDVAAAIVAALK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  392  TVSEKIPTDFY  402



>ref|XP_009112664.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Brassica rapa]
Length=403

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT + QPVYV DVA+AI+A+LK
Sbjct  212  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNRFQPVYVVDVAAAIVAALK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  392  TVSEKIPTDFY  402



>ref|XP_002321296.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
 gb|EEE99611.2| hypothetical protein POPTR_0014s18680g [Populus trichocarpa]
Length=384

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 160/180 (89%), Gaps = 3/180 (2%)
 Frame = -3

Query  679  EDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDDGTSMGKVYELGGP  500
            EDRILN WA F K Y FLPLIG G+TKIQPVYV D+A+AIIA+LKDDGTSMGKVYELGGP
Sbjct  205  EDRILNRWAHFTKKYSFLPLIGDGSTKIQPVYVVDIAAAIIAALKDDGTSMGKVYELGGP  264

Query  499  EIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFPLPTPSIFNLDVIE  320
            EIFTVH+LAELMYDVIREWPRYVKVPFPIAKA ATPRE+LL KVPFPLP P +FNLD I 
Sbjct  265  EIFTVHELAELMYDVIREWPRYVKVPFPIAKAFATPREILLNKVPFPLPNPKMFNLDEIN  324

Query  319  ALTTDTLVSENA---LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGSTVSEKISPDSYP  149
            +LT DT+VSEN    LTF DLGIVPHKLKGYPVE+LI YRKGGPQ+GST+SE++SPDS+P
Sbjct  325  SLTMDTVVSENGEFTLTFSDLGIVPHKLKGYPVEFLISYRKGGPQFGSTISERVSPDSFP  384



>ref|XP_009117495.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=403

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  212  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQPVYVVDVAAAIVAALK  271

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  272  DDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  331

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALT DTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  332  FPLPSPQIFNLDQINALTIDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  391

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  392  TVSEKIPTDFY  402



>gb|KFK40412.1| hypothetical protein AALP_AA3G370500 [Arabis alpina]
Length=404

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AIIA+LK
Sbjct  213  LPEATVMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIIAALK  272

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++F    LAE+M+D+IRE PRYVK+PFPIAK +A PR+ ++ KVP
Sbjct  273  DDGSSMGKTYELGGPDVFNARDLAEIMFDMIREVPRYVKLPFPIAKVMAGPRDFMVNKVP  332

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP P +FNLD I A T DTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  333  FPLPCPQVFNLDQINASTIDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  392

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  393  TVSEKIPTDFY  403



>emb|CDY05746.1| BnaC07g00570D [Brassica napus]
Length=402

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGFLPLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  211  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFLPLIGGGTNKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A  R+ ++ KVP
Sbjct  271  DDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGTRDFMVNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I  LTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  331  FPLPSPQIFNLDQINTLTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  390

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  391  TVSEKIPTDFY  401



>emb|CDY03308.1| BnaC09g10400D [Brassica napus]
Length=402

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWA F K YGF PLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  211  LPEATVMRPATMIGTEDRILNPWAMFVKKYGFFPLIGGGTNKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT   LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  271  DDGSSMGKTYELGGPDVFTPRDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P IFNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  331  FPLPSPQIFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  390

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  391  TVSEKIPTDFY  401



>ref|XP_006408954.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
 gb|ESQ50407.1| hypothetical protein EUTSA_v10002002mg [Eutrema salsugineum]
Length=402

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPWAQF K YGFLPLIGGGTTK QPVYV DVA+AI+A+LK
Sbjct  211  LPEATVMRPATMIGTEDRILNPWAQFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++F    LAE+M+D+IRE PRYVK+PFPIAK +A PR+ ++ KVP
Sbjct  271  DDGSSMGKTYELGGPDVFNAQDLAEIMFDMIRERPRYVKLPFPIAKVMAGPRDFMVNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
            FPLP+P +FNLD I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  331  FPLPSPQVFNLDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  390

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  391  TVSEKIPTDFY  401



>ref|XP_009102039.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Brassica rapa]
Length=402

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEAT+++PA MIGTEDRILNPW  F K YGFLPLIGGGT K QPVYV DVA+AI+A+LK
Sbjct  211  LPEATVMRPATMIGTEDRILNPWEMFVKKYGFLPLIGGGTNKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DDG+SMGK YELGGP++FT H LAE+M+D+IREWPRYVK+PFPIAKA+A PR+ ++ KVP
Sbjct  271  DDGSSMGKTYELGGPDVFTPHDLAEIMFDMIREWPRYVKLPFPIAKAMAGPRDFMVNKVP  330

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
             PLP+P IFN D I ALTTDTLVS+ ALTF+DL +VPHKLKGYPVE+LIQYRKGGP +GS
Sbjct  331  SPLPSPQIFNRDQINALTTDTLVSDKALTFQDLDLVPHKLKGYPVEFLIQYRKGGPNFGS  390

Query  184  TVSEKISPDSY  152
            TVSEKI  D Y
Sbjct  391  TVSEKIPTDFY  401



>ref|XP_008235764.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Prunus mume]
Length=387

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEAT+L+PAV+IGTEDRILN WA FAK YGFLPLIG G+TKIQPVYV DVA AI+A+
Sbjct  206  RELPEATVLRPAVLIGTEDRILNRWAFFAKKYGFLPLIGDGSTKIQPVYVVDVAGAIVAA  265

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGKVYELGGPE+FTVHQLAELM++ IREWP YVKVP PIAKAIA PRE+LL K
Sbjct  266  LKDDGTSMGKVYELGGPEVFTVHQLAELMFETIREWPHYVKVPLPIAKAIAAPREILLNK  325

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEY  224
            VPFPLP P IFN D I A  TDT+VSEN+LTF DLG+VPHKLKGYPVE+
Sbjct  326  VPFPLPNPEIFNRDQILAQATDTVVSENSLTFSDLGLVPHKLKGYPVEF  374



>gb|KDO37085.1| hypothetical protein CISIN_1g047628mg, partial [Citrus sinensis]
Length=327

 Score =   275 bits (704),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+P ATI++PA MIGTEDR+LN WAQF K + F PL G G+T+IQPVYV DVA+A+ A+
Sbjct  148  RELPWATIMRPAAMIGTEDRLLNKWAQFVKKFNFFPLFGDGSTRIQPVYVVDVAAAVTAA  207

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTSMGK+YELGGP+IFTVH+LAELMYD IRE+P YVKVPFP+AKA+A PRE+LLKK
Sbjct  208  LKDDGTSMGKIYELGGPDIFTVHELAELMYDTIREYPHYVKVPFPVAKAVAMPREILLKK  267

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLP P +FNLD I A T+DT+VS+NALTF+DLGIVPHKLKGYP EYLI YRKGGP++
Sbjct  268  VPFPLPRPGLFNLDEINAYTSDTIVSDNALTFQDLGIVPHKLKGYPTEYLIWYRKGGPKF  327



>gb|ABK24353.1| unknown [Picea sitchensis]
Length=401

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            RE+PEATIL+PA M+GTEDRILN WAQ AK +  LP+IG G+T++QPVYV DVA+AIIA+
Sbjct  209  RELPEATILRPAAMVGTEDRILNKWAQIAKKWSVLPIIGDGSTRLQPVYVIDVAAAIIAA  268

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDGTS+GK YELGGP++FT+ QL  LM+++IRE PR++K+P PIA+ I++PRE LL K
Sbjct  269  LKDDGTSIGKTYELGGPDVFTIDQLVHLMFEMIREEPRFIKIPIPIARLISSPREFLLNK  328

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP IFN D +++L  D +VS++ALTF DL +VPHKLKGYP+E+L QYR GGP +
Sbjct  329  VPFPLPTPEIFNQDYVDSLLADNVVSQDALTFTDLSVVPHKLKGYPIEFLFQYRTGGPSF  388

Query  190  GSTVSEKIS  164
            G+T+ E+IS
Sbjct  389  GATLGERIS  397



>gb|KJB42337.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=358

 Score =   256 bits (654),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQPVYV DVASAI+A+
Sbjct  207  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQPVYVVDVASAIVAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PIAKAIA PRE+LLKK
Sbjct  267  LKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKAIAMPREVLLKK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENA  284
            VPFPLP P IFNLD I A  TDT+VSEN 
Sbjct  327  VPFPLPNPDIFNLDQINAFATDTVVSENG  355



>gb|KJB42338.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=367

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y FLPLIGGG+TKIQPVYV DVASAI+A+
Sbjct  207  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYSFLPLIGGGSTKIQPVYVVDVASAIVAA  266

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            LKDDG+SMG VYELGGPEI+TVH+LAELMY+ IREWPRYV +P PIAKAIA PRE+LLKK
Sbjct  267  LKDDGSSMGNVYELGGPEIYTVHELAELMYETIREWPRYVNIPLPIAKAIAMPREVLLKK  326

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENA  284
            VPFPLP P IFNLD I A  TDT+VSEN 
Sbjct  327  VPFPLPNPDIFNLDQINAFATDTVVSENG  355



>gb|EEE58042.1| hypothetical protein OsJ_08874 [Oryza sativa Japonica Group]
Length=310

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -3

Query  595  QPVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFP  416
            +PVYV DVA+AI+ SLKDDGTSMGK YELGGPEI+TVH+LAELMY+ IREWPRY+ VP P
Sbjct  163  EPVYVVDVAAAIVNSLKDDGTSMGKTYELGGPEIYTVHELAELMYETIREWPRYIDVPLP  222

Query  415  IAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGY  236
            IA+AIA+PRE+LL KVPFPLPTPSIFN D I A + DTLVS+NALTF DLGIVPHKLKGY
Sbjct  223  IARAIASPREMLLNKVPFPLPTPSIFNKDQINAFSVDTLVSDNALTFSDLGIVPHKLKGY  282

Query  235  PVEYLIQYRKGGPQYGSTVSEKI  167
            PVE+L+ YRKGGP +GSTVSEKI
Sbjct  283  PVEFLVCYRKGGPAFGSTVSEKI  305



>ref|XP_009763970.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Nicotiana sylvestris]
Length=314

 Score =   190 bits (483),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PE TI++PAVMIGTEDRILNPWA FAK YGF+PL G G+TKIQPV+V DVASAI+ASLK
Sbjct  206  LPEVTIMRPAVMIGTEDRILNPWAHFAKKYGFIPLFGDGSTKIQPVFVADVASAIVASLK  265

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKA  404
            D+G SMGKVYELGGP+++T+H+LAELM+D+IREWPRYV VPFPIAKA
Sbjct  266  DNGISMGKVYELGGPDVYTMHELAELMFDMIREWPRYVNVPFPIAKA  312



>ref|XP_001765756.1| predicted protein [Physcomitrella patens]
 gb|EDQ69347.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   174 bits (441),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 131/188 (70%), Gaps = 1/188 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +  PEATIL+ A ++G EDR+LN WA  AK   F+P+ G G +K+QPV V DVA+A+IA+
Sbjct  214  QNFPEATILRTAPLVGVEDRLLNRWAIQAKKLPFVPIPGDGLSKLQPVLVVDVAAAVIAA  273

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            ++D+G SMGK +ELGGP++FTV++L  LM++ IRE+PR V +P P+ +  A PREL +K+
Sbjct  274  IRDEGFSMGKTFELGGPDVFTVNELVALMFEAIREYPRVVHIPMPLCQIAAMPRELAMKR  333

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
               P+P    F+ D ++ L  D +VS++A+   DLGI  HK+ G  +E+L  YR GGP  
Sbjct  334  -GIPIPFSPSFSKDYLDQLACDLIVSQDAMGLADLGITSHKIGGLTIEHLNAYRTGGPSV  392

Query  190  GSTVSEKI  167
            G+TV E +
Sbjct  393  GTTVGESV  400



>ref|XP_002976090.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
 gb|EFJ22995.1| hypothetical protein SELMODRAFT_104564, partial [Selaginella 
moellendorffii]
Length=353

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 123/183 (67%), Gaps = 1/183 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA M G  D+ LN +A  AK +  +P+   G T++QPV V DVA+A +A+
Sbjct  168  QEFPEATIMRPASMFGYHDKFLNRFATKAKFWPNVPMFFDGKTRVQPVCVLDVAAAFLAA  227

Query  550  LKD-DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLK  374
            +K+ +G  +GKVYELGGP+++T+H+L   M++V+RE PR + +P P+A+A++  RE   K
Sbjct  228  VKEKEGIHVGKVYELGGPDVYTIHELLLWMFEVLREKPRIINIPLPLAEAVSRVREFFFK  287

Query  373  KVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            +VP PLP         I++L  D +VS +ALTFE+LGI P  L G   EYL  YR+GGP 
Sbjct  288  RVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGLATEYLFYYREGGPH  347

Query  193  YGS  185
             G 
Sbjct  348  MGQ  350



>ref|XP_002968287.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
 gb|EFJ30541.1| hypothetical protein SELMODRAFT_89106, partial [Selaginella moellendorffii]
Length=362

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 122/183 (67%), Gaps = 1/183 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA M G  D+ LN +A  AK +  +P    G TK+QPV V DVA+A +A+
Sbjct  177  QEFPEATIMRPASMFGYHDKFLNRFATKAKFWPNVPTFFDGKTKVQPVCVLDVAAAFLAA  236

Query  550  LKD-DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLK  374
            +K+ +G  +GKVYELGGP+++T+H+L   M++V+RE PR + +P P+A+A++  RE   K
Sbjct  237  VKEKEGIHVGKVYELGGPDVYTIHELLLWMFEVLREKPRIINIPLPLAEAVSRVREFFFK  296

Query  373  KVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            +VP PLP         I++L  D +VS +ALTFE+LGI P  L G   EYL  YR+GGP 
Sbjct  297  RVPVPLPQLWPCYRHYIDSLKVDQVVSPDALTFEELGIKPRPLGGLATEYLFYYREGGPH  356

Query  193  YGS  185
             G 
Sbjct  357  MGQ  359



>ref|XP_001757609.1| predicted protein [Physcomitrella patens]
 gb|EDQ77666.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 128/188 (68%), Gaps = 1/188 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +  PEATIL+   M+G EDR+LN WA  AK    +P+ G G TK+QPV V DVA+A+IA+
Sbjct  202  QNFPEATILRTGPMVGVEDRLLNRWAIQAKKLPVVPIPGDGLTKMQPVLVVDVAAAVIAA  261

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            ++D+G SMGK +ELGGP++FTV+ L  L+++ IRE PR V +P  +A+ +A PRE+ +K+
Sbjct  262  IRDEGFSMGKTFELGGPDVFTVNDLVTLVFEAIREHPRVVHIPMALAQLLAMPREVAMKR  321

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
               P+P    F+ D ++ L+ D +VS +A+   DLG+  HK+ G  +E+L  YR GGP  
Sbjct  322  -GIPIPFSPTFSKDYLDQLSCDLVVSSDAMGLADLGVTSHKIGGLTIEHLNAYRTGGPSV  380

Query  190  GSTVSEKI  167
            G+TV E I
Sbjct  381  GTTVGESI  388



>ref|XP_005651289.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26745.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=378

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 4/176 (2%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P AT+ KP  ++GTEDR+ N +A  AK   F+PL+GGG TK+QP YV DVA A+I SLK
Sbjct  187  LPYATVFKPGHVVGTEDRMYNIYATMAKQVPFIPLVGGGETKLQPTYVRDVADAVIHSLK  246

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
                ++GK Y L GPE+ TV Q+ EL+Y  IRE      +P P+A+ +A PRE L K   
Sbjct  247  TK-EALGKEYFLAGPEVLTVKQIVELVYTTIREPISTFNLPLPVARLLAVPREKLFKM--  303

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKL-KGYPVEYLIQYRKGG  200
            FP+P  ++F  D IE +T D ++  N LT+ DL +VP K+ +G+P+E+L  YR GG
Sbjct  304  FPIPVNTMFTADYIEEMTQDHVLPPNVLTYADLEVVPKKVTEGFPIEHLRHYRVGG  359



>ref|XP_009803384.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial [Nicotiana sylvestris]
Length=147

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  436  YVKVPFPIAKAIATPRELLLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIV  257
            Y+     + +AIA+PRE LL KVP P+PTP+IFNLD IEAL TD +VS++ALTFEDLG+ 
Sbjct  52   YLHFGLFLFQAIASPREFLLNKVPAPMPTPTIFNLDAIEALATDNIVSKDALTFEDLGLA  111

Query  256  PHKLKGYPVEYLIQYRKGGPQYGSTVSEKISPDSYP  149
            PHK+KGYPVE+LIQYRKGGP YGSTVSE++SP+SYP
Sbjct  112  PHKVKGYPVEFLIQYRKGGPNYGSTVSERVSPESYP  147



>emb|CEF99374.1| NAD(P)-binding domain [Ostreococcus tauri]
Length=359

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
             P AT+++PA M+G EDR LN +A+ ++ Y  +P+I GG T+ QPV+V DVA AI   + 
Sbjct  172  FPSATVVRPAKMVGVEDRFLNVFAEHSRKYPMVPIIDGGDTQHQPVFVDDVAVAIRQIVH  231

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D+ TS G+ YEL G +++TVH LA+L+    R       +P  I +A++ P E LL+KVP
Sbjct  232  DELTS-GRTYELAGKKVYTVHDLAKLVLRTARSRRSTAYIPSFIMRALSCPHEFLLRKVP  290

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLK-GYPVEYLIQYRKGGPQYG  188
            FP+PTP       I+A + D + + + L F DLGI P+ ++ GY ++YL  +R GG   G
Sbjct  291  FPMPTPVGLTRSYIDAQSRDYVKAPDTLGFSDLGIDPNDIENGYVLDYLRSFRAGGYALG  350



>gb|EEC74184.1| hypothetical protein OsI_09314 [Oryza sativa Indica Group]
Length=366

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 82/113 (73%), Gaps = 17/113 (15%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +E PEATI++PA MIGTED ILN W Q                 IQPVYV DVA+AI+ S
Sbjct  269  KEFPEATIMRPATMIGTEDWILNRWVQ-----------------IQPVYVVDVAAAIVNS  311

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATP  392
            LKDDGTSMGK Y LGGPEI+TVH LAELMY+ I EWPRY+ VP PIA+AIA+P
Sbjct  312  LKDDGTSMGKSYGLGGPEIYTVHDLAELMYETICEWPRYIDVPLPIARAIASP  364



>ref|XP_001420142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98435.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=366

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
             P ATI++PA ++G EDR LN + + ++ Y  +P+I GG TK QPV+V DVA AI   + 
Sbjct  173  FPSATIVRPAKIVGVEDRFLNIFGEHSRKYPAVPIIDGGDTKHQPVFVDDVAVAIRQIVH  232

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D+ TS G+ YEL G +++T  +LA+++   IR       +P  I KA++ P E LL++VP
Sbjct  233  DELTS-GRTYELAGNKVYTFDELAKMVLKTIRTRKSTAYIPSFIMKALSCPHEWLLRRVP  291

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLK-GYPVEYLIQYRKGGPQYG  188
            FP+PTP       I+A + D +   ++L F DLGI P+ ++ GY ++YL  +R GG Q G
Sbjct  292  FPMPTPLGLTRSYIDAQSRDYVKRADSLGFSDLGIEPNNIENGYVLDYLRSFRAGGYQVG  351



>ref|XP_003059930.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55882.1| predicted protein [Micromonas pusilla CCMP1545]
Length=353

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 111/185 (60%), Gaps = 3/185 (2%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P AT++KPA +IGTEDR+LN +A+    +    LI  G +K QPVYV DVA AI A + D
Sbjct  167  PNATVVKPAKLIGTEDRLLNVFAEHTCKFPVQTLIDDGGSKHQPVYVDDVALAIRAIVHD  226

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIR--EWPRYVKVPFPIAKAIATPRELLLKKV  368
            + T+ G+ +EL G +I T+  + ++   +IR     R V VP  I K +A P E LL +V
Sbjct  227  ESTA-GRTFELCGEKILTMEDMLKMTQSIIRAQNASRIVYVPSFILKMLAAPHEFLLNRV  285

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYG  188
            PFPLPTP+      I+A   D L    +  F++LGIVP KL+G  ++YL  +R GG   G
Sbjct  286  PFPLPTPTGLTRSYIDAQGEDYLKDPKSEGFKELGIVPAKLEGVVIDYLRAFRFGGYDVG  345

Query  187  STVSE  173
            +T  +
Sbjct  346  ATAGQ  350



>gb|KJB42341.1| hypothetical protein B456_007G150200 [Gossypium raimondii]
Length=312

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  376  KKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
            K +PFPLP P IFNLD I A  TDT+VSENALTF DLGIVPHKLKGYPVEYLIQYRKGGP
Sbjct  237  KYMPFPLPNPDIFNLDQINAFATDTVVSENALTFMDLGIVPHKLKGYPVEYLIQYRKGGP  296

Query  196  QYGSTVSEKISPDSYP  149
            Q+GSTVSEK++PDSYP
Sbjct  297  QFGSTVSEKVNPDSYP  312


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPL  620
            +E+PEAT++KPAVMIGTEDRI+N WA FAK Y   PL
Sbjct  207  KELPEATVMKPAVMIGTEDRIMNRWAHFAKKYMPFPL  243



>ref|XP_002504449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65707.1| predicted protein [Micromonas sp. RCC299]
Length=390

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 111/181 (61%), Gaps = 3/181 (2%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
             P ATI+KPA +IGTEDR+LN +A+    +   PL+  G +K QPVYV DVA AI A ++
Sbjct  200  FPNATIVKPAKLIGTEDRLLNVFAEHTCKFPLAPLVDDGESKHQPVYVDDVALAIQAIVE  259

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIRE--WPRYVKVPFPIAKAIATPRELLLKK  371
            D+ T+ G+ +EL G +++T+  +   +   IR   +P+ + VP  I +A+  P E LL+K
Sbjct  260  DEETA-GQTFELAGDKVYTMEDMLRFVQKTIRTPGYPKILYVPSFILRALGAPHEFLLRK  318

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            VPFPLPTP+      I+A + + L +     FE LGI P KL+G  ++YL  +R GG   
Sbjct  319  VPFPLPTPTGLTKSYIDAQSVNYLKNPRVPGFEQLGIKPAKLEGVVIDYLRAFRFGGYDA  378

Query  190  G  188
            G
Sbjct  379  G  379



>ref|XP_007510295.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18640.1| predicted protein [Bathycoccus prasinos]
Length=431

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 105/178 (59%), Gaps = 2/178 (1%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            R  P ATI+KPA +IG EDR LN +A+ A  + F+PL G G +K QPV V DVA AI + 
Sbjct  234  RIFPRATIVKPAKLIGVEDRFLNVFAEHASKFPFVPLTGLGESKHQPVSVDDVAIAI-SQ  292

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIR-EWPRYVKVPFPIAKAIATPRELLLK  374
            +  D  ++GK Y L G + FT+ +LA+L  D  R    R   +P  + K ++ P E LL 
Sbjct  293  MPYDEETVGKEYVLAGEKTFTMEELAKLTVDAGRFRSARVAYIPKFVYKLLSAPHEFLLN  352

Query  373  KVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            +VPFPLPTP       ++A   D +   N L F++LG+ P K+ G  ++YL  YR GG
Sbjct  353  RVPFPLPTPKGLTRSFVDAQDADYVKKPNELGFKELGMTPAKMDGITIDYLRSYRSGG  410



>ref|WP_026986147.1| 3-beta hydroxysteroid dehydrogenase [Fodinicurvata fenggangensis]
Length=313

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 102/177 (58%), Gaps = 10/177 (6%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            + +P A IL+P+V+ G ED   N +A   +   FLPLIGGG TK QPVYV DVA A + +
Sbjct  142  KALPNAVILRPSVVFGPEDDFFNRFAVMTRMSPFLPLIGGGHTKFQPVYVGDVADAAVQT  201

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            L+D     GK YELGGP +++  +L ELM   IR     V VPF +AK + +  +LL   
Sbjct  202  LQDT-KCQGKTYELGGPRVYSFKELMELMLKTIRRKRLLVPVPFGMAKVMGSVAQLL---  257

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PF   T      D +E L  D +VS++ALT EDLGI  H  +     YL +YR GG
Sbjct  258  -PFAPITA-----DQVELLKNDNIVSKDALTLEDLGIEKHSAEVIIPTYLDRYRPGG  308



>ref|XP_005850526.1| hypothetical protein CHLNCDRAFT_34039 [Chlorella variabilis]
 gb|EFN58424.1| hypothetical protein CHLNCDRAFT_34039 [Chlorella variabilis]
Length=415

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 108/187 (58%), Gaps = 7/187 (4%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P +TI KPA + GTEDR+ N +A  AK   FLPLI GG T++QPV+V DVA+AI+ SLK 
Sbjct  212  PISTIFKPAAVSGTEDRLFNMFATMAKRTPFLPLIDGGKTRMQPVWVRDVAAAIMNSLKT  271

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               S+G+ Y L GP++ TV QL    Y  IRE    V +P  +A  +A   + L +    
Sbjct  272  Y-DSLGQTYYLAGPDVMTVAQLVAFTYHTIRERNASVPMPAAVAGVLAKGWDALGRST--  328

Query  361  PLPTPSIFNLDVIEALT---TDTLVSENALTFEDLGIVPHKL-KGYPVEYLIQYRKGGPQ  194
            PL  P +F+ D I  +     D ++    L FE L + PH++ +G P+EYL  YR GG  
Sbjct  329  PLRGPLMFSSDFIAEMKGGWGDYVMPSGVLGFEHLDVEPHRVAEGIPIEYLRHYRSGGYD  388

Query  193  YGSTVSE  173
            +GS   E
Sbjct  389  FGSLAEE  395



>ref|WP_022729668.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Fodinicurvata 
sediminis]
Length=313

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 102/175 (58%), Gaps = 10/175 (6%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P+V+ G ED   N +A  ++   FLPLIGGG TK QPVYV DVA A + +L+
Sbjct  144  LPDAVILRPSVVFGPEDDFFNRFAVMSRMSPFLPLIGGGHTKFQPVYVGDVADAAVQTLQ  203

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     GK YELGGP  ++  +L ELM   IR     V VPF +AK + +  +LL    P
Sbjct  204  DT-KCHGKTYELGGPRTYSFKELMELMLKTIRRKRLLVPVPFGMAKIMGSVAQLL----P  258

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            F   T      D +E L  D +VS++ALT EDLGI  H  +     YL +YR GG
Sbjct  259  FAPITA-----DQVELLKNDNIVSKDALTLEDLGIEKHSAEVIIPTYLDRYRPGG  308



>ref|XP_006296717.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
 gb|EOA29615.1| hypothetical protein CARUB_v10014190mg [Capsella rubella]
Length=323

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEATI++PA MIGTEDRILNPW+ F K YGFLPLIGGGTTK QPVYV DVA+AI+A+LK
Sbjct  211  LPEATIMRPATMIGTEDRILNPWSMFVKKYGFLPLIGGGTTKFQPVYVVDVAAAIVAALK  270

Query  544  DDGTSMGKVYELGGPEIFTVHQL  476
            DDG+SMGK YELGGP++FT H+L
Sbjct  271  DDGSSMGKTYELGGPDVFTTHEL  293



>ref|WP_038036038.1| 3-beta hydroxysteroid dehydrogenase, partial [Thermopetrobacter 
sp. TC1]
Length=316

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 106/179 (59%), Gaps = 14/179 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P+V++G ED   N +A+ A+    LPLIGGG T+ QPVYV DVA A + +L+
Sbjct  140  MPQAVILRPSVVVGPEDSFFNKFAEMARFSPVLPLIGGGKTRFQPVYVEDVAKAAVKALE  199

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D+  S GK  ELGGPE++T  +L E M  VIR     V VPF +AK +A P + L    P
Sbjct  200  DETLS-GKTLELGGPEVWTFRELMEYMLMVIRRRRMLVSVPFGVAKVMAWPAQFL----P  254

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             P  TP     D ++ L  + +VS+ A     T E +GI P  ++    +YL++YR  G
Sbjct  255  GPPLTP-----DQVKMLMRNNVVSDKARAEGRTLEGIGIEPDGIEAVVPDYLVRYRPAG  308



>ref|WP_027287982.1| 3-beta hydroxysteroid dehydrogenase [Rhodovibrio salinarum]
Length=320

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 104/177 (59%), Gaps = 10/177 (6%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +  P+ +IL+P+++IG ED  LN +AQ A+    LPLIGGG T+ QPVYV DVA A +  
Sbjct  142  KHFPQVSILRPSIVIGPEDGFLNFFAQMARISPALPLIGGGKTRFQPVYVGDVADAAMVC  201

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            + +  T  GK YELGGP+I+T  QL E++   IR     + +PF +A+  A   ELL   
Sbjct  202  VHESKTK-GKTYELGGPQIYTFKQLMEILLKEIRRKRLLLPIPFGVAQVQAGIAELL---  257

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             P PL T      D +  L  D +V + AL+F+ LG+ P  ++     YLI+YR GG
Sbjct  258  -PKPLLT-----RDQVTLLKQDNVVQKGALSFKTLGLEPQAIEAILPTYLIRYRPGG  308



>ref|XP_011401632.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Auxenochlorella protothecoides]
 gb|KFM28596.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, 
mitochondrial [Auxenochlorella protothecoides]
Length=378

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 108/191 (57%), Gaps = 8/191 (4%)
 Frame = -3

Query  715  ATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDDG  536
            ATI K A + GTEDR+ N  A+  K Y  LPL+ GG  ++QPV+V DVA A+  S++++G
Sbjct  183  ATIFKVAPVTGTEDRVFNQLARLIKAYPALPLVAGGALRLQPVWVRDVAQAVFNSMQEEG  242

Query  535  TSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFPL  356
             + GK Y L GPE+ T+ QLA+L Y  IRE    + VP  +A+  + P   L  K PF  
Sbjct  243  AA-GKTYALAGPEVLTLSQLADLTYHTIREPHNVLPVPEKLAELASRPLGWLGTKTPF-R  300

Query  355  PTPSIFNLDVIEALTTD-TLVSENA----LTFEDLGIVPHKL-KGYPVEYLIQYRKGGPQ  194
              P   +  V E    D TL +  A    LT EDLG+ P ++ +G+P+E+L  YR GG  
Sbjct  301  ANPFFSSDSVAELARGDFTLAAATADQPLLTIEDLGVAPRRVTEGHPIEFLRYYRSGGYD  360

Query  193  YGSTVSEKISP  161
             G+      +P
Sbjct  361  MGAVAEVDSAP  371



>dbj|GAK45366.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[alpha proteobacterium MA2]
Length=323

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 106/181 (59%), Gaps = 14/181 (8%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            + +P ATIL+P+++ G ED   N +A  A+    LPLIGGGTT+ QP+YV DVASAI+A+
Sbjct  146  KAVPTATILRPSIVFGPEDDFFNRFAAMARLSPVLPLIGGGTTRFQPIYVKDVASAILAA  205

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            L+++  + GK+YELGGPE+F+  +L E M + IR     V +PF +AK        L+ +
Sbjct  206  LENE-EARGKIYELGGPEVFSFKELMERMLEEIRRKRVLVTLPFGLAK--------LMGR  256

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
            V   LP P +   D +E L  D +VS+ A     T   LG+    L      YL ++R+ 
Sbjct  257  VAGLLPNPPL-TADQVELLKRDNVVSDEAREEERTLAALGVPATGLDSVLSTYLYRFRRT  315

Query  202  G  200
            G
Sbjct  316  G  316



>ref|WP_024512948.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. ARR65]
Length=322

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+VM G ED+  N +A  A+    LPLIGGG TK+QPVYV DVASA IA   
Sbjct  146  LPSATIMRPSVMFGPEDQFTNRFAALARISPMLPLIGGGVTKLQPVYVGDVASA-IAEAA  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D  T  G  YELGGPE+ ++ ++ EL+ ++       V +PF +AK  A      L+  P
Sbjct  205  DGKTRPGATYELGGPEVLSMREIMELILEITDRDRALVSLPFGLAKFQAA----FLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              L  TP     D +E L TD +VSE A    LT E LGI P  L+    +YL ++R  G
Sbjct  261  GALKLTP-----DQVELLRTDNVVSEAAKAAGLTLEGLGITPDSLEAIAPQYLWRFRPAG  315



>ref|WP_036555293.1| 3-beta hydroxysteroid dehydrogenase [Nisaea denitrificans]
Length=317

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 97/175 (55%), Gaps = 10/175 (6%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
             P ATIL+P+++ G +D   N +   A+ + FLPLIGGG TK QPVYV DVA A +A+L 
Sbjct  145  FPTATILRPSIVFGPDDDFFNRFGTMAEAFSFLPLIGGGQTKFQPVYVDDVARAALAALT  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
             D  + G+ YELGGP  ++   L EL+        R V++PF +A   AT  EL      
Sbjct  205  SD-AAEGQTYELGGPTTYSFRDLMELVVAQTGRKCRLVQIPFWLASLEATFLEL------  257

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              LPTP +   D +  L +D +VSE A T  D GI P   +     YL ++R GG
Sbjct  258  --LPTPPL-TRDQVVLLKSDNVVSEGAATLADFGIKPTACEAILPTYLDRFRSGG  309



>ref|WP_029621248.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 gb|KEQ03966.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. R1-200B4]
 gb|KEQ04550.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. R2-400B4]
Length=326

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 102/179 (57%), Gaps = 14/179 (8%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P + IL+P+++ G ED   N +A  AK +  LPLIGGG TK QPVYV DVA A+  +L  
Sbjct  148  PGSVILRPSIVFGPEDSFFNKFAAMAKMFPALPLIGGGKTKFQPVYVEDVAQAV--ALGV  205

Query  541  DGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DGT + GK+YELGGPE+ T  +  EL+   IR     V +PF IA  + +   L+     
Sbjct  206  DGTIAGGKIYELGGPEVLTFRECMELVLHTIRRQRPLVSLPFGIASMLGSVASLI-----  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL TP I + D +  L  D +VSE+A+    T E +GI P  L      YL+QYR  G
Sbjct  261  -PLITPPITS-DQVALLRHDNVVSEDAIRDGRTLEGMGIRPTLLSSVVPSYLVQYRPQG  317



>gb|EKE10168.1| NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex subunit 9 
[uncultured bacterium]
Length=308

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 101/178 (57%), Gaps = 12/178 (7%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAII-A  554
            +  PEAT+ +P+V+ G ED  LN +A+ A+   FLPLIGGG T+ QPVYV DVA   + A
Sbjct  140  KHFPEATVFRPSVIFGPEDAFLNRFAEMARFSPFLPLIGGGKTRFQPVYVGDVAECFLKA  199

Query  553  SLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLK  374
            + K +  S GK YELGG EI+T  QL   +   I      + VPF +A+ +AT  + L  
Sbjct  200  AFKKE--SRGKTYELGGTEIYTFKQLMAYLLKTIYRKRLLLPVPFSLARIMATFAQFL--  255

Query  373  KVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P P  TP     D +E L ++T VS  AL  +DLG+    ++     YL +YR GG
Sbjct  256  --PTPPLTP-----DQVELLKSNTTVSSKALIAKDLGVHVKAMEALAPFYLKRYRPGG  306



>ref|WP_019199324.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Afipia birgiae]
Length=322

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 105/180 (58%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+V+ G ED+  N +A  A+    LPLIGGG TK+QPVYV DVA+A +A+  
Sbjct  146  VPSATIIRPSVVFGPEDQFTNRFAGLARISPMLPLIGGGLTKMQPVYVGDVATA-VANAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D  T  G  YELGGPEI T+ ++ +L+ ++ R     + +PFP+AK     +   L+  P
Sbjct  205  DGKTRPGATYELGGPEIMTMREIIDLILNITRRNRMLMSLPFPLAKI----QSYFLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              L  TP     + +E L +D +VS+ A    LT E LGI P  L      YL +YRK G
Sbjct  261  GDLKLTP-----NQVELLRSDNVVSDTAKAAGLTLEGLGITPDSLAAVAPSYLWRYRKTG  315



>ref|WP_039195170.1| 3-beta hydroxysteroid dehydrogenase [Aureimonas altamirensis]
 gb|KHJ53663.1| 3-beta hydroxysteroid dehydrogenase [Aureimonas altamirensis]
Length=335

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 108/198 (55%), Gaps = 20/198 (10%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+AT+L+P+++ G ED+  N +A  A+   FLPLIGGG T  QPVYV DVA A+  ++ 
Sbjct  146  VPDATVLRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTMFQPVYVNDVAEAVAKTV-  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G VYELGGPEI +   L E M  VI    R++ +PF  A+ +A     L+K +P
Sbjct  205  DGAVPGGCVYELGGPEILSFRALMEEMLLVIDRKRRFLDIPFGAAERLAG----LMKYLP  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYR----  209
                  +    D ++ L  D +VS+ A     TFE  GI P  L+     YL+++R    
Sbjct  261  -----GAPLTHDQVQQLRQDNVVSQAAKAEGRTFEAFGIQPRTLEAVLPTYLVRFRPQGQ  315

Query  208  --KGGPQYGSTVSEKISP  161
              KG P    T+  +I+P
Sbjct  316  FTKGSPTSDQTIDPEIAP  333



>ref|WP_035694954.1| 3-beta hydroxysteroid dehydrogenase [Aurantimonas coralicida]
Length=334

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 101/179 (56%), Gaps = 14/179 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVYV DVA A IA   
Sbjct  146  IPGAYIMRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTRFQPVYVGDVAEA-IADTV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A ++A     L++ +P
Sbjct  205  DGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRNFVTIPFGAAASMAK----LMRFLP  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
                TP     D +  L TD +VS++A+    T E  GI P  +      YL+++RK G
Sbjct  261  GAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAILPTYLVRFRKHG  314



>ref|WP_040326025.1| 3-beta hydroxysteroid dehydrogenase [Aurantimonas manganoxydans]
Length=334

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 101/179 (56%), Gaps = 14/179 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVYV DVA A IA   
Sbjct  146  IPGAYIMRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTRFQPVYVGDVAEA-IADTV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A ++A     L++ +P
Sbjct  205  DGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRSFVTIPFGAAASMAK----LMRFLP  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
                TP     D +  L TD +VS++A+    T E  GI P  +      YL+++RK G
Sbjct  261  GAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAILPTYLVRFRKHG  314



>gb|EAS48786.1| NADH-ubiquinone oxidoreductase [Aurantimonas manganoxydans SI85-9A1]
Length=369

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 101/179 (56%), Gaps = 14/179 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVYV DVA A IA   
Sbjct  181  IPGAYIMRPSIVFGAEDQFFNRFADMARFSPFLPLIGGGKTRFQPVYVGDVAEA-IADTV  239

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G+VYELGGPE+ T  Q+ E M  +I     +V +PF  A ++A     L++ +P
Sbjct  240  DGKVPGGRVYELGGPEVLTFRQMMEEMLRIIERKRSFVTIPFGAAASMAK----LMRFLP  295

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
                TP     D +  L TD +VS++A+    T E  GI P  +      YL+++RK G
Sbjct  296  GAPLTP-----DQVTQLQTDNVVSQDAIEDGRTLEAFGIRPRTVDAILPTYLVRFRKHG  349



>ref|WP_024514903.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. Tv2a-2]
Length=322

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 103/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+V+ G ED+  N +   A+   FLPLIGGG TK+QPVYV DVASA +A   
Sbjct  146  VPTATIMRPSVVFGPEDQFTNRFGALARISPFLPLIGGGVTKMQPVYVGDVASA-VADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPEI ++ ++ E + D+       V +PF IA+     +  +L+  P
Sbjct  205  DGKAKAGATYELGGPEILSMREIMETILDITDRERMLVSLPFGIARF----QSHVLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              L  TP     D +E L +D +VS+ A    LT E LGI P  L+G   +YL ++R  G
Sbjct  261  GALKLTP-----DQVELLRSDNVVSQAAKDAGLTLEGLGITPDSLEGVAPQYLWRFRPAG  315



>ref|WP_029585516.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. URHD0069]
Length=322

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 103/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP ATI++P++M G ED+  N +A  A+    LPLIGGG T++QPVYV+DVA+A +A   
Sbjct  146  IPSATIMRPSIMFGPEDQFTNRFASLARISPVLPLIGGGVTRLQPVYVSDVATA-VADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D  T  G  YELGGPE+ T+ ++ E++   I      + +PF +AK  A    L L+  P
Sbjct  205  DGKTKPGATYELGGPEVLTMREIMEIILATIERRRTMISLPFGLAKLQA----LFLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +E L +D +VS+ A    LT E LGI    L+     YL ++R  G
Sbjct  261  GPLKLTP-----DQVELLRSDNVVSDAAKAAGLTLEGLGIAADTLEAIAPLYLWRFRAAG  315



>ref|WP_008943960.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Oceanibaculum 
indicum]
 gb|EKE76880.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Oceanibaculum 
indicum P24]
Length=316

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 102/178 (57%), Gaps = 11/178 (6%)
 Frame = -3

Query  730  REI-PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIA  554
            RE+ PEATIL+P+++ G ED   N +A  A+    LPLIGGG T  QPVYV DVA A++ 
Sbjct  142  REVFPEATILRPSIVFGPEDGFFNRFAAMARLSPALPLIGGGHTLFQPVYVGDVADAVLR  201

Query  553  SLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLK  374
             L D   + GK+YELGGP+ ++   L ELM   I      V VPF IA+  A+  +L   
Sbjct  202  VLSDP-KAQGKIYELGGPKTYSFKALMELMLATIGRSRLLVPVPFGIAELQASVLQL---  257

Query  373  KVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
                 LP P +   D +  L  D +VSE ALT  DLGI P  ++     Y+ ++R+GG
Sbjct  258  -----LPVPPL-TRDQVTLLKRDNVVSEGALTLADLGIEPTTVEVILPAYMERFRRGG  309



>ref|WP_011661958.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhodopseudomonas 
palustris]
 gb|ABJ04464.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris 
BisA53]
Length=328

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 105/191 (55%), Gaps = 17/191 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+V+ G ED+  N +A  A+   F+PL+GGG  ++QPVYV DVA A +A+  
Sbjct  146  VPAATIMRPSVVFGPEDQFTNRFAALARMLPFVPLVGGGANRLQPVYVGDVAQA-VATAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            +     G VYELGGPE+ T+ ++ E +  +I+     + +PF +AK  A   +       
Sbjct  205  EGLAKPGAVYELGGPEVLTMREVIEAILQIIQRRRTLLSLPFGLAKLQAALLQF------  258

Query  364  FPLPTPSIFNL--DVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
                 P I  L  D +E L  D +VSE A    LT + LGI P  L+     YL ++RK 
Sbjct  259  ----APGILQLTPDQVELLKVDNVVSEAAKAAGLTLQGLGIAPDSLQAMAPSYLWRFRKT  314

Query  202  GPQYGSTVSEK  170
            G   G  ++E+
Sbjct  315  GQFAGKPIAER  325



>sp|Q0DWQ7.1|CCB12_ORYSJ RecName: Full=Cyclin-B1-2; AltName: Full=G2/mitotic-specific 
cyclin-B1-2; Short=CycB1;2 [Oryza sativa Japonica Group]
Length=391

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  604  TKIQPVYVTDVASAIIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKV  425
            ++IQPVYV DVA+AI+ SLKDDGTSMGK Y LGGPEI+TVH LAELMY+ I EWPRY+ V
Sbjct  319  SRIQPVYVVDVAAAIVNSLKDDGTSMGKSYGLGGPEIYTVHDLAELMYETICEWPRYIDV  378

Query  424  PFPIAKAIATP  392
            P PIA+AIA+P
Sbjct  379  PLPIARAIASP  389



>ref|WP_011508790.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitrobacter hamburgensis]
 gb|ABE61084.1| NAD-dependent epimerase/dehydratase [Nitrobacter hamburgensis 
X14]
Length=322

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 106/180 (59%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATIL+P+V+ G+ED+  N +A  A     LPLIGGG TK+QPVYV DVA+A +A   
Sbjct  146  VPSATILRPSVVFGSEDQFANRFAALALMSPVLPLIGGGATKLQPVYVGDVATA-VADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D  T  G VYELGGPE+ ++ ++ +++  VI      V +PF IA+     + + L+  P
Sbjct  205  DGRTKAGAVYELGGPEVLSMREIIQIILRVIERERVLVPLPFLIARF----KAMFLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              L  TP     D +  L TD +VS++A    LT + LGI P  ++    +YL ++RK G
Sbjct  261  GALKLTP-----DQVALLRTDNVVSDSATAAGLTLQGLGISPDSMEAVVPQYLWRFRKAG  315



>ref|WP_035569694.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonas adhaerens]
 gb|KCZ84945.1| putative NADH-quinone oxidoreductase [Hyphomonas adhaerens MHS-3]
Length=329

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 101/162 (62%), Gaps = 8/162 (5%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            + +P ATIL+P+V+ G ED   N +AQ A+    +P IGGG TK+QPVY  DVA AI  S
Sbjct  142  KAVPTATILRPSVVFGPEDEFFNKFAQMARVAPVMPAIGGGKTKMQPVYAGDVAEAIAVS  201

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRY-VKVPFPIAKAIATPRELLLK  374
            + DD T+ GK YELGGP ++T++++ + +   I   PR+ + +PF +AK I      + +
Sbjct  202  VDDD-TTAGKTYELGGPRVYTMNEIYDFICKTISR-PRFKISLPFVLAKPIGYLSGAVWR  259

Query  373  KV-PFP---LPTPSIFNLDVIEALTTDTLVSENALTFEDLGI  260
             V PF    L  P +   D +E L TD +V+++ALT EDLG+
Sbjct  260  YVPPFSWGFLGQPPVTG-DQVEMLKTDNVVADDALTLEDLGV  300



>ref|WP_027845124.1| 3-beta hydroxysteroid dehydrogenase [Mastigocoleus testarum]
Length=324

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 107/190 (56%), Gaps = 15/190 (8%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            PEA IL+P+++ G  D   N +A  A+    LPL+GGG TK+QPVYV DVA A+  +L+D
Sbjct  145  PEAVILRPSIVFGKGDGFFNRFAGLARFLPALPLLGGGHTKMQPVYVDDVADAVCVALED  204

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
             GTS GK+YELGGP +++  +L +++ D  +       VP+PIA+        L  ++  
Sbjct  205  TGTS-GKIYELGGPRVYSFKELMQIVLDETQRKRLLAPVPWPIAR--------LQGRILG  255

Query  361  PLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
             LP P +   D ++ L TD +VSE A+    T  DLGI    ++     YL  YR+ G Q
Sbjct  256  LLPNP-LLTHDQVKMLETDNVVSEAAIAEKRTLGDLGIEATSVEAIVPSYLWMYRRQG-Q  313

Query  193  YGSTVSEKIS  164
            Y   +  + +
Sbjct  314  YAEDIRRETA  323



>ref|WP_041768854.1| 3-beta hydroxysteroid dehydrogenase [Pseudovibrio sp. FO-BEG1]
Length=326

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 106/189 (56%), Gaps = 15/189 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVYV DVA A IA+  
Sbjct  148  MPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVYVGDVALA-IANAA  206

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+  A      L+ +P
Sbjct  207  ENKVETGKIYELGGPQVATFKECLQLMMNVILRRRMLVSLPFLMARIQAK----FLQMLP  262

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
             P+ T     +D +  L +D +VS+ A     TFE LGI PH ++     YL ++R  G 
Sbjct  263  KPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAILPTYLDKFRPRG-  316

Query  196  QYGSTVSEK  170
            QY S  S K
Sbjct  317  QYDSQKSAK  325



>ref|WP_007529376.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium mesoamericanum]
 emb|CCM74073.1| NAD-dependent epimerase/dehydratase [Rhizobium mesoamericanum 
STM3625]
Length=326

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 97/183 (53%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+   FLPLIGGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIFRPSVVFGPEDSFFNKFADMARVSPFLPLIGGGKTKFQPVYVVDVAQAVARAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T+ G+VYELGGPE+ T  +  E+M    R   R V +PF IA  +     L+      
Sbjct  208  KVTA-GEVYELGGPEVLTFRECLEIMLKATRRKNRLVSLPFSIASLMGNIASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  D +VS+ A     T + +G+ P  +      YL+ YR  G  
Sbjct  261  PFVTPPI-TADQVRLLKKDNIVSKEAEAEGRTLKGIGVTPTLVSSVIGSYLVHYRPQGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_041345268.1| 3-beta hydroxysteroid dehydrogenase [Nitrobacter winogradskyi]
Length=322

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 104/180 (58%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATIL+P+VM G ED+  N +A  A     LPLIGGG T++QPV+V DVA+A +A   
Sbjct  146  VPSATILRPSVMFGPEDQFANRFAALALISPMLPLIGGGATRMQPVHVGDVATA-VADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D  T  G VYELGGP++ ++ ++  ++  VI      V VPF +A+ +A    + L+  P
Sbjct  205  DGRTKAGAVYELGGPDVLSMREIMRIILRVIERERMLVPVPFLMARLMA----MGLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +  L TD +VS  A    LT + LGI P  ++    +YL ++RK G
Sbjct  261  GPLKLTP-----DQVALLRTDNVVSNTATAAGLTLQGLGIAPDSMEAVVPQYLWRFRKAG  315



>ref|WP_038279873.1| 3-beta hydroxysteroid dehydrogenase [alpha proteobacterium Mf 
1.05b.01]
Length=328

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 112/187 (60%), Gaps = 17/187 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP ATI++P+++ G ED+  N +A  A+    LPLIGGG T+ QPVYV DVA+A+  +L+
Sbjct  154  IPTATIVRPSIIFGPEDQFFNRFAAMARLAPALPLIGGGETRYQPVYVKDVAAAMTIALQ  213

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPR---YVKVPFPIAKAIATPRELLLK  374
                + GKV ELGGPE+ T    AELM   ++E  R    VK+P   AKA+A+    +L+
Sbjct  214  QPQWN-GKVLELGGPEVAT---FAELMEITLKETGRSRPLVKLPSFAAKAMAS----VLQ  265

Query  373  KVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
             +P PL T     +D +E L  D +VS+ AL F DLGI P  +      YL ++R+ G Q
Sbjct  266  FLPAPLLT-----VDQVELLKHDNVVSDGALGFSDLGIEPSAMSAILPAYLYRFRRTG-Q  319

Query  193  YGSTVSE  173
            +   V++
Sbjct  320  FADGVAD  326



>gb|AEV35208.1| NADH dehydrogenase (ubiquinone) [Pseudovibrio sp. FO-BEG1]
Length=328

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 106/189 (56%), Gaps = 15/189 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVYV DVA A IA+  
Sbjct  150  MPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVYVGDVALA-IANAA  208

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+  A      L+ +P
Sbjct  209  ENKVETGKIYELGGPQVATFKECLQLMMNVILRRRMLVSLPFLMARIQAK----FLQMLP  264

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
             P+ T     +D +  L +D +VS+ A     TFE LGI PH ++     YL ++R  G 
Sbjct  265  KPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAILPTYLDKFRPRG-  318

Query  196  QYGSTVSEK  170
            QY S  S K
Sbjct  319  QYDSQKSAK  327



>ref|WP_035693857.1| 3-beta hydroxysteroid dehydrogenase, partial [Azospirillum halopraeferens]
Length=313

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 99/174 (57%), Gaps = 8/174 (5%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            PEATIL+P+++ G ED+  N +A  A+    LPLIGGG T+ QPVYV DVA AI+ +L  
Sbjct  147  PEATILRPSIVFGPEDQFFNRFAAMAQVSPVLPLIGGGKTRFQPVYVGDVADAIVGALTA  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D  + G+ YELGGP ++T  QL E M   IR     V VP+  A  +      +L+KVP 
Sbjct  207  D-DAAGRTYELGGPGVYTFRQLMERMLGEIRRKRLLVPVPWGAAGTLGG----ILEKVPL  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P   +   D +E L  D +V+ +A   ++LG+ P  L+     YL ++  GG
Sbjct  262  GAP---LLTRDQVEMLRHDNVVAADAPGLKELGVTPTALEVILPTYLFRFIVGG  312



>ref|WP_015663304.1| hypothetical protein [Bradyrhizobium oligotrophicum]
 dbj|BAM86162.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
Length=326

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 103/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEA I++P+V+ G ED+  N +A  A+   FLPLIGGG TK+QPVYV DVASA +A   
Sbjct  150  VPEAVIMRPSVVFGPEDQFTNRFAGLARMSPFLPLIGGGETKMQPVYVGDVASA-VADAV  208

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ +  ++ +++ D+       + +PF +AK  A     +L+  P
Sbjct  209  DGKAQAGATYELGGPEVLSFREILKIILDITDRDRALLPLPFGLAKLQAA----VLQFAP  264

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +E L  D +VSE A    LT + LGI P  L+    +YL ++R  G
Sbjct  265  GPLKLTP-----DQVELLRHDNVVSEAAKAAGLTLQGLGITPDSLEAVAPQYLWRFRPSG  319



>ref|WP_009757683.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Ahrensia sp. R2A130]
 gb|EFL90794.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[Ahrensia sp. R2A130]
Length=320

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 100/178 (56%), Gaps = 14/178 (8%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I++P+++ G ED   N +A  A+    LPLIGGG ++ QPVYV DVA A IA+  D
Sbjct  145  PDAIIMRPSIIFGPEDDFFNRFAGMARIAPALPLIGGGKSRFQPVYVGDVAKA-IANAAD  203

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            +    G  +ELGGPE+ T  +  E M DVI      V +PFPIA A+ +    LL+  P 
Sbjct  204  EKLEAGSTWELGGPEVLTFRECMERMLDVIDRKRALVSLPFPIASAMGS----LLQFAPG  259

Query  361  PLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
               TP       +E L +D +VS++++    T ED G+ P  L      YL+++RK G
Sbjct  260  APITPG-----QVEMLKSDNVVSDDSITQNRTLEDAGVEPTALSAVLPTYLVRFRKHG  312



>ref|WP_043948096.1| 3-beta hydroxysteroid dehydrogenase [Candidatus Phaeomarinobacter 
ectocarpi]
Length=323

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 105/188 (56%), Gaps = 15/188 (8%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+++ G  D   N +A  AK    LPL+GGG TK+QPVYV DVA A+  +L+D
Sbjct  145  PDAVILRPSIIFGNGDGFFNRFAAMAKFSPALPLLGGGHTKMQPVYVDDVADAVCTALED  204

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T  GK YELGGP   TV+   ELM  V+ E  R  ++  PI  +IA  +  +L  +P 
Sbjct  205  TSTQ-GKTYELGGP---TVYSFKELMQIVLDETQRK-RILAPIPWSIARLQGRILGLLPA  259

Query  361  PLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL T     LD +  L TD +VSE A     T EDLGI P  ++     YL  YR+ G Q
Sbjct  260  PLLT-----LDQVRMLETDNVVSEEATSQNRTIEDLGITPKSVEAIVPGYLWMYRRQG-Q  313

Query  193  YGSTVSEK  170
            Y   +  +
Sbjct  314  YAEDIKRE  321



>ref|WP_041801299.1| 3-beta hydroxysteroid dehydrogenase [Rhodopseudomonas palustris]
Length=327

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 102/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A I +P+V+ G ED+  N +A  A+    +PLIGGG TK+QPVYV DVA+A +A   
Sbjct  146  VPQAVIFRPSVVFGPEDQFTNRFAGLARMSAVVPLIGGGATKLQPVYVGDVATA-VAQAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ T+ Q+ E++ DVI+     + +PF +A+  A     LL+  P
Sbjct  205  DGKAKPGATYELGGPEVLTMRQVIEIILDVIQRRRILLSLPFGLARLQAQ----LLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +  L  D +VSE A    LT + LGI P  L+     YL ++R  G
Sbjct  261  GPLKLTP-----DQVALLQVDNVVSEAAQAAGLTLQGLGIPPDSLQAIAPSYLWRFRATG  315



>ref|WP_039540296.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria sp. ANG-R]
 gb|KIC40448.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria sp. ANG-R]
Length=327

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 103/183 (56%), Gaps = 5/183 (3%)
 Frame = -3

Query  739  GCXREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAI  560
            G  + +P A IL+P+V+ GTED+  N +A   +   FLPL+ G  T+ QPVYV DVA A 
Sbjct  138  GVLQHMPNAVILRPSVIFGTEDQFFNRFAGMTRMSPFLPLV-GADTQFQPVYVDDVAQAA  196

Query  559  IASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELL  380
            +  +   G +   VYELGGPE+ +   L + M DVI      V +PF +AK +A   + +
Sbjct  197  VQGVL--GKATAGVYELGGPEVKSFRALMQQMLDVIHRRRIIVGLPFWVAKIMAGVLD-I  253

Query  379  LKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            +K V F L   +I   D ++ L  D +V+E+A  F DLGI P  L     EYL ++R  G
Sbjct  254  VKFVSFQLFPNNILTRDQLKNLRRDNVVAEDARGFADLGIEPATLDSILPEYLWKFRPSG  313

Query  199  PQY  191
             QY
Sbjct  314  -QY  315



>ref|WP_020043898.1| hypothetical protein [alpha proteobacterium SCGC AAA298-K06]
Length=327

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 102/179 (57%), Gaps = 5/179 (3%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            PEATIL+P+++ G ED+  N +AQ A    FLPL+ G  TK QPVYV DVA A+  +L D
Sbjct  144  PEATILRPSIIFGAEDQFFNRFAQMATLSPFLPLV-GANTKFQPVYVGDVAVAVEKALLD  202

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              +S+  VYELGGP + T  +L + M  VI+     + VPF +A+ +    + L+K V  
Sbjct  203  --SSVCGVYELGGPNVETFSELMKRMLGVIQRRRLMLNVPFFVAEIMGQTLD-LIKAVSL  259

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
             L   +I   D ++ L  D +VS NA    DL I P  ++    EYL +YR  G QY S
Sbjct  260  GLFPNNILTQDQVKNLKNDNVVSANAKNLGDLDIKPTAMETVLPEYLWRYRVSG-QYAS  317



>gb|ABA03434.1| NAD-dependent epimerase/dehydratase [Nitrobacter winogradskyi 
Nb-255]
Length=353

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 104/180 (58%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATIL+P+VM G ED+  N +A  A     LPLIGGG T++QPV+V DVA+A +A   
Sbjct  177  VPSATILRPSVMFGPEDQFANRFAALALISPMLPLIGGGATRMQPVHVGDVATA-VADAV  235

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D  T  G VYELGGP++ ++ ++  ++  VI      V VPF +A+ +A    + L+  P
Sbjct  236  DGRTKAGAVYELGGPDVLSMREIMRIILRVIERERMLVPVPFLMARLMA----MGLQFAP  291

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +  L TD +VS  A    LT + LGI P  ++    +YL ++RK G
Sbjct  292  GPLKLTP-----DQVALLRTDNVVSNTATAAGLTLQGLGIAPDSMEAVVPQYLWRFRKAG  346



>gb|ABD86012.1| NAD-dependent epimerase/dehydratase [Rhodopseudomonas palustris 
BisB18]
Length=349

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 102/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A I +P+V+ G ED+  N +A  A+    +PLIGGG TK+QPVYV DVA+A +A   
Sbjct  168  VPQAVIFRPSVVFGPEDQFTNRFAGLARMSAVVPLIGGGATKLQPVYVGDVATA-VAQAV  226

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ T+ Q+ E++ DVI+     + +PF +A+  A     LL+  P
Sbjct  227  DGKAKPGATYELGGPEVLTMRQVIEIILDVIQRRRILLSLPFGLARLQAQ----LLQFAP  282

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +  L  D +VSE A    LT + LGI P  L+     YL ++R  G
Sbjct  283  GPLKLTP-----DQVALLQVDNVVSEAAQAAGLTLQGLGIPPDSLQAIAPSYLWRFRATG  337



>emb|CCF21999.1| putative NADH dehydrogenase/NADH dehydrogenase (Ubiquinone) protein 
[Rhizobium sp.]
Length=326

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 99/180 (55%), Gaps = 14/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P+++ G ED   N +A  AK +  LPLIGGG TK QPVYV DVA A+  +L 
Sbjct  147  VPDAVILRPSIVFGPEDSFFNKFAGMAKMFPALPLIGGGKTKFQPVYVEDVAKAV--ALG  204

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DG    G++YELGGPE+ T  +  E++          + +PFPIA  I +   L+    
Sbjct  205  VDGVIPGGRIYELGGPEVLTFRECMEIVLRTTARKRPLISLPFPIASMIGSVASLI----  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL  P I + D +  L  D +VSE A+    T E +GI P  L      YL+QYR  G
Sbjct  261  --PLIKPPITS-DQVALLKKDNVVSEEAIRDGRTLEGMGIRPTHLTSVVPSYLVQYRPQG  317



>ref|WP_037036496.1| 3-beta hydroxysteroid dehydrogenase [Pseudovibrio sp. JE062]
Length=326

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 106/189 (56%), Gaps = 15/189 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVYV DVA A IA+  
Sbjct  148  MPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVYVGDVALA-IANAA  206

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+  A      L+ +P
Sbjct  207  ENKVETGKIYELGGPQVATFKECLQLMMNVILRKRMLVSLPFLMARIQAK----FLQMLP  262

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
             P+ T     +D +  L +D +VS+ A     TFE LGI PH ++     YL ++R  G 
Sbjct  263  KPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAILPTYLDKFRPRG-  316

Query  196  QYGSTVSEK  170
            QY S  + K
Sbjct  317  QYDSQNAAK  325



>gb|EEA95143.1| NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 
[Pseudovibrio sp. JE062]
Length=328

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 106/189 (56%), Gaps = 15/189 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A I +P+++ G ED   N +   A+ +  LPLIGGG TK QPVYV DVA A IA+  
Sbjct  150  MPNAVIFRPSIVFGPEDDFFNRFGSMAQLFPALPLIGGGHTKFQPVYVGDVALA-IANAA  208

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            ++    GK+YELGGP++ T  +  +LM +VI      V +PF +A+  A      L+ +P
Sbjct  209  ENKVETGKIYELGGPQVATFKECLQLMMNVILRKRMLVSLPFLMARIQAK----FLQMLP  264

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
             P+ T     +D +  L +D +VS+ A     TFE LGI PH ++     YL ++R  G 
Sbjct  265  KPMLT-----VDQVNLLKSDNVVSKEAQAEKRTFEGLGIEPHSMEAILPTYLDKFRPRG-  318

Query  196  QYGSTVSEK  170
            QY S  + K
Sbjct  319  QYDSQNAAK  327



>ref|WP_027297804.1| 3-beta hydroxysteroid dehydrogenase [Rhodospirillales bacterium 
URHD0088]
Length=317

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 96/174 (55%), Gaps = 10/174 (6%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P ATIL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVYV DVA A++A+L D
Sbjct  145  PGATILRPSIVFGPEDAFFNRFARLARILPALPLIGGGKTRFQPVYVGDVADAVMAAL-D  203

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D  S G+ YELGGP I+T   L EL+    R     V VP+ +A+          +    
Sbjct  204  DPASAGQTYELGGPRIYTFKALMELILAETRRKRLLVPVPWAVAR---------CQGALL  254

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             L       LD + +L  D +V   A T +DLGI P  ++     YL +YR+GG
Sbjct  255  QLLPNPPLTLDQVRSLERDNIVPPGARTLKDLGITPDTVEAIVPAYLDRYRRGG  308



>ref|WP_037159370.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. YS-1r]
 gb|KGD86540.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. YS-1r]
Length=326

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 96/180 (53%), Gaps = 9/180 (5%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P++M G ED   N +A  A+ +  LPL+GGG TK QPVYV DVA  +  S+ 
Sbjct  147  LPDAVILRPSIMFGPEDSFFNKFAAMARIFPALPLVGGGNTKFQPVYVEDVAETVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D   + GK+YELGGPE+ T  Q  E M  +     R V +P  IA  I +   L    +P
Sbjct  206  DGAIAPGKIYELGGPEVMTFRQCLETMLRITNRQNRLVSLPSGIASLIGSIASL----IP  261

Query  364  FPLP--TPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
            F  P  TP    L  ++ + +D  V E   T E +GI P         YL+QYR  G QY
Sbjct  262  FVQPPITPDQVKLLKVDNVVSDAAVKE-GRTLEAIGIRPTLATSILPSYLVQYRPQG-QY  319



>ref|WP_035069164.1| 3-beta hydroxysteroid dehydrogenase, partial [Caulobacteraceae 
bacterium PMMR1]
Length=316

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 103/176 (59%), Gaps = 4/176 (2%)
 Frame = -3

Query  727  EIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASL  548
             +P++ IL+P+V+ G ED+  N +A  A     LPLIGGG T++QPVY  DV  AI+ SL
Sbjct  142  RLPDSVILRPSVVFGAEDQFFNRFAAMAAVAPALPLIGGGKTRMQPVYAGDVGEAIVRSL  201

Query  547  KDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             +  ++ G+++ELGGP I+T  +L +L+ +  +     V +PF +A+ I    ++L   +
Sbjct  202  -EQASAGGRIFELGGPAIYTFKELMQLVLNETQRRRALVPLPFEVARLIGVAGDVLSAVL  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            P  +P P     D +E L  D +V+  ALT  DLG+ P  ++     YL ++R GG
Sbjct  261  PV-IPPP--LTTDQVELLKRDNVVAPGALTLADLGVTPTAVEAVVPTYLWRFRPGG  313



>ref|WP_038548505.1| 3-beta hydroxysteroid dehydrogenase [Neorhizobium galegae]
 emb|CDN56803.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Neorhizobium galegae 
bv. officinalis bv. officinalis str. HAMBI 1141]
Length=326

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 97/183 (53%), Gaps = 10/183 (5%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P++M G ED   N +A  A+ +  LPLIGGG TK QPVYV DVA  +  S+ 
Sbjct  147  LPDAVILRPSIMFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVYVEDVAETVARSV-  205

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT + GK+YELGG E+ T  Q  E M  V       V +PF IA  I +   L    +
Sbjct  206  -DGTIASGKIYELGGGEVMTFRQCLETMLRVTNRTNALVSLPFGIASLIGSIASL----I  260

Query  367  PFPLP--TPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PF  P  T     L  I+ + +DT  +E   T + +GI P         YL+QYR  G  
Sbjct  261  PFVQPPITSDQVKLLKIDNVVSDTAATEGR-TLQGIGIRPTLASSILPSYLVQYRPQGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_029057708.1| 3-beta hydroxysteroid dehydrogenase [Stappia stellulata]
Length=330

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 104/187 (56%), Gaps = 15/187 (8%)
 Frame = -3

Query  739  GCXREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAI  560
            G    +PEA + +P+++ G ED   N +A  A+    LPLIGGG T+ QPV+V DVA A+
Sbjct  148  GVFETVPEAVVFRPSIVFGPEDGFFNRFASMARMSPVLPLIGGGATRFQPVFVGDVAEAV  207

Query  559  IASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELL  380
              ++ D  T+ G +YELGGPEI T  +  ELM +VIR     V +PF +A+  A+  +  
Sbjct  208  AMAV-DGQTARGTIYELGGPEIKTFKECLELMLEVIRRKRLLVTLPFSVARVQASVMQW-  265

Query  379  LKKVPFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQY  212
                   LP+P +  +D +E L +D +V E A+    T E LGI    L      YL ++
Sbjct  266  -------LPSPPL-TVDQVELLKSDNVVCEEAIADGRTLEGLGIEGRTLMAILPTYLERF  317

Query  211  RKGGPQY  191
            R+ G QY
Sbjct  318  REHG-QY  323



>ref|WP_009028277.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Bradyrhizobium 
sp. ORS 375]
 emb|CCD93315.1| conserved hypothetical protein [Bradyrhizobium sp. ORS 375]
Length=322

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 102/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEA I++P+V+ G ED+  N +A  A+   FLPL+GGG TK+QPVYV DVA+A IA   
Sbjct  146  VPEAVIMRPSVVFGPEDQFTNRFAALARVAPFLPLVGGGETKMQPVYVGDVATA-IADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ +  ++ +++ D+       + +PF +AK  A      L+  P
Sbjct  205  DGKAQAGATYELGGPEVLSFREILKIILDITDRDRALLPLPFGLAKLQAA----FLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +E L  D +VSE A    LT + LGI P  L+    +YL ++R  G
Sbjct  261  GPLKLTP-----DQVELLRQDNVVSEAATAAGLTLQGLGITPDSLEAIGPQYLWRFRPAG  315



>ref|WP_006310143.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium 
sp. ATCC 31749]
 gb|EGL67030.1| NADH-ubiquinone oxidoreductase [Agrobacterium sp. ATCC 31749]
Length=326

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 97/179 (54%), Gaps = 12/179 (7%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+N  FLPLIGGG TK QPVYV DVA A+  S+ 
Sbjct  147  LPGAVILRPSIVFGPEDDFFNKFAKMARNLPFLPLIGGGKTKFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G +YELGGP++ T     E +         +V +PF +A  I     L+     
Sbjct  206  DGKLKPGAIYELGGPDVMTFRDCLEAVLAATYRERSFVNLPFGVASMIGKLASLV-----  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL TP +   D +  L  D +VS    +N LT E +GI P ++      Y++QYR+ G
Sbjct  261  -PLITPPL-TPDQVTMLKKDNVVSAEAEKNGLTLEGIGITPVRVASVLPSYMVQYRQHG  317



>ref|WP_038592623.1| 3-beta hydroxysteroid dehydrogenase [Neorhizobium galegae]
 emb|CDN50644.1| NADH-ubiquinone oxidoreductase 39 kDa subunit [Neorhizobium galegae 
bv. orientalis str. HAMBI 540]
Length=326

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 97/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P++M G ED   N +A  A+ +  LPLIGGG TK QPVYV DVA  +  S+ 
Sbjct  147  LPDAVILRPSIMFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVYVEDVAETVARSV-  205

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT + GK+YELGG E+ T  Q  E M  V       V +PF IA  I +   L    +
Sbjct  206  -DGTIASGKIYELGGGEVMTFRQCLETMLRVTNRTNALVSLPFGIASLIGSIASL----I  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            PF  P       D ++ L  D +VS+ A     T + +GI P         YL+QYR  G
Sbjct  261  PFVQPP---ITSDQVKLLKIDNVVSDAAATEGRTLQGIGIRPTLASSILPSYLVQYRPQG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_007598696.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
PDO1-076]
 gb|EHS53162.1| NAD-dependent epimerase/dehydratase [Rhizobium sp. PDO1-076]
Length=326

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 102/184 (55%), Gaps = 12/184 (7%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP+ATIL+P+++ G ED   N +A  A+   FLPL+GGG TK QPVYV DVA A+  S+ 
Sbjct  147  IPDATILRPSIVFGPEDSFFNKFAAMARISPFLPLVGGGKTKFQPVYVEDVAEAVALSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D   + GK+YELGG ++ T  Q  + M +VI      V +PF IA  I +    +     
Sbjct  206  DGKIASGKIYELGGRDVLTFKQCLQTMLEVIGRKRALVPMPFGIASMIGSIASAI-----  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
             PL TP + + D +  L  D +VS++A     T E +GI P K+      YL+ +R  G 
Sbjct  261  -PLITPPLTS-DQVTLLKRDNVVSDSAKAEGRTLEGMGIQPVKVASILPTYLVHFRPHGQ  318

Query  196  QYGS  185
              GS
Sbjct  319  FTGS  322



>ref|WP_028793393.1| 3-beta hydroxysteroid dehydrogenase [Thalassobaculum salexigens]
Length=317

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 101/179 (56%), Gaps = 20/179 (11%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            PEATIL+P+V+ G  D   N +A  A     LPLIGGGTT+ QPVYV +VA A++A+L+ 
Sbjct  145  PEATILRPSVVFGANDSFFNKFASLALLSPVLPLIGGGTTRFQPVYVDNVADAVMAALET  204

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + G+ YELGGPEI++  +L E++        + V +PF  A   A   EL       
Sbjct  205  P-AAKGQTYELGGPEIYSFRELMEMVLKETNRKAKLVNLPFWAASIQAAFLEL-------  256

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVE-----YLIQYRKGG  200
             LP+P +   D +E L +D +V+ +A T  DLG+     K  PVE     YL ++R GG
Sbjct  257  -LPSP-MLTRDQVELLKSDNVVAADAKTLADLGV-----KATPVEVIVPTYLDKFRPGG  308



>ref|WP_011923395.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Bradyrhizobium 
sp. ORS 278]
 emb|CAL74097.1| Conserved hypothetical protein; putative NAD dependent epimerase/dehydratase 
family protein [Bradyrhizobium sp. ORS 278]
Length=322

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 103/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEA I++P+V+ G ED+  N +A  A+   FLPL+GGG TK+QPVYV DVA+A +A   
Sbjct  146  VPEAVIMRPSVVFGPEDQFTNRFAGLARIAPFLPLVGGGETKMQPVYVGDVATA-VADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ +  ++ +++ D+       + +PF +AK  AT     L+  P
Sbjct  205  DGKAQPGATYELGGPEVLSFREILKIILDITDRDRALLPLPFGLAKLQAT----FLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +E L  D +VSE A    LT + LGI P  L+    +YL ++R  G
Sbjct  261  GPLKLTP-----DQVELLRHDNVVSEAAKAAGLTLQGLGITPDSLEAVGPQYLWRFRPAG  315



>ref|WP_023512751.1| putative nucleoside-diphosphate-sugar epimerase [Shinella sp. 
DD12]
 gb|EYR83343.1| putative nucleoside-diphosphate-sugar epimerase [Shinella sp. 
DD12]
Length=326

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 99/182 (54%), Gaps = 14/182 (8%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            R +P+A IL+P+++ G ED   N +A  A+    LPLIGGG TK QPVYV DVA A+  S
Sbjct  145  RTVPDAVILRPSIVFGPEDGFFNKFATMARYAPVLPLIGGGHTKFQPVYVADVAEAVARS  204

Query  550  LKDDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLK  374
            +  DGT   G+VYELGGPE+ T  Q  ELM  ++      V +PF IA  + +   L   
Sbjct  205  V--DGTIERGRVYELGGPEVLTFRQCLELMLRIVDRKNPLVSLPFGIASLMGSVASL---  259

Query  373  KVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRK  206
             VPF  P       D +  L +D +VS+ A     T E +GI P   +     YL++YR 
Sbjct  260  -VPFIKPP---LTADQVTLLRSDNIVSDAARNEGRTLEAIGIEPILAEAILPSYLVRYRP  315

Query  205  GG  200
             G
Sbjct  316  QG  317



>ref|WP_003493425.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium 
tumefaciens]
 gb|EGP58646.1| NADH-ubiquinone oxidoreductase [Agrobacterium tumefaciens F2]
Length=326

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 101/180 (56%), Gaps = 14/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+   FLPLIGGGTTK QPVYV DVA A+  S+ 
Sbjct  147  LPNAVILRPSIIFGPEDDFFNKFAKMARGLPFLPLIGGGTTKFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            D     G +YELGG ++ T     E ++    R+ P +V +PF IA  IA    ++    
Sbjct  206  DGKLKPGAIYELGGQDVMTFRDCLEAVLAATYRQRP-FVDLPFGIASMIAKITSMI----  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL TP +  +D +  L  D +VS    +N LT E +GI P ++      Y++QYR  G
Sbjct  261  --PLITPPL-TVDQVTMLKKDNVVSADAEKNGLTLEGIGITPVRVASVLPSYMVQYRTHG  317



>ref|WP_037115283.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 gb|KEC72238.1| NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein [Rhizobium 
leguminosarum bv. phaseoli CCGM1]
Length=326

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 94/185 (51%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                +GKVYELGGPE+ +  +  E M  V     R V +PF IA  I +   L    +PF
Sbjct  207  GKVPVGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P         YL+QYR  G
Sbjct  263  VTPPITP-----DQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMAASVLESYLVQYRPHG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_040489901.1| 3-beta hydroxysteroid dehydrogenase, partial [Fulvimarina pelagi]
Length=323

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 100/178 (56%), Gaps = 14/178 (8%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+++ G ED   N +A+ ++    LPL+GGG TK QP+YV DVA A+  ++ D
Sbjct  147  PDAYILRPSIVFGPEDEFFNRFAEMSRFSPVLPLLGGGKTKFQPIYVVDVAEAVAKTV-D  205

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            +  + G VYELGGPE+ +  QL E M  VI    R+V +PF +A ++A       + VP 
Sbjct  206  NEVAGGTVYELGGPEVLSFRQLMEEMLRVINRKRRFVSIPFSLAGSMAQ----FAQYVPG  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
               TP     D ++ L  D +VSE A+    T +  GI P  +      YL+++R  G
Sbjct  262  APLTP-----DQVKQLQNDNVVSEEAIADGRTLDAFGIRPRTVDSILPTYLVRFRPQG  314



>ref|WP_037065538.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 98/185 (53%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIYRPSVVFGPEDGFFNKFADMARIAPVLPLVGGGKTKFQPVYVVDVAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GK+YELGGPE+ T  +  E M  V     R V +PF +A  I +   L    VPF
Sbjct  208  K-VAGGKIYELGGPEVLTFRECLEAMLKVTCRTNRLVSIPFSLASLIGSVASL----VPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS++A     T + LGI P  +      YL+QYR  G
Sbjct  263  VAPPITP-----DQVRLLKKDNVVSKDAEADGRTLKGLGIAPTMVSSVLPSYLVQYRPHG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>gb|KIE04291.1| NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex subunit 9 
[endosymbiont of Acanthamoeba sp. UWC36]
Length=307

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 98/167 (59%), Gaps = 10/167 (6%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P + I++P+V+ G ED  +N +A+    +  +PLIGGG T++QPVYV DVA A+   L  
Sbjct  150  PNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRLQPVYVVDVAEAVGRCLVK  209

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +A    LL    P 
Sbjct  210  DNIC-GKVFELGGSKVYTLREIYELVFKLIGKKKPLVSIPFIFAKVMAAILSLL----PR  264

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  221
            PL T      D +E L TD ++ +   +FE+LG+ P  ++    EY+
Sbjct  265  PLLT-----CDQVELLKTDNVIVKTKNSFEELGLTPTSMEAVLSEYI  306



>ref|WP_039459013.1| hypothetical protein, partial [endosymbiont of Acanthamoeba sp. 
UWC36]
Length=305

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 98/167 (59%), Gaps = 10/167 (6%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P + I++P+V+ G ED  +N +A+    +  +PLIGGG T++QPVYV DVA A+   L  
Sbjct  149  PNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRLQPVYVVDVAEAVGRCLVK  208

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +A    LL    P 
Sbjct  209  DNIC-GKVFELGGSKVYTLREIYELVFKLIGKKKPLVSIPFIFAKVMAAILSLL----PR  263

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  221
            PL T      D +E L TD ++ +   +FE+LG+ P  ++    EY+
Sbjct  264  PLLT-----CDQVELLKTDNVIVKTKNSFEELGLTPTSMEAVLSEYI  305



>ref|WP_037197314.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. OK494]
Length=326

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 98/183 (54%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I++P+++ G ED   N +A  ++   FLPLIGGG TK QPVYV DVA A+  S+ D
Sbjct  148  PDAVIMRPSIVFGPEDGFFNKFADMSRTAPFLPLIGGGETKFQPVYVEDVAEAVARSV-D  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 G  YELGGPE+ T  +  E    VI      V +PF +A  I +   L+      
Sbjct  207  GKLKAGTTYELGGPEVLTFRECLETTLSVINRKKTLVSIPFAVASLIGSIASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL TP I   D +  L +D +VS+ A     T +D+G++P  L      YL++YR  G  
Sbjct  261  PLITPPI-TPDQVTLLKSDNVVSKQAEAEGRTLKDIGLLPTLLISVLPSYLVRYRPQGQF  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_037079590.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium vignae]
Length=326

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 98/185 (53%), Gaps = 14/185 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P+++ G ED   N +A  A+ +  LPLIGGG TK QPVYV DVA  +  S+ 
Sbjct  147  LPDAVILRPSIVFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVYVEDVAETVARSV-  205

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT + GK+YELGG E+ T  Q  E M  V       V +PF IA  I +   L    +
Sbjct  206  -DGTIASGKIYELGGGEVMTFRQCLETMLRVTNRSNALVSLPFGIASLIGSIASL----I  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            PF  P       D ++ L  D +VS+ A+    T + +GI P         YL+QYR  G
Sbjct  261  PFVQPP---ITSDQVKLLKIDNVVSDAAITEGRTLQGIGIRPTLASSILPSYLVQYRPQG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_014249039.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Azospirillum lipoferum]
 emb|CBS88060.1| putative NAD-dependent epimerase/dehydratase [Azospirillum lipoferum 
4B]
Length=323

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 92/154 (60%), Gaps = 8/154 (5%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P ATIL+P+++ G ED   N +A  A+    LPLIGGG T+ QPVYV ++A A++A+L+ 
Sbjct  147  PAATILRPSIVFGPEDNFFNKFAAMAQKAPALPLIGGGKTRFQPVYVGNLADAVVAALES  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D  S GK YELGGP +++  +L EL    I+     V +P+ IA+++A      L+KVP 
Sbjct  207  D-DSRGKTYELGGPRVYSFRELLELTQKDIQRHRPLVTIPWNIAESLAG----FLEKVPV  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGI  260
              P       D +  L  D +VS  AL F+DLGI
Sbjct  262  LAPA---LTRDQVALLRQDNVVSPTALGFKDLGI  292



>ref|WP_007799503.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
CF122]
 gb|EJL51308.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium sp. 
CF122]
Length=326

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 98/183 (54%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+   FLPLIGGG TK QPVYV DVA A+  ++++
Sbjct  148  PDAIIFRPSVVFGPEDGFFNKFADMARISPFLPLIGGGKTKFQPVYVVDVAEAVAKAVEN  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T+ G+VYELGGPE+ T  +  E+M        R V +PF IA  I     L+      
Sbjct  208  KVTA-GEVYELGGPEVLTFRECLEIMLKATWRKNRLVSLPFGIASLIGRVASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  + +VS+ A     T + +GI P  +      YL+QYR  G  
Sbjct  261  PFITPPI-TADQVRLLKKNNIVSKEAEAEGRTLKGIGITPTLVSSVIGSYLVQYRPHGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>gb|EAU41592.1| putative oxidoreductase protein [Fulvimarina pelagi HTCC2506]
Length=335

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 100/178 (56%), Gaps = 14/178 (8%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+++ G ED   N +A+ ++    LPL+GGG TK QP+YV DVA A+  ++ D
Sbjct  147  PDAYILRPSIVFGPEDEFFNRFAEMSRFSPVLPLLGGGKTKFQPIYVVDVAEAVAKTV-D  205

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            +  + G VYELGGPE+ +  QL E M  VI    R+V +PF +A ++A       + VP 
Sbjct  206  NEVAGGTVYELGGPEVLSFRQLMEEMLRVINRKRRFVSIPFSLAGSMAQ----FAQYVPG  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
               TP     D ++ L  D +VSE A+    T +  GI P  +      YL+++R  G
Sbjct  262  APLTP-----DQVKQLQNDNVVSEEAIADGRTLDAFGIRPRTVDSILPTYLVRFRPQG  314



>ref|WP_002713828.1| hypothetical protein [Afipia clevelandensis]
 gb|EKS33838.1| hypothetical protein HMPREF9696_02958 [Afipia clevelandensis 
ATCC 49720]
Length=322

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 99/181 (55%), Gaps = 17/181 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+++ G ED+  N +A  A+    LPLIGGG TK+QPVY  DVA+A IA   
Sbjct  146  LPSATIMRPSIVFGPEDQFTNRFAGLARLSPMLPLIGGGLTKLQPVYAGDVATA-IADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D  T  G  YELGGPE+ T+ Q+ E +  + +     V +PF +A+         LK   
Sbjct  205  DGKTKAGATYELGGPEVMTMRQIIEDILKITQRDRMLVPLPFALAR---------LKSF-  254

Query  364  FPLPTPSIFNL--DVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
            F    P  F L  D +E L  D +VS+ A    LT E LGI P  L+     YL +YRK 
Sbjct  255  FLQFAPGDFKLTPDQVEMLRADNVVSDAAKAAGLTLEGLGITPDSLEAVTPSYLWRYRKT  314

Query  202  G  200
            G
Sbjct  315  G  315



>ref|WP_007813453.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
CF142]
 gb|EJJ31046.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium sp. 
CF142]
Length=326

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 96/185 (52%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+ +  LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAIIFRPSIVFGPEDSFFNKFADMARTFPVLPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 GK+YELGGPE+ T  +  E +  V     R V +PF IA  I +   L+    PF
Sbjct  207  GKVEGGKIYELGGPEVLTFRECLETILKVTVRKNRLVSLPFSIASLIGSIASLM----PF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D ++ L  D +VS+ A     T + LGI P         YL+QYR  G
Sbjct  263  IAPPITP-----DQVKLLKHDNVVSKAAEAEGRTLKGLGITPTMATSVLDSYLVQYRPHG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_008596326.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitratireductor 
pacificus]
 gb|EKF19243.1| NAD-dependent epimerase/dehydratase [Nitratireductor pacificus 
pht-3B]
Length=324

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 98/180 (54%), Gaps = 16/180 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            + +A I++P+++ G ED+  N +A  A+   FLPLIGGG T+ QPVYV DVA     S+ 
Sbjct  148  VKDAVIIRPSIIFGPEDQFFNRFANMARFSPFLPLIGGGETRFQPVYVGDVAEVYARSV-  206

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT   GKVYELGGPE+ T  +  E M +VI     +V +P+ +A+        +L K+
Sbjct  207  -DGTLKGGKVYELGGPEVLTFRECMEQMLEVIHRKRWFVSIPWSVARLQGR----ILGKL  261

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            P  L T     LD +E L  D +VSE A     T   LGI  H L      YL ++R  G
Sbjct  262  PGHLLT-----LDQVEQLRHDNVVSEAAAKDKRTLAGLGIAQHSLAAMLPAYLWRFRPAG  316



>ref|WP_025602653.1| 3-beta hydroxysteroid dehydrogenase [Proteobacteria bacterium 
JGI 0001013-N05]
Length=326

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 97/183 (53%), Gaps = 15/183 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P++M G ED   N +A  A+ +  LPL+GGG TK QPVYV DVA  +  S+ 
Sbjct  147  LPDAVILRPSIMFGQEDSFFNKFASMARMFPVLPLVGGGKTKFQPVYVEDVAETVARSV-  205

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT + GKVYELGG E+ T  Q  E M  V       V +PF IA  I +   L    V
Sbjct  206  -DGTIASGKVYELGGSEVLTFRQCLETMLSVTNRKNPLVSLPFGIASLIGSIASL----V  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            PF  P       D ++ L TD +VS+ A     T   +GI P         YL+QYR  G
Sbjct  261  PFVQPP---ITSDQVKLLKTDNVVSQAATNEGRTLAGIGIHPTLPASILPTYLVQYRPQG  317

Query  199  PQY  191
             QY
Sbjct  318  -QY  319



>ref|WP_012482360.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium etli]
 gb|ACE89344.1| probable NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein 
[Rhizobium etli CIAT 652]
Length=326

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 93/185 (50%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 GKVYELGGPE+ +  +  E M  V     R V +PF IA  I +   L    +PF
Sbjct  207  GKVPAGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P         YL+QYR  G
Sbjct  263  VTPPITP-----DQVRLLKRDNVVSAEAESEGRTLKGLGIAPTMAASVLESYLVQYRPHG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_037100746.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium alamii]
Length=326

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 96/185 (52%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+ +  LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAIIFRPSIVFGPEDSFFNKFADMARTFPVLPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 GK+YELGGPE+ T  +  E +  V     R + +PF IA  I +   L    VPF
Sbjct  207  GKVEGGKIYELGGPEVLTFRECLETILKVTVRKNRLISLPFSIASLIGSIASL----VPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D ++ L  D +VS+ A     T + LGI P         YL+QYR  G
Sbjct  263  IAPPITP-----DQVKLLKHDNVVSKAAEAEGRTLKGLGITPTMATSVLDSYLVQYRPHG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_037457841.1| 3-beta hydroxysteroid dehydrogenase [Skermanella stibiiresistens]
 gb|EWY38050.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Skermanella stibiiresistens 
SB22]
Length=320

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 99/174 (57%), Gaps = 10/174 (6%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            PEATIL+P+V+ G ED   N +A  A+    LPLIGGG TK QPVYV DVA AI+ +L  
Sbjct  147  PEATILRPSVVFGPEDGFFNRFAAMARVLPALPLIGGGHTKFQPVYVGDVADAIMKALA-  205

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GK YELGGP ++T  +L EL+    +     V VP+ +A+     +  +L K+P 
Sbjct  206  SAEAPGKTYELGGPRVYTFKELMELVLAETKRKRFLVSVPWSVAEF----QGKVLGKLPK  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            P+ T      D +E L +D +V+  A T  DLGI P   +     YL +YR GG
Sbjct  262  PMLTE-----DQVELLRSDNVVAPGAATLADLGISPTAAEVIIPTYLDRYRIGG  310



>ref|WP_016735020.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium phaseoli]
Length=326

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 93/185 (50%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 GKVYELGGPE+ +  +  E M  V     R V +PF IA  I +   L    +PF
Sbjct  207  GKVPAGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P         YL+QYR  G
Sbjct  263  VTPPITP-----DQVRLLKRDNVVSAEAESEGRTLKGLGIAPTMAASVLESYLVQYRPHG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_009449172.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Nitratireductor 
indicus]
 gb|EKF44097.1| NAD-dependent epimerase/dehydratase [Nitratireductor indicus 
C115]
Length=324

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 95/179 (53%), Gaps = 14/179 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            I +A I++P+++ G ED+  N +A  A+   F+PLIGGG TK QPVYV DVA     S+ 
Sbjct  148  IKDAVIVRPSIVFGPEDKFFNRFANMARFSPFIPLIGGGETKFQPVYVGDVAEVFARSVD  207

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
             D    GK+YELGGPE+ T  Q  E M DV       V VP+ IA+        L  ++ 
Sbjct  208  GD-LEGGKIYELGGPEVLTFRQCMEQMLDVTCRKRWLVSVPWAIAR--------LQGRIL  258

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              LP P +  LD ++ L  D +VSE A     T + LGI  H L      YL ++R  G
Sbjct  259  GLLPNP-LLTLDQVKLLEKDNVVSEEAAREKRTLQGLGIAGHSLAAILPMYLWRFRPAG  316



>ref|WP_010970802.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium 
tumefaciens complex]
 ref|NP_353326.2| NADH-ubiquinone oxidoreductase [Agrobacterium fabrum str. C58]
 gb|AAK86111.2| NADH-ubiquinone oxidoreductase [Agrobacterium fabrum str. C58]
 gb|KEY54712.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium tumefaciens]
Length=326

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 96/179 (54%), Gaps = 12/179 (7%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+N  FLPLIGGG TK QPVYV DVA A+  S+ 
Sbjct  147  LPGAVILRPSIIFGPEDDFFNKFAKMARNLPFLPLIGGGKTKFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G +YELGGP++ T     E +         +V +PF +A  I     L+     
Sbjct  206  DGKLKPGAIYELGGPDVMTFRDCLEAVLAATYRERSFVNLPFGVASMIGKLASLV-----  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL TP +   D +  L  D +VS  A    LT E +GI P ++      Y++QYR+ G
Sbjct  261  -PLITPPL-TPDQVTMLKKDNVVSAEAEKKGLTLEGIGITPVRVASVLPSYMVQYRQHG  317



>ref|WP_024317749.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Rhizobium]
 emb|CDM56065.1| NADH dehydrogenase/NADH dehydrogenase(ubiquinone) protein [Rhizobium 
sp. LPU83]
Length=326

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 98/183 (54%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+    LPLIGGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIYRPSVVFGPEDSFFNKFADMARIAPVLPLIGGGKTKFQPVYVVDVAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               ++G+VYELGGPE+ T  +  E+M        R V +PF IA  I +   L+      
Sbjct  208  K-VAVGEVYELGGPEVLTFRECLEIMLKATWRKNRLVSIPFGIASLIGSIASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  D +VS++A     T + +G+ P  +      YL+QYR  G  
Sbjct  261  PFITPPI-TADQVRLLKKDNIVSKDAEAEDRTLKGIGVTPTLVSSVIGSYLVQYRPHGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_027581325.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. Ai1a-2]
Length=329

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 99/178 (56%), Gaps = 13/178 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P ATIL+P+V+ G ED+  N +A  A+    +PL+GGG TK+QP +V DVA+A +A   D
Sbjct  147  PSATILRPSVVFGPEDQFTNRFAAMARMSPAIPLVGGGLTKMQPAFVGDVATA-VADAVD  205

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T     YELGGPE+ T+ ++ E + D+       V +PF +A+ +A     LL+  P 
Sbjct  206  GKTRPAATYELGGPEVLTMREIMETILDITDRDRALVSLPFGLARFMAA----LLQFAPG  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             L        D +E L  D +VS+ A    LTFE LGI P  L+    +YL ++R  G
Sbjct  262  ALK----LTADQVELLRKDNVVSDTAKAAGLTFEGLGIAPDSLEAIAPQYLWRFRPAG  315



>gb|EGE59004.1| putative NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein 
[Rhizobium etli CNPAF512]
Length=396

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 94/183 (51%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A+  ++ D
Sbjct  218  PDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVYVEDVAEAVARAV-D  276

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                +GKVYELGGPE+ +  +  E M  V     R V +PF IA  I +   L+      
Sbjct  277  GKVPVGKVYELGGPEVLSFRECLETMLKVTSRKNRLVSLPFGIASMIGSIASLI------  330

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  D +VS  A     T + LGI P         YL+QYR  G  
Sbjct  331  PFVTPPI-TPDQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMAASVLESYLVQYRPHGQY  389

Query  193  YGS  185
             GS
Sbjct  390  TGS  392



>ref|WP_042689500.1| 3-beta hydroxysteroid dehydrogenase [Azospirillum sp. B506]
Length=323

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 101/185 (55%), Gaps = 13/185 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P ATIL+P+++ G ED   N +A  A+    LPLIGGG T  QPVYV D+A A++A+L  
Sbjct  147  PAATILRPSIVFGPEDNFFNKFAAMAQKAPALPLIGGGKTLFQPVYVGDLADAVVAALDS  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D  S GK YELGGP ++T  +L +L    I      V +P+  A+++A     +L+KVP 
Sbjct  207  D-ASRGKTYELGGPRVYTFRELLDLTQKAILRHRPLVTIPWNAAESLAG----ILEKVPV  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPV---EYLIQYRKGGPQY  191
              P       D +  L  D +VS  AL F+DLGI   +L    V    YL ++  GG   
Sbjct  262  LAPA---LTRDQVALLKQDNVVSPGALGFKDLGIA--ELASCEVILPTYLSRFIVGGKFS  316

Query  190  GSTVS  176
            G T S
Sbjct  317  GQTNS  321



>ref|WP_028034557.1| 3-beta hydroxysteroid dehydrogenase [Chelativorans sp. J32]
Length=323

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 97/180 (54%), Gaps = 16/180 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +  A +++P+++ G ED+  N +A  A+   FLPL+GGG  ++QPVYV DVA     S+ 
Sbjct  148  VKNAVVIRPSIIFGPEDKFFNRFANMARFSPFLPLVGGGRNRLQPVYVGDVAEVYARSV-  206

Query  544  DDGTSM-GKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT   G +YELGGP++ T  +  E M +VI     ++ VP+P+A+        L  +V
Sbjct  207  -DGTLKPGAIYELGGPQVLTFRECMEEMLEVIERKRAFISVPWPLAR--------LQARV  257

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
               LP P +  LD +  L  D +VSE A    LT E LGI  H L      YL  YR  G
Sbjct  258  LGLLPNP-LLTLDQVRMLAVDNVVSEEASRRGLTLEGLGISRHALATILPTYLWTYRPAG  316



>ref|WP_020011099.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Agrobacterium]
Length=326

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 100/180 (56%), Gaps = 14/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+N  FLPLIGGG TK QPVYV DVA A+  S+ 
Sbjct  147  LPGAVILRPSIIFGPEDDFFNKFAKMARNLPFLPLIGGGQTKFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            D     G +YELGG +I T     E ++    R+ P +V +PF IA  +A    L+    
Sbjct  206  DGKLKPGAIYELGGQDIMTFRDCLEAVLAATYRQRP-FVDLPFGIASTVAKLTSLV----  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL  P +  +D +  L  D +VS    +N LT E +GI P ++      Y++QYR  G
Sbjct  261  --PLIKPPL-TVDQVTMLKKDNVVSADAEKNGLTLEGIGITPVRVASILPSYMVQYRTHG  317



>ref|WP_012589203.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Methylocella silvestris]
 gb|ACK49133.1| NADH dehydrogenase (ubiquinone) [Methylocella silvestris BL2]
Length=335

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 100/182 (55%), Gaps = 8/182 (4%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P A IL+P+V+ G ED   N +A  A+    LPLIGGG TK+QPV+V DVA A  A+L  
Sbjct  151  PGAVILRPSVVFGPEDEFFNRFAAMARFMPVLPLIGGGETKLQPVFVGDVARA--AALAL  208

Query  541  DGTSM-GKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DG +  G +YELGGPE+ T+ ++ E +  V     R V + F  A+++    E+L K   
Sbjct  209  DGKAKPGAIYELGGPEVATMRRIMEFVLKVTERKRRLVTLSFDQARSVGGVTEVLSKLSL  268

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
              LP       D +E L  D +VS+ A+    T + LG+ P   + +   YL +YR  G 
Sbjct  269  GLLPKMFEITRDQVELLKHDNVVSKAAIVEGRTLQGLGLAPESFEAFTPTYLTRYRATG-  327

Query  196  QY  191
            QY
Sbjct  328  QY  329



>gb|EWM25568.1| nadh dehydrogenase, partial [Nannochloropsis gaditana]
Length=273

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 99/180 (55%), Gaps = 11/180 (6%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
             P ATI++P  + G EDR+LN +AQ A ++G +PL  GG   +QP Y +DV  A++  ++
Sbjct  96   FPRATIVRPGRLFGPEDRLLNWFAQNAASFGVIPLFNGGNALLQPTYASDVVDAMVKIIE  155

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     GK +EL G   FT  +L +  +D+  + PR V +P  + +  A      L ++P
Sbjct  156  DPEDYEGKTFELAGEHNFTWRELMDFTFDITYQKPRVVDLPLAVGEMAA----FGLSQLP  211

Query  364  FPLPTPSIFNLDVIEALTTDTLV--SENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
             PL T     +D  + ++TD ++  S +A+TF+DL I P  L+     YL +YR  G  +
Sbjct  212  NPLLT-----IDDAKLMSTDVILEPSSSAMTFQDLHIKPTPLEKVAFNYLYRYRTDGGHF  266



>ref|WP_037314823.1| 3-beta hydroxysteroid dehydrogenase [Ruegeria halocynthiae]
Length=327

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 101/183 (55%), Gaps = 5/183 (3%)
 Frame = -3

Query  739  GCXREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAI  560
            G    +P A IL+P+V+ GTED+  N +A   +   FLPL G G TK QPV+V DVA A 
Sbjct  138  GVLAHMPNAVILRPSVVFGTEDQFFNRFAGMTRMGPFLPLAGAG-TKFQPVFVDDVAKAA  196

Query  559  IASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELL  380
            +   +  G +   +YELGGPE+ +   L + M DVI      + +PF +A+ +A+  + +
Sbjct  197  VQGAQ--GQAEAGIYELGGPEVKSFRALMQQMLDVIYRRRVIIGMPFWVARIMASVLD-I  253

Query  379  LKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            LK   F L    I   D ++ L  D +VS+ A  F DLGI P  L+    +YL ++R  G
Sbjct  254  LKFASFQLFPNHILTRDQLKNLRRDNVVSDGAKGFADLGIEPAALESILPDYLWKFRPSG  313

Query  199  PQY  191
             QY
Sbjct  314  -QY  315



>ref|WP_038686352.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium etli]
 gb|AIC25502.1| NAD-dependent nucleoside-diphosphate-sugar epimerase protein 
[Rhizobium etli bv. mimosae str. IE4771]
 gb|AJC77596.1| NAD-dependent nucleoside-diphosphate-sugar epimerase protein 
[Rhizobium etli bv. phaseoli str. IE4803]
Length=326

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 94/185 (51%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPLIGGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLIGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 GKVYELGGPE+ +  +  E M  V      ++ +PF IA  I +   L    +PF
Sbjct  207  GKVPSGKVYELGGPEVLSFRECLETMLKVTSRKNPFISLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P  +      YL+QYR  G
Sbjct  263  VTPPITP-----DQVRLLKRDNVVSAEAEAEGRTLKGLGIAPTMVASVLESYLVQYRPHG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_043924186.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobiaceae bacterium 
SG-6C]
Length=322

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 98/181 (54%), Gaps = 17/181 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+++ G ED+  N +A  A+    LPLIGGG TK+QPVY  DVA+A IA   
Sbjct  146  LPSATIMRPSIVFGPEDQFTNRFAGLARLSPILPLIGGGLTKLQPVYAGDVATA-IADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ T+ Q+ E +  + +     V +PF +A+         LK   
Sbjct  205  DGKAKAGATYELGGPEVMTMRQIIEDILKITQRDRMLVPLPFALAR---------LKSF-  254

Query  364  FPLPTPSIFNL--DVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
            F    P  F L  D +E L  D +VS+ A    LT E LGI P  L+     YL +YRK 
Sbjct  255  FLQFAPGDFKLTPDQVEMLRADNVVSDAAKAAGLTLEGLGITPDSLEAVTPSYLWRYRKT  314

Query  202  G  200
            G
Sbjct  315  G  315



>ref|WP_025425609.1| 3-beta hydroxysteroid dehydrogenase [Ensifer adhaerens]
 gb|AHK43123.1| NADH-ubiquinone oxidoreductase [Ensifer adhaerens OV14]
Length=326

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 98/184 (53%), Gaps = 17/184 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P+++ G ED   N +AQ A+    LPLIGGG TK QPVYVTDVA  +  S+ 
Sbjct  147  LPDAIILRPSIVFGPEDGFFNKFAQMARFAPALPLIGGGNTKFQPVYVTDVAEVVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D   S G +YELGGP++ T  +  E+M   I      V VPF IA  +      +   +P
Sbjct  206  DGKLSAGTIYELGGPDVLTFRECLEIMLQTIDRKRSLVSVPFGIASLMGR----VASMIP  261

Query  364  FPLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
            F  P  TP     D +  L +D +VS  A     T   +GI P  L+     YL++YR  
Sbjct  262  FITPPITP-----DQVVLLKSDNIVSAKAESEGRTLGGIGITPTMLESILSTYLVRYRPQ  316

Query  202  GPQY  191
            G QY
Sbjct  317  G-QY  319



>ref|WP_022713397.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium mongolense]
Length=326

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 95/182 (52%), Gaps = 12/182 (7%)
 Frame = -3

Query  718  EATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDD  539
            +A I +P+++ G ED   N +A+ A+    LPLIGGG TK+QPVYV DVA A+  +++  
Sbjct  149  DAIIFRPSIVFGPEDGFFNKFAEMARLSPVLPLIGGGKTKLQPVYVEDVAEAVARAVEGK  208

Query  538  GTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFP  359
              S G +YELGGPE+ T  +  ++M  +     R V +PF IA  I +   L    +PF 
Sbjct  209  AAS-GTIYELGGPEVLTFRECLQVMLKITARKNRLVSIPFTIASLIGSVASL----IPFV  263

Query  358  LPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
             P       D +  L  D +VS  A    LT + LG+ P  L      YL+ YR  G   
Sbjct  264  KPP---ITADQVRLLKRDNVVSTKAETDGLTLKALGVTPTMLTSVLPSYLVHYRPHGQYT  320

Query  190  GS  185
            GS
Sbjct  321  GS  322



>ref|WP_020042805.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Salipiger mucosus]
 gb|EPX79806.1| NAD-dependent epimerase/dehydratase [Salipiger mucosus DSM 16094]
Length=327

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 98/184 (53%), Gaps = 14/184 (8%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            + +P+A IL+P+VM G ED+  N +A  ++    LPL+G   TK QPVYV DVA A +  
Sbjct  141  KHMPDAMILRPSVMFGVEDQFFNRFAGMSRMGPVLPLVGA-ETKFQPVYVDDVARAAVMG  199

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIA----TPREL  383
            +   G + G  YELGGP++ T  +L   M ++IR     V +PF IA  +     T   L
Sbjct  200  VT--GEAAGGTYELGGPDVDTFRELISQMLEIIRRRRLLVNIPFGIASVMGRVFETVSRL  257

Query  382  LLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKG  203
                VP  + +  + N      L  D +VSE A  FE LG  P  ++    EYL ++RKG
Sbjct  258  TGGLVPAQITSDQVIN------LRHDNVVSEGARGFETLGFEPASMEAVLPEYLWRFRKG  311

Query  202  GPQY  191
            G QY
Sbjct  312  G-QY  314



>gb|KJF68958.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium nepotum 39/7]
Length=326

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 101/180 (56%), Gaps = 14/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A++  FLPLIGGG TK QPVYV DVA A+  S+ 
Sbjct  147  LPGAVILRPSIIFGPEDDFFNKFAKMARSLPFLPLIGGGKTKFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            D     G +YELGG ++ T     E ++    R+ P +V +PF +A  I     L+    
Sbjct  206  DGKLKPGTIYELGGQDVMTFRDCLEAVLAATYRQRP-FVNLPFGVASMIGKIASLV----  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL TP +  +D +  L  D +VS    +N LT E +GI P ++      Y++QYR+ G
Sbjct  261  --PLITPPL-TVDQVTMLKKDNIVSADAEKNGLTLEGIGITPVRVASVLPSYMVQYRQHG  317



>ref|WP_007674128.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [alpha proteobacterium 
BAL199]
 gb|EDP64286.1| NADH-ubiquinone oxidoreductase 40 kDa subunit [alpha proteobacterium 
BAL199]
Length=317

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 95/178 (53%), Gaps = 10/178 (6%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P ATIL+P+++ G +D   N +A  A+    LPL GGG+TK QPVYV DVA A +A L D
Sbjct  145  PSATILRPSIVFGPDDSFFNRFAAMAQISPVLPLFGGGSTKFQPVYVDDVADAALAVL-D  203

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + G  +ELGGP I+T  QL ELM    R   + + +PF  A  +    EL       
Sbjct  204  RSDAAGATFELGGPTIYTFRQLLELMQAHTRRNRKLLPLPFWAASLLGGVLEL-------  256

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYG  188
             LP P +   D +E L  D +VS  A T  DLGI P  ++     Y+ ++R GG   G
Sbjct  257  -LPVPPV-TRDQVELLKRDNIVSAGAKTLADLGIEPTPVELILPSYMDKFRVGGRYSG  312



>ref|WP_034804481.1| 3-beta hydroxysteroid dehydrogenase [Ensifer adhaerens]
 gb|KDP70627.1| 3-beta hydroxysteroid dehydrogenase [Ensifer adhaerens]
Length=326

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 101/182 (55%), Gaps = 15/182 (8%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+V+ G ED   N +A  A+    LPLIGGG TK QPVYVTDVA A+  ++  
Sbjct  148  PDAIILRPSVVFGPEDGFFNKFANMARFSPVLPLIGGGETKFQPVYVTDVAEAVARAV--  205

Query  541  DGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            DGT + GK+YELGGP++ +     E+M + I      V +PF +A  I +   L+     
Sbjct  206  DGTIAKGKIYELGGPDVLSFRDCLEIMLNTIDRKRTLVSLPFGVASLIGSVSSLI-----  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
             P  TP +   D +  L +D +VS  A+    T   +GI P  L+     YL++YR  G 
Sbjct  261  -PFVTPPL-TADQVVLLKSDNVVSTKAVSEGRTLSGIGIDPTMLESILPTYLVRYRPQG-  317

Query  196  QY  191
            QY
Sbjct  318  QY  319



>ref|WP_017966662.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 95/186 (51%), Gaps = 17/186 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GKVYELGGPE+ +  +  E M  V     R + +PF IA  I +   L    +PF
Sbjct  207  GKVAGGKVYELGGPEVLSFRECLETMLKVTCRKNRLISLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P         YL+ YR  G
Sbjct  263  ITPPITP-----DQVRLLKRDNVVSREAEAEGRTLKGLGITPTMAASVLGSYLVHYRPHG  317

Query  199  PQYGST  182
             QY  T
Sbjct  318  -QYTGT  322



>ref|WP_009604313.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [SAR116 cluster 
alpha proteobacterium HIMB100]
 gb|EHI49131.1| putative nucleoside-diphosphate sugar epimerase [SAR116 cluster 
alpha proteobacterium HIMB100]
Length=315

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 99/181 (55%), Gaps = 10/181 (6%)
 Frame = -3

Query  742  RGCXREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASA  563
            R   R+ P+AT+L+P+++ G  D   N + Q A     LPLIGGG+  +QPVYV DVA A
Sbjct  141  RALLRQFPQATVLQPSIIFGPGDGFFNRFGQMAMIAPALPLIGGGSGLMQPVYVGDVAGA  200

Query  562  IIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPREL  383
            ++A+L  +  + G++Y+LGGP+ ++  +L     D +      + VPF +A   A    L
Sbjct  201  VLAALTTE-EARGQIYQLGGPQTYSFAELMRFTLDCVGRRRLLLPVPFAVASLPAAFASL  259

Query  382  LLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKG  203
                    LP P +  LD ++ L  D +  ++A    DLGIVP  ++G    YL+ +R G
Sbjct  260  --------LPNPPL-TLDQLKLLKVDNICKKSAPGLADLGIVPTAIEGVVPAYLMPFRPG  310

Query  202  G  200
            G
Sbjct  311  G  311



>gb|EGP09699.1| NAD-dependent epimerase/dehydratase [Bradyrhizobiaceae bacterium 
SG-6C]
Length=351

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 98/181 (54%), Gaps = 17/181 (9%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+++ G ED+  N +A  A+    LPLIGGG TK+QPVY  DVA+A IA   
Sbjct  175  LPSATIMRPSIVFGPEDQFTNRFAGLARLSPILPLIGGGLTKLQPVYAGDVATA-IADAV  233

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ T+ Q+ E +  + +     V +PF +A+         LK   
Sbjct  234  DGKAKAGATYELGGPEVMTMRQIIEDILKITQRDRMLVPLPFALAR---------LKSF-  283

Query  364  FPLPTPSIFNL--DVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
            F    P  F L  D +E L  D +VS+ A    LT E LGI P  L+     YL +YRK 
Sbjct  284  FLQFAPGDFKLTPDQVEMLRADNVVSDAAKAAGLTLEGLGITPDSLEAVTPSYLWRYRKT  343

Query  202  G  200
            G
Sbjct  344  G  344



>ref|WP_028745342.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium mesoamericanum]
Length=326

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 96/183 (52%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+   FLPLIGGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIFRPSVVFGPEDSFFNKFADMARVSPFLPLIGGGKTKFQPVYVVDVAQAVARAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T+ G+V+ELGGPE+ T  +  E+M        R V +PF IA  I     L+      
Sbjct  208  KVTA-GEVFELGGPEVLTFRECLEMMLKATWRKNRLVSLPFSIASLIGNVASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  + +VS+ A     T + +G+ P  +      YL+ YR  G  
Sbjct  261  PFITPPI-TADQVRLLKKNNIVSKEAEAEGRTLKGIGVTPTLVSSVIGSYLVHYRPHGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_037114878.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. OV201]
Length=326

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 97/183 (53%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+    LPLIGGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIYRPSVVFGPEDSFFNKFADMARIAPVLPLIGGGKTKFQPVYVVDVAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + G++YELGGPE+ T  +  E+M        R V +PF IA  I +   L+      
Sbjct  208  K-VAGGEIYELGGPEVLTFRECLEIMLKATWRKNRLVSIPFGIASLIGSIASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  D +VS++A     T + +G+ P  +      YL+QYR  G  
Sbjct  261  PFITPPI-TADQVRLLKKDNIVSKDAEAEDRTLKGIGVTPTLVSSVIGSYLVQYRPHGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_039846586.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium gallicum]
 gb|AJD39699.1| NAD-dependent nucleoside-diphosphate-sugar epimerase protein 
[Rhizobium gallicum bv. gallicum R602]
Length=326

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 95/182 (52%), Gaps = 12/182 (7%)
 Frame = -3

Query  718  EATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDD  539
            +A I +P+++ G ED   N +A+ A+    LPLIGGG TK+QPVYV DVA A+  +++  
Sbjct  149  DAIIFRPSIVFGPEDGFFNKFAEMARLSPVLPLIGGGKTKLQPVYVEDVAEAVARAVEGK  208

Query  538  GTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFP  359
                G +YELGGPE+ T  +  ++M  +     R V +PF IA  I +   L    VPF 
Sbjct  209  AAG-GTIYELGGPEVLTFRECLQVMLKITARKNRLVSIPFSIASLIGSVASL----VPFV  263

Query  358  LPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQY  191
             P       D +  L  D +VS  A    LT + LG+ P  L      YL++YR  G   
Sbjct  264  KPP---ITADQVRLLKRDNVVSTKAETDGLTLKALGVTPTMLTSVLPSYLVRYRPHGQYT  320

Query  190  GS  185
            GS
Sbjct  321  GS  322



>ref|WP_034992883.1| 3-beta hydroxysteroid dehydrogenase [Beijerinckia mobilis]
Length=336

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 101/181 (56%), Gaps = 9/181 (5%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PE  IL+P+V+ G ED   N +A  A+    LPLIGGG TK+QPV+V DVA A+  SL 
Sbjct  150  LPEGIILRPSVVFGPEDDFFNRFAAMARISPALPLIGGGKTKLQPVFVGDVAKAVAGSLN  209

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
             +    G +YELGGPEI ++ ++ E +   I      + +PFP+AK +A   E + + + 
Sbjct  210  GN-VKTGTIYELGGPEIRSMREIMEFILATIERQRLLLPIPFPLAKLVAFGTE-IAEALS  267

Query  364  FPLPTPSIFNL--DVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
              L  PS F+L  D +E L  D +VSE A     + +  G+ P   +     YL ++RK 
Sbjct  268  LGL-FPSTFSLTRDQVELLRRDNIVSEEAKAEGRSLQAFGLEPESFETIVPTYLYRFRKA  326

Query  202  G  200
            G
Sbjct  327  G  327



>ref|WP_028164836.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium elkanii]
Length=329

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 99/178 (56%), Gaps = 13/178 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P ATIL+P+++ G ED+  N +A  A+    +PL+GGG TK+QP +V DVA+A +A   D
Sbjct  147  PSATILRPSLVFGPEDQFTNRFAAMARMSPAIPLVGGGLTKMQPTFVGDVATA-VADAVD  205

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T  G  YELGGPE+ T+ ++ E + ++       V +PF +A+ +A      L+  P 
Sbjct  206  GKTKPGATYELGGPEVLTMREIMETILEITDRDRALVSLPFGLARILAA----FLQFAPG  261

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             L        D +E L  D +VS+ A    LTFE LGI P  L+    +YL ++R  G
Sbjct  262  ALK----LTADQVELLRKDNVVSDTAKAAGLTFEGLGITPDSLEAIAPQYLWRFRPAG  315



>ref|WP_007763297.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
CF080]
 gb|EUC00531.1| hypothetical protein PMI07_003817 [Rhizobium sp. CF080]
Length=326

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 97/185 (52%), Gaps = 14/185 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+A IL+P+++ G ED   N +A  A+ +  LPLIGGG TK QPVYV DVA  +  S+ 
Sbjct  147  LPDAIILRPSIVFGPEDSFFNKFASMARTFPALPLIGGGKTKFQPVYVEDVAETVARSV-  205

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT + GK+YELGG E+ T  Q  E +  V       V +PF IA  I +   L    +
Sbjct  206  -DGTIASGKIYELGGGEVMTFRQCLETVLRVTNRSNALVSLPFGIASLIGSIASL----I  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            PF  P       D ++ L  D +VS+ A     T + +GI P         YL+QYR  G
Sbjct  261  PFVQPP---ITSDQVKLLKVDNVVSDAAAAEGRTLQGIGIRPTLASSILPSYLVQYRPQG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QYTGS  322



>ref|WP_002717736.1| hypothetical protein [Afipia felis]
 gb|EKS30141.1| hypothetical protein HMPREF9697_02669 [Afipia felis ATCC 53690]
Length=321

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 99/179 (55%), Gaps = 16/179 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+ATI++P+++ G ED   N +A  A+ +  LPLIG   TK+QPVYV DVASAI A   D
Sbjct  147  PDATIIRPSIVFGPEDHFTNRFAALARLFPALPLIGA-DTKLQPVYVGDVASAI-ADAVD  204

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T  G  YELGGPE+ T+ +  EL+  V    P  V +PF +AK  A      L+  P 
Sbjct  205  GKTKAGATYELGGPEVMTMREAIELILRVAERDPMLVPLPFGLAKLQAA----FLQFAPG  260

Query  361  PLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             L  TP     D +E L TD +VS+ A    LT E LGI P  +      YL ++RK G
Sbjct  261  DLKLTP-----DQVEMLKTDNVVSDAAKSAGLTLEGLGIAPESMAAVLPSYLWRFRKTG  314



>ref|WP_018116836.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium]
Length=326

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 98/183 (54%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIYRPSVVFGPEDSFFNKFADMARIAPALPLVGGGKTKFQPVYVVDVAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T+ G+VYELGGPE+ T  +  E+M        R V +PF IA  I +   L+      
Sbjct  208  KVTA-GQVYELGGPEVLTFRECLEVMLKTTWRKNRLVSLPFGIASLIGSIASLI------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I + D +  L  D +VS+ A     T + +G+ P  +      YL+QYR  G  
Sbjct  261  PFVTPPITS-DQVRLLKKDNVVSKEAETEGRTLKGIGVTPTLVNSVIGSYLVQYRPHGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_018855187.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
42MFCr.1]
Length=326

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 98/183 (54%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+V+ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIYRPSVVFGPEDSFFNKFADMARIAPALPLVGGGKTKFQPVYVVDVAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T+ G+VYELGGPE+ T  +  E+M        R V +PF IA  I +   L+      
Sbjct  208  KVTA-GQVYELGGPEVLTFRECLEVMLKTTWRKNRLVSLPFGIASLIGSIASLI------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I + D +  L  D +VS+ A     T + +G+ P  +      YL+QYR  G  
Sbjct  261  PFVTPPITS-DQVRLLKKDNVVSKEAETEGRTLKGIGVTPTLVNSVIGSYLVQYRPHGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_018899326.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
2MFCol3.1]
Length=326

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 98/181 (54%), Gaps = 13/181 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A++  FLPLIGGG TK+QPVYV DVA A+  +++ 
Sbjct  148  PDAIIYRPSIVFGPEDGFFNKFAGMARSAPFLPLIGGGKTKLQPVYVMDVAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GK+YELGGPE+ T  Q  E +          V +PF +A  I +   ++      
Sbjct  208  K-VAGGKIYELGGPEVLTFRQCLEAVLKSTARTNPLVSLPFGVASLIGSVASMI------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL  P I   D ++ L  D +VS+ A     T  DLGI P  +      YL+Q+R  G Q
Sbjct  261  PLIAPPI-TADQVKLLKKDNVVSKEAETEGRTLRDLGIAPTMVSSVIDSYLVQFRPQG-Q  318

Query  193  Y  191
            Y
Sbjct  319  Y  319



>ref|WP_017269127.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase, partial [Sinorhizobium 
meliloti]
Length=206

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 100/183 (55%), Gaps = 15/183 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVYVTDVA A+  S+ 
Sbjct  27   LPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVYVTDVAEAVARSV-  85

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT + G +YELGGP++ +  +  ++M   I     +V +PF IA  + +   L    V
Sbjct  86   -DGTLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIASLMGSVASL----V  140

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            PF  P       D +  L +D +VS  A     T   +GI P  L+     YL++YR  G
Sbjct  141  PFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLESILPTYLVRYRPHG  197

Query  199  PQY  191
             QY
Sbjct  198  -QY  199



>ref|WP_011642056.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Maricaulis maris]
 gb|ABI64409.1| NAD-dependent epimerase/dehydratase [Maricaulis maris MCS10]
Length=321

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 102/176 (58%), Gaps = 7/176 (4%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P+ATIL+P+++ GTED   N +A  A+    LPL GGG T+ QPV+  DV  A++A+ +
Sbjct  145  MPDATILRPSIVFGTEDSFFNRFAAMARFVPALPLFGGGKTRFQPVFAGDVGKAVLAAFE  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVK-VPFPIAKAIATPRELLLKKV  368
               T  G+ YELGGP ++T  +L   + D I + PR++  +P+ I K IAT  EL+    
Sbjct  205  RSDTR-GQTYELGGPGVYTFEELMRFILDEI-DRPRFLLPLPWAIGKVIATVSELV---G  259

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL  P +   D +  L +D +V+++A    DLGI    ++     YL +YR+ G
Sbjct  260  ALPL-MPVLITRDQLVQLQSDNVVADDAKGLADLGIAGETVEAIVPGYLERYRRYG  314



>ref|XP_005971320.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex 
subunit 9, mitochondrial-like [Pantholops hodgsonii]
Length=326

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 99/180 (55%), Gaps = 14/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A++  FLPLIGGG T+ QPVYV DVA A+  S+ 
Sbjct  147  LPGAVILRPSIIFGPEDDFFNKFAKMARSLPFLPLIGGGKTRFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            D     G +YELGG ++ T     E ++    RE P +V +PF IA  I     L+    
Sbjct  206  DGKLKPGSIYELGGQDVMTFRDCLEAVLAATYRERP-FVNLPFGIASTIGKIASLV----  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL TP +   D +  L  D +VS    +N LT E +GI P ++      Y++QYR  G
Sbjct  261  --PLITPPL-TADQVTMLKKDNVVSAEAEKNGLTLEGIGITPVRVASVLPSYMVQYRPHG  317



>ref|WP_038328123.1| hypothetical protein [alpha proteobacterium SCGC AAA240-E13]
Length=311

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 102/185 (55%), Gaps = 11/185 (6%)
 Frame = -3

Query  742  RGCXREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASA  563
            +        + IL+P+++ G ED+  N +A  A  +  LPLIGGG TK QP+YV+D+   
Sbjct  138  KNILNNFNRSVILRPSLIFGPEDKFFNQFASLAAFFPALPLIGGGKTKFQPIYVSDLCKV  197

Query  562  IIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPREL  383
            I+A ++ +  +   +YELGGP+IFT  +L E++   +++   ++ +PF  AK  A     
Sbjct  198  IVAIIEKEEINEN-IYELGGPQIFTFKELMEILLVHVKKKRLFISIPFSFAKFQAK----  252

Query  382  LLKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKG  203
            +L+  P PL T      D +E L  D +V+ N  T +D  I P  +      Y+ ++RKG
Sbjct  253  ILQLFPKPLLTT-----DQVEILKYDNVVTNNYPTIKDFKINPKTIDSILPNYIWRFRKG  307

Query  202  GPQYG  188
            G Q+G
Sbjct  308  G-QFG  311



>ref|WP_044427727.1| 3-beta hydroxysteroid dehydrogenase [Skermanella aerolata]
 gb|KJB96015.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Skermanella aerolata 
KACC 11604]
Length=321

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 101/177 (57%), Gaps = 10/177 (6%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +  PEATIL+P+V+ G ED   N +   A+    LPLIGGG TK QPVYV DVA AI+ +
Sbjct  144  KAFPEATILRPSVVFGPEDGFFNRFGAMARISPVLPLIGGGHTKFQPVYVGDVADAIMKA  203

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            L++   ++GK YELGGP +++  ++  L+    R     V VP+ +A+     +  +L K
Sbjct  204  LENP-AALGKTYELGGPRVYSFKEIMGLVLTETRRKRIMVTVPWGVAEL----QGKILGK  258

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            +P PL T     +D +E L  D +V+  A T  DLG+ P   +     YL ++R GG
Sbjct  259  LPKPLLT-----VDQVELLKRDNVVAPGAATLADLGVEPTAAEVIIPTYLDRFRVGG  310



>ref|WP_008972707.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Bradyrhizobium 
sp. STM 3843]
 emb|CCE10197.1| conserved hypothetical protein [Bradyrhizobium sp. STM 3843]
Length=322

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 100/180 (56%), Gaps = 15/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI++P+V+ G ED   N +A  A+   FLPLIGGG T++QPVYV DVA+A IA   
Sbjct  146  LPTATIMRPSVVFGPEDDFTNRFAGLARISPFLPLIGGGATRMQPVYVGDVATA-IADAV  204

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGGPE+ +  ++ E++ D+       + +PF +AK  A      L+  P
Sbjct  205  DGKARAGATYELGGPEVLSFREIIEIILDITDRKRMLLSLPFGLAKFQAA----FLQFAP  260

Query  364  FPLP-TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  TP     D +E L +D +VS+ A     T + L I P  L+    +YL ++R  G
Sbjct  261  GPLKLTP-----DQVELLRSDNVVSDAAQADGRTLQGLSITPDSLEAVGPQYLWRFRPAG  315



>ref|WP_034514069.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium rhizogenes]
Length=326

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 97/183 (53%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+  I++P+++ G ED   N +A  ++   FLPLIGGG TK QPVYV D+A A+  S+ D
Sbjct  148  PDTVIMRPSIVFGPEDGFFNKFADMSRTAPFLPLIGGGETKFQPVYVEDIAEAVARSV-D  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 G  YELGGPE+ +  +  E    VI      V +PF +A  I +   L+      
Sbjct  207  GKLKGGTTYELGGPEVLSFRECLETTLSVINRKKSLVSIPFAVASLIGSIASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL TP I   D +  L +D +VS+ A     T +D+G++P  L      YL++YR  G  
Sbjct  261  PLITPPI-TPDQVTLLKSDNVVSKQAEAEGRTLKDIGLLPTLLISVLPSYLVRYRPQGQF  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_035581487.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonas jannaschiana]
 gb|KCZ88641.1| putative NADH-quinone oxidoreductase [Hyphomonas jannaschiana 
VP2]
Length=329

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 107/181 (59%), Gaps = 9/181 (5%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATIL+P+V+ G ED   N +AQ A+    +P IGGG TK+QPVY  DVA AI  ++ 
Sbjct  144  VPTATILRPSVVFGPEDEFFNKFAQMARVAPLMPAIGGGKTKMQPVYAGDVAEAIAVAV-  202

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRY-VKVPFPIAKAIATPRELLLKKV  368
            DD ++ GK YELGGP ++T++++ + +   I + PR+ V +PF  AK +      + + V
Sbjct  203  DDASTEGKTYELGGPRVYTMNEIYDFICATI-DRPRFKVTLPFFAAKPLGYLSGAVWRYV  261

Query  367  -PFP---LPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVP-HKLKGYPVEYLIQYRKG  203
             PF    L  P +   D +E L TD +V+++ALT  DLG+     ++     YL ++R  
Sbjct  262  PPFSWGFLGQPPVTG-DQVEMLKTDNVVADDALTLADLGVTTLESVEAIVPTYLWRFRDY  320

Query  202  G  200
            G
Sbjct  321  G  321



>ref|WP_025029733.1| 3-beta hydroxysteroid dehydrogenase, partial [Nitratireductor 
aquibiodomus]
Length=217

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 98/179 (55%), Gaps = 14/179 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            + +A I++P+++ G ED   N +A  A+   FLPLIGGG TK QPVYV DVA A   S+ 
Sbjct  41   VKDAVIIRPSIVFGPEDDFFNRFANMARFSPFLPLIGGGETKFQPVYVGDVAEAYARSVD  100

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
             D    G++YELGGPE+ +  +  E M +       +V +P+ +A+  A     +L+ +P
Sbjct  101  GD-LEGGQIYELGGPEVLSFRECLEEMLEATYRKRWFVSLPWFVARIQAR----ILQLLP  155

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             P+ T     LD ++ L TD +VSE A     T + LGI  H L      YL +YR  G
Sbjct  156  KPMLT-----LDQVKLLKTDNVVSEEANAAGRTLDGLGIQKHSLAAILPTYLWRYRPAG  209



>ref|WP_027574763.1| 3-beta hydroxysteroid dehydrogenase [Bradyrhizobium sp. WSM1743]
Length=321

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 98/181 (54%), Gaps = 18/181 (10%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P ATI +P+VM G ED+  N +A  A+    LPLI GG+T++QPVYV DVA+A IA   
Sbjct  146  VPSATIFRPSVMFGPEDQFTNRFAALARMSPVLPLI-GGSTRMQPVYVGDVATA-IADAA  203

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D    +G  YELGGPE+ T+ ++ + + D+       + +PF +A+  A           
Sbjct  204  DGKAKVGATYELGGPEVLTMREIIQTILDITDRQRMLIPLPFGLARFQAN----------  253

Query  364  FPLPTPSIFNL--DVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKG  203
            F    P  F L  D +  L  D +VSE+A    LT E LGI P  L+    +YL ++R  
Sbjct  254  FLQFAPGAFKLTPDQVTLLERDNVVSESAKAAGLTLEGLGITPDSLEAIAPQYLWRFRAA  313

Query  202  G  200
            G
Sbjct  314  G  314



>ref|WP_003544730.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
 gb|EJC69053.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium leguminosarum 
bv. viciae WSM1455]
Length=326

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 95/186 (51%), Gaps = 17/186 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A+ A+    LPLIGGG TK QPVYV D+A A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLIGGGKTKFQPVYVEDIAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GKVYELGGPE+ +  +  E M  V       V +PF IA  I +   L    VPF
Sbjct  207  GKVAGGKVYELGGPEVLSFRECLETMLKVTCRRNPLVSLPFGIASMIGSIASL----VPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P  +      YL+ YR  G
Sbjct  263  ITPPITP-----DQVRMLKRDNVVSREAEAEGRTLKGLGIAPTMVASVLGSYLVHYRPHG  317

Query  199  PQYGST  182
             QY  T
Sbjct  318  -QYTGT  322



>ref|WP_034766843.1| 3-beta hydroxysteroid dehydrogenase [Hyphomonas sp. CY54-11-8]
 gb|KCZ47066.1| hypothetical protein HY17_06570 [Hyphomonas sp. CY54-11-8]
Length=329

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 94/159 (59%), Gaps = 6/159 (4%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP ATIL+P+V+ G ED   N +AQ A+    +P IGGG TK+QPVY  DVA AI  ++ 
Sbjct  144  IPTATILRPSVVFGPEDEFFNRFAQMARVAPLMPAIGGGKTKMQPVYAGDVAEAIAVAVD  203

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRY-VKVPFPIAKAIATPRELLLKKV  368
            D+ T  GK YELGGP ++T++++ + +   I   PR+ + +PF  AK I      + + V
Sbjct  204  DEATE-GKTYELGGPRVYTMNEIYDFVCKTISR-PRFKITLPFFAAKPIGYLSGAVWRYV  261

Query  367  P---FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGI  260
            P   +     +    D +E L TD +V+E ALT  DLG+
Sbjct  262  PPFSWGFLGDAPVTGDQVELLKTDNVVAEGALTLADLGV  300



>ref|WP_027674017.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium larrymoorei]
Length=326

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 93/179 (52%), Gaps = 12/179 (7%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEA IL+P+++ G ED   N +A  A+   FLPLIGGG TK QPVYV DVA A+  S+ 
Sbjct  147  LPEAIILRPSIVFGPEDDFFNKFAGMAQRLPFLPLIGGGKTKFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G  YELGG ++ T  Q  E +        R V +PF IA  + +   L+     
Sbjct  206  DGALKSGSTYELGGQDVMTFRQCLEAVLTATYRQNRLVNLPFGIASLLGSVASLI-----  260

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             PL  P + + D +  L  D +VS  A    LT + +GI P ++      YL+ YR  G
Sbjct  261  -PLIKPPLTS-DQVALLKNDNVVSAEAEKAGLTLDGIGITPVRVSSVLPSYLVSYRPHG  317



>ref|WP_037188156.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. YR519]
Length=326

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 97/183 (53%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPLIGGG T+ QPVYV D+A A+  +++ 
Sbjct  148  PDAVIYRPSIVFGPEDDFFNKFADMARMAPVLPLIGGGKTRFQPVYVMDIAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 GKVYELGGPE+ T  +  E +          V +PF +A  I +   L+      
Sbjct  208  K-VEGGKVYELGGPEVLTFRECLEAVLKATSRKNPLVSIPFGLASLIGSVASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL  P I + D +  L TD +VS+ A     T +D+G+VP  +      YL+QYR  G  
Sbjct  261  PLIKPPITS-DQVRLLKTDNVVSKEAEAEGRTLKDIGVVPTMVGSVVDSYLVQYRPQGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_037130671.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. CF394]
Length=326

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 96/183 (52%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A+ A+    LPLIGGG TK QPVYV DVA A+  +++ 
Sbjct  148  PDAIIYRPSIVFGPEDSFFNKFAEMARIAPALPLIGGGKTKFQPVYVVDVAEAVAKAVEG  207

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T  G++YELGGPE+ T  +  E M        R V +PF IA  I +   L+      
Sbjct  208  KVTG-GEIYELGGPEVLTFRECLEAMLKATWRKNRLVSLPFGIASLIGSVASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  D +VS+ A     T + +G+ P  +      YL+QYR  G  
Sbjct  261  PFITPPI-TADQVRLLKKDNVVSKEAEAAGRTLKGIGVTPTLVNSVLSSYLVQYRPHGQY  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_036260034.1| 3-beta hydroxysteroid dehydrogenase [Methylocapsa aurea]
Length=335

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 96/178 (54%), Gaps = 5/178 (3%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I++P+V+ G ED   N +A  A+    LPLIGGG TK+QPV+V DVA+AI  +++ 
Sbjct  151  PDAIIMRPSVVFGPEDEFFNRFAAMARFMPALPLIGGGETKLQPVFVGDVATAIALAVEG  210

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
              T+ G  YELGGP+I T+ ++ E + ++         + F  AK I    E   K    
Sbjct  211  KATA-GATYELGGPDIATLRRIIEFILEITERKRWLAPISFEQAKLIGGVTEFAKKASLG  269

Query  361  PLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P     + D +E L TD +VS  A+    T + LGI P   + +   YL +YRK G
Sbjct  270  LFPELLTISPDQVELLQTDNVVSRQAIAERRTLDGLGITPESFEAFTPSYLYRYRKTG  327



>ref|WP_034833137.1| 3-beta hydroxysteroid dehydrogenase [Inquilinus limosus]
 gb|KGM35114.1| 3-beta hydroxysteroid dehydrogenase [Inquilinus limosus MP06]
Length=320

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 97/181 (54%), Gaps = 11/181 (6%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
             P A+IL+P+V+ G ED   N +A  A+   FLPL GGGTT+ QPVYV DVA+AI+A L+
Sbjct  148  FPGASILRPSVIFGPEDGFFNLFANLARTAPFLPLFGGGTTRFQPVYVRDVAAAIVACLE  207

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
             DGT+ G+ YELGGP ++T+ ++ +L         R V + + +A           +   
Sbjct  208  RDGTA-GQTYELGGPRVYTLREIMQLTLQQTGRKKRLVPLSWGMAA---------FEAKL  257

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGGPQYGS  185
              L        D +  L  D +V   A T  DLGI P   +     YL +YR GG ++G+
Sbjct  258  LGLLPKPPLTSDQVTQLKIDNVVGAGARTLTDLGITPTPAELILPSYLDRYRPGG-RFGN  316

Query  184  T  182
            +
Sbjct  317  S  317



>ref|WP_012040577.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Bradyrhizobium 
sp. BTAi1]
 gb|ABQ32520.1| hypothetical protein BBta_0224 [Bradyrhizobium sp. BTAi1]
Length=322

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 100/175 (57%), Gaps = 15/175 (9%)
 Frame = -3

Query  709  ILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDDGTS  530
            I++P+V+ G ED+  N +A  A+   FLPLIGGG TK+QPVYV DVA+A +A   D    
Sbjct  151  IMRPSVVFGPEDQFTNRFAGLARISPFLPLIGGGETKMQPVYVGDVATA-VADAVDGKAQ  209

Query  529  MGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFPLP-  353
             G  YELGGPE+ +  ++ +++ D+       + +PF +A+  A     LL+  P PL  
Sbjct  210  AGATYELGGPEVLSFREILKIILDITDRDRALLPLPFGLARLQAA----LLQFAPGPLKL  265

Query  352  TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            TP     D +E L +D +VSE A    LT + LGI P  L+    +YL ++R  G
Sbjct  266  TP-----DQVELLRSDNVVSETAKAAGLTLQGLGITPDSLEAIGPQYLWRFRPAG  315



>ref|WP_003589083.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
 gb|ACI57581.1| NAD-dependent epimerase/dehydratase [Rhizobium leguminosarum 
bv. trifolii WSM2304]
 gb|EJB04576.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium leguminosarum 
bv. trifolii WSM597]
Length=326

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 94/186 (51%), Gaps = 17/186 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPLIGGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLIGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GKVYELGGPE+ +  +  E+M  V       V +PF IA  I +   L    +PF
Sbjct  207  GKVAGGKVYELGGPEVLSFRECLEMMLKVTSRKNPLVSLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P         YL+ YR  G
Sbjct  263  ITPPITP-----DQVRMLKHDNIVSREAEAEGRTLKGLGIAPTMAASVLGSYLVHYRPHG  317

Query  199  PQYGST  182
             QY  T
Sbjct  318  -QYTGT  322



>ref|WP_023431376.1| NAD-dependent epimerase/dehydratase [Lutibaculum baratangense]
 gb|ESR25896.1| NAD-dependent epimerase/dehydratase [Lutibaculum baratangense 
AMV1]
Length=330

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 96/179 (54%), Gaps = 14/179 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P++M G ED+  N +A  A+   FLPLIGGG T+ QPV+V DV  A +A   
Sbjct  149  VPGAVILRPSIMFGQEDQFFNRFAAMARMSPFLPLIGGGQTRFQPVFVGDVGEA-VARAV  207

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D   + G  YELGGPEI T  QL ELM  VI      + VPF  A  +A     +L  +P
Sbjct  208  DGKATPGCTYELGGPEIRTFRQLMELMLHVIGRKRVLLNVPFGAADRLAG----VLGALP  263

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              L T      D +  L  D +VS+ A+    T E LGI P  ++     YL ++R+ G
Sbjct  264  GRLLTT-----DQVIQLRHDNVVSQAAIEEGRTIEALGIDPVGMEAILPTYLQRFRRAG  317



>ref|WP_026613537.1| 3-beta hydroxysteroid dehydrogenase [Ensifer sp. TW10]
Length=326

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 95/185 (51%), Gaps = 13/185 (7%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +PEA IL+P+++ G ED   N +A  A+    LPL+GGG TK QPVYV DVA A +A   
Sbjct  147  VPEAVILRPSIIFGPEDDFFNKFAGMARLSPVLPLVGGGHTKFQPVYVADVAEA-VARAV  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D     G +YELGGP++ T  +  E+M   I    R+V +PF IA  + +   L    VP
Sbjct  206  DGKLKGGTIYELGGPQVLTFRECLEIMLKTIDRKRRFVSIPFGIASLMGSVASL----VP  261

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
            F  P       D +  L TD +VS  A     T   +GI    L      YL++YR  G 
Sbjct  262  FITPP---LTADQVVLLKTDNVVSAEAEAEGRTLAGIGIKSTMLDSILPTYLVRYRPQG-  317

Query  196  QYGST  182
            QY  T
Sbjct  318  QYTGT  322



>ref|WP_008524875.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium sp. 
Pop5]
 gb|EJZ22117.1| NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein [Rhizobium 
sp. Pop5]
Length=326

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 95/186 (51%), Gaps = 17/186 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A  A+    LPL+GGG TK QPVYV D+A A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFADMARMSPVLPLVGGGKTKFQPVYVEDIAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GK+YELGGPE+ T  +  E+M  V       V +PF IA  I +    +   +PF
Sbjct  207  GKVAGGKIYELGGPEVLTFRECLEMMLKVTNRKNPLVSLPFGIASMIGS----IASMIPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P         YL+QYR  G
Sbjct  263  ITPPITP-----DQVRLLKHDNIVSREAEAEGRTLKGLGITPTMPASVLGSYLVQYRPHG  317

Query  199  PQYGST  182
             QY  T
Sbjct  318  -QYTGT  322



>ref|WP_028750945.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leucaenae]
Length=326

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 96/185 (52%), Gaps = 16/185 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+++ G ED   N +A  ++   FLPL+GGG TK QPVYV DVA A+   + D
Sbjct  148  PDAVILRPSIVFGPEDGFFNKFADMSRTAPFLPLVGGGQTKFQPVYVEDVAEAVARGV-D  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 G +YELGGPE+ T  +  E    VI      V +PF +A  I      +   VPF
Sbjct  207  GKLKAGTIYELGGPEVLTFRECLETTLSVINRKKSLVSLPFGLASFIGG----IASAVPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS+ A     T +D+G++P  L      YL++YR  G
Sbjct  263  ITPPITP-----DQVRLLKHDNVVSKEAEAEGRTLKDIGLMPTLLISVLPSYLVRYRPQG  317

Query  199  PQYGS  185
               GS
Sbjct  318  QFTGS  322



>ref|WP_007702838.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium/Agrobacterium 
group]
 gb|ACM25198.1| NADH dehydrogenase/NADH dehydrogenase (ubiquinone) protein [Agrobacterium 
radiobacter K84]
 gb|EJK78616.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium sp. 
AP16]
 dbj|GAJ94505.1| hypothetical protein RRH01S_08_02440 [Rhizobium rhizogenes NBRC 
13257]
 gb|KEA04982.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium rhizogenes]
Length=326

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 99/183 (54%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+++ G ED   N +A  +++  FLPLIGGG TK QPVYV DVA A+   + D
Sbjct  148  PDAVILRPSIVFGPEDGFFNKFADMSRSAPFLPLIGGGKTKFQPVYVEDVAEAVARGV-D  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 G +YELGGPE+ +  +  E    VI      V +PF +A  I +   L+      
Sbjct  207  GKLKAGTIYELGGPEVLSFRECLETTLAVINRKKPLVSIPFGLASLIGSVASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL TP I + D +  L +D +VS+ A     T + +G++P  L      YL++YR  G  
Sbjct  261  PLITPPITS-DQVTLLKSDNVVSKEAEAEGRTLKGIGLLPTLLISVLPSYLVRYRPQGQF  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_028096083.1| 3-beta hydroxysteroid dehydrogenase [Dongia sp. URHE0060]
Length=316

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 97/177 (55%), Gaps = 7/177 (4%)
 Frame = -3

Query  730  REIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIAS  551
            +  P ATI +P+++ G ED   N +A+ A     LPLIGGGTT+ QPVYV DVA AI  +
Sbjct  142  KAFPAATIFRPSIVFGPEDGFFNRFAKMALLAPALPLIGGGTTRFQPVYVLDVAEAISRA  201

Query  550  LKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKK  371
            +++     GK+YELGGP I++  +L  +M   I        +PF    A+A+ +  +L+ 
Sbjct  202  IENPAAYGGKIYELGGPRIYSFRELMTVMLAEIGRKRWLCSMPF----ALASLQGAVLQA  257

Query  370  VPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            +PF  P      +D ++ L  D +V   A  F+ LGI P  L+     YL +YR  G
Sbjct  258  IPFIQPP---LTVDQVKLLKRDNVVGPQAAGFKSLGITPTALEPILPTYLDRYRPHG  311



>ref|WP_015089185.1| short chain dehydrogenase family protein [Candidatus Endolissoclinum 
faulkneri]
 gb|AFX99687.1| short chain dehydrogenase family protein [Candidatus Endolissoclinum 
faulkneri L2]
Length=314

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 99/173 (57%), Gaps = 10/173 (6%)
 Frame = -3

Query  718  EATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDD  539
            EA IL+P+++ G +D   N +A  A+    LPLIGGGT+K QPVYV D+A AIIA+L + 
Sbjct  146  EAIILRPSIVFGKDDSFFNKFAYMAQVLPILPLIGGGTSKFQPVYVIDLAEAIIAAL-NT  204

Query  538  GTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFP  359
              + G+ YE+GGP +++  +L E++          +++PF      A+ + LLL+  P P
Sbjct  205  PAAYGQTYEVGGPSVYSFRELMEIILKETNRKVLLIRIPF----WFASLKALLLELTPNP  260

Query  358  LPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            + T      D +E L  D +VS +A T  DL I P  ++     YL +YR GG
Sbjct  261  ILTR-----DQVELLKMDNIVSHDAKTINDLFIKPTPIEIIIPTYLNKYRPGG  308



>ref|WP_015241008.1| putative nucleoside-diphosphate-sugar epimerase [Sinorhizobium 
meliloti]
 gb|AGA05314.1| putative nucleoside-diphosphate-sugar epimerase [Sinorhizobium 
meliloti GR4]
Length=326

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 100/183 (55%), Gaps = 15/183 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+    LPLIGGG TK QPVYVTDVA A+  S+ 
Sbjct  147  LPAAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTKFQPVYVTDVAEAVARSV-  205

Query  544  DDGT-SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
             DGT + G +YELGGP++ +  +  ++M   I     +V +PF IA  + +   L    V
Sbjct  206  -DGTLTGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIASLMGSVASL----V  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            PF  P       D +  L +D +VS  A     T   +GI P  L+     YL++YR  G
Sbjct  261  PFITPP---LTADQVVLLKSDNVVSAKAEAEGRTLAGIGIEPTMLESILPTYLVRYRPHG  317

Query  199  PQY  191
             QY
Sbjct  318  -QY  319



>ref|WP_033181246.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 96/186 (52%), Gaps = 17/186 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GKVYELGGPE+ +  +  E M  V       V +PF IA  I +   L    +PF
Sbjct  207  GKVAGGKVYELGGPEVLSFRECLETMLRVTCRKNPLVSLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS+ A     T + LGI P  +      YL+ YR  G
Sbjct  263  ITPPITP-----DQVRMLKRDNVVSKEAEAEGRTLKGLGIAPTMVASVLGSYLVHYRPHG  317

Query  199  PQYGST  182
             QY  T
Sbjct  318  -QYTGT  322



>ref|WP_015338537.1| NADH dehydrogenase [Rhizobium tropici]
 gb|AGB69806.1| NADH dehydrogenase [Rhizobium tropici CIAT 899]
Length=326

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 96/183 (52%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+++ G ED   N +A  ++   FLPLIGGG TK QPVYV D+A  +  S+ D
Sbjct  148  PDAIILRPSIVFGPEDEFFNKFADMSRTAPFLPLIGGGKTKFQPVYVQDIAETVARSV-D  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 G  YELGGPE+ +  +  E    VI     +V +PF +A  I +   L+      
Sbjct  207  GKLKAGTTYELGGPEVLSFRECLETTLAVINRKKSFVSIPFGLASLIGSVASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL  P I   D +  L +D +VS+ A     T + +G++P  L      YL++YR  G  
Sbjct  261  PLIKPPI-TADQVTLLKSDNVVSKQAEAEGRTLKGIGLLPTLLVSVLPSYLVRYRPQGQF  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_038541460.1| hypothetical protein, partial [endosymbiont of Acanthamoeba sp. 
UWC8]
Length=305

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 95/167 (57%), Gaps = 10/167 (6%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P + I++P+V+ G ED  +N +A+    +  +PLIGGG T+ QPVYV+DVA A+   L  
Sbjct  149  PNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRFQPVYVSDVAKAVGRCLVK  208

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +AT           
Sbjct  209  DNIC-GKVFELGGSKVYTLREIYELIFKLIGKKKPLVSIPFIFAKVMATVL---------  258

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  221
             L    +   D +E L TD ++ +N   FE+LG+ P  ++    EY+
Sbjct  259  TLLPRPLLTCDQVELLKTDNIIVKNKNGFEELGLTPTSMEAVLSEYI  305



>ref|WP_018485276.1| 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 95/186 (51%), Gaps = 17/186 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GKVYELGGPE+ +  +  E M  V       V +PF IA  I +   L    +PF
Sbjct  207  GKVAGGKVYELGGPEVLSFRECLETMLKVTCRKNPLVSLPFGIASMIGSIASL----IPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P  +      YL+ YR  G
Sbjct  263  ITPPITP-----DQVRLLKRDNIVSREAEAEGRTLKGLGIAPTMVASVLGSYLVHYRPHG  317

Query  199  PQYGST  182
             QY  T
Sbjct  318  -QYTGT  322



>gb|AIF81505.1| NADH dehydrogenase (ubiquinone) [endosymbiont of Acanthamoeba 
sp. UWC8]
Length=306

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 95/167 (57%), Gaps = 10/167 (6%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P + I++P+V+ G ED  +N +A+    +  +PLIGGG T+ QPVYV+DVA A+   L  
Sbjct  149  PNSVIIRPSVVFGREDNFINMFAKLVAVFPVIPLIGGGRTRFQPVYVSDVAKAVGRCLVK  208

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
            D    GKV+ELGG +++T+ ++ EL++ +I +    V +PF  AK +AT           
Sbjct  209  DNIC-GKVFELGGSKVYTLREIYELIFKLIGKKKPLVSIPFIFAKVMATVL---------  258

Query  361  PLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYL  221
             L    +   D +E L TD ++ +N   FE+LG+ P  ++    EY+
Sbjct  259  TLLPRPLLTCDQVELLKTDNIIVKNKNGFEELGLTPTSMEAVLSEYI  305



>ref|WP_035206671.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium tumefaciens]
 gb|KAJ37198.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium tumefaciens]
Length=326

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 99/180 (55%), Gaps = 14/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+   FLPLIGGG T+ QPVYV DVA A+  S+ 
Sbjct  147  LPAAVILRPSIIFGPEDDFFNKFAKMARGMPFLPLIGGGKTRFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            D     G +YELGG ++ T     E ++    RE P +V +PF +A  I     ++    
Sbjct  206  DGKLKPGAIYELGGQDVMTFRDCLEAVLAATYRERP-FVNLPFGVASMIGKVASMV----  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL TP + + D +  L  D +VS    +N LT E +GI P ++      Y++QYR  G
Sbjct  261  --PLITPPLTS-DQVTMLKKDNVVSAEAEKNGLTLEGIGITPVRVASVLPSYMVQYRPHG  317



>ref|WP_025063871.1| 3-beta hydroxysteroid dehydrogenase [Sulfitobacter guttiformis]
 gb|KIN74344.1| NADH-ubiquinone oxidoreductase [Sulfitobacter guttiformis KCTC 
32187]
Length=327

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 99/180 (55%), Gaps = 5/180 (3%)
 Frame = -3

Query  739  GCXREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAI  560
            G  R  P+A IL+P+++ G+ED   N +A  A+    LP++G  +T+ QPVYV DVA A 
Sbjct  138  GVLRHQPDALILRPSIVFGSEDAFFNRFAGMARMSPVLPVVGA-STRFQPVYVDDVAQAA  196

Query  559  IASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELL  380
            +  +   G   G +YELGGP       L  LM +VIR     + +PF  AK +A   ++L
Sbjct  197  VMGVV--GNVKG-IYELGGPVTMNFRDLMALMLEVIRRRRLVLNIPFFAAKVMAFGFDML  253

Query  379  LKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             +KV   L +  +   D ++ L  D +V+E A+ F+DLGI P  +     EYL ++R  G
Sbjct  254  -EKVTLGLLSNGMITRDQVKNLRRDNVVAETAMGFDDLGITPVAMVSVLPEYLWRFRPSG  312



>ref|WP_037089422.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. H41]
 gb|KGE84142.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. H41]
Length=326

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 99/180 (55%), Gaps = 14/180 (8%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+   FLPLIGGG T+ QPVYV DVA A+  S+ 
Sbjct  147  LPAAVILRPSIIFGPEDDFFNKFAKMARGMPFLPLIGGGKTRFQPVYVEDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAE-LMYDVIREWPRYVKVPFPIAKAIATPRELLLKKV  368
            D     G +YELGG ++ T     E ++    RE P +V +PF +A  I     ++    
Sbjct  206  DGKLKPGAIYELGGQDVMTFRDCLEAVLAATYRERP-FVNLPFGVASMIGKVASMV----  260

Query  367  PFPLPTPSIFNLDVIEALTTDTLVS----ENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              PL TP + + D +  L  D +VS    +N LT E +GI P ++      Y++QYR  G
Sbjct  261  --PLITPPLTS-DQVTMLKKDNVVSAEAEKNGLTLEGIGITPVRVASVLPSYMVQYRPHG  317



>ref|WP_024322235.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 95/186 (51%), Gaps = 17/186 (9%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A+ A+    LPL+GGG TK QPVYV DVA A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLVGGGKTKFQPVYVEDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GKVYELGGPE+ +  +  E M  V       V +PF IA  I +    +   +PF
Sbjct  207  GKVAGGKVYELGGPEVLSFRECLETMLKVTCRKNPLVSLPFGIASMIGS----IASMIPF  262

Query  361  PLP--TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
              P  TP     D +  L  D +VS  A     T + LGI P  +      YL+ YR  G
Sbjct  263  ITPPITP-----DQVRLLKRDNIVSREAEAEGRTLKGLGIAPTMVASVLGSYLVHYRPHG  317

Query  199  PQYGST  182
             QY  T
Sbjct  318  -QYTGT  322



>ref|WP_029873971.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium leguminosarum]
Length=326

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 94/184 (51%), Gaps = 13/184 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A I +P+++ G ED   N +A+ A+    LPLIGGG TK QPVYV D+A A +A   D
Sbjct  148  PDAVIFRPSIVFGPEDSFFNKFAEMARMSPILPLIGGGKTKFQPVYVEDIAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GKVYELGGPE+ +  Q  E M  V       V +PF +A  I +   L+      
Sbjct  207  GKVAGGKVYELGGPEVLSFRQCLETMLKVTCRKNPLVSLPFGVASMIGSIASLI------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP I   D +  L  D +VS  A     T + LGI P  +      YL+ YR  G Q
Sbjct  261  PFITPPI-TPDQVRMLKRDNVVSPEAEAEGRTLKGLGIAPTMVASVLGSYLVHYRPHG-Q  318

Query  193  YGST  182
            Y  T
Sbjct  319  YTGT  322



>ref|WP_044214941.1| 3-beta hydroxysteroid dehydrogenase [Candidatus Endolissoclinum 
faulkneri]
Length=319

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 97/182 (53%), Gaps = 11/182 (6%)
 Frame = -3

Query  736  CXRE-IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAI  560
            C R   PEA IL+P+++ G +D   N +A  A+    LPLIGGG +  QPVYV D+A AI
Sbjct  139  CVRSAFPEAIILRPSIVFGNDDSFFNKFASMAQFLPVLPLIGGGKSMFQPVYVIDLAEAI  198

Query  559  IASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELL  380
            IA+L +   + G+ YELGGP I+++  L E++          +K+PF ++   A+  EL 
Sbjct  199  IAAL-NTPAAYGQTYELGGPAIYSLRDLIEIILKETNRKVSLIKLPFWLSSLKASLLEL-  256

Query  379  LKKVPFPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
                    P P I   D +E L  D +VS  A TF DL I P  ++     YL +YR  G
Sbjct  257  -------APNP-ILTRDQVELLKMDNVVSCGAKTFNDLFINPTPIEIIIPSYLNKYRPSG  308

Query  199  PQ  194
              
Sbjct  309  SS  310



>ref|WP_043615439.1| 3-beta hydroxysteroid dehydrogenase [Ensifer sp. ZNC0028]
Length=326

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 98/181 (54%), Gaps = 13/181 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+V+ G ED   N +A  A+    LPLIGGG TK QPVYVTDVA A +A   D
Sbjct  148  PDAIILRPSVVFGPEDGFFNKFANMARFSPALPLIGGGETKFQPVYVTDVAEA-VARAVD  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
               + GK+YELGGP++ +     E+M + I      V +PF +A  I +   L+      
Sbjct  207  GKIAKGKIYELGGPDVLSFRDCLEIMLNTIDRKRALVSLPFGVASLIGSVSSLI------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENAL----TFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            P  TP +   D +  L +D +VS  A+    T   +GI P  L+     YL++YR  G Q
Sbjct  261  PFVTPPL-TADQVVLLKSDNVVSAKAVSEGRTLSGIGIDPTMLEPILPTYLVRYRPQG-Q  318

Query  193  Y  191
            Y
Sbjct  319  Y  319



>ref|WP_034489081.1| 3-beta hydroxysteroid dehydrogenase [Agrobacterium rhizogenes]
Length=326

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 97/183 (53%), Gaps = 12/183 (7%)
 Frame = -3

Query  721  PEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKD  542
            P+A IL+P+++ G ED   N +A  ++   FLPLIGGG TK QPVYV D+A A+   + D
Sbjct  148  PDAVILRPSIVFGPEDGFFNKFADMSRTAPFLPLIGGGKTKFQPVYVEDIAEAVARGV-D  206

Query  541  DGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPF  362
                 G  YELGGPE+ +  +  E    VI      V +PF +A  I +   L+      
Sbjct  207  GKLKAGTTYELGGPEVLSFRECLETTLSVINRKKPLVSIPFGLASLIGSVASLV------  260

Query  361  PLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGPQ  194
            PL TP I + D +  L +D +VS+ A     T + +G++P  L      YL++YR  G  
Sbjct  261  PLITPPITS-DQVTLLKSDNIVSKQAEAEGRTLKGIGLLPTLLVSVLPSYLVRYRPQGQF  319

Query  193  YGS  185
             GS
Sbjct  320  TGS  322



>ref|WP_006023269.1| hypothetical protein [Afipia broomeae]
 gb|EKS34655.1| hypothetical protein HMPREF9695_04565 [Afipia broomeae ATCC 49717]
Length=322

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 98/176 (56%), Gaps = 15/176 (9%)
 Frame = -3

Query  712  TILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDDGT  533
            TIL+P+V+ G ED+  N +A  A+    LPLIGGG TK+QPVYV DVA+A +A   D  T
Sbjct  150  TILRPSVVFGPEDQFTNRFAGLARISPVLPLIGGGLTKLQPVYVGDVANA-VADAVDGKT  208

Query  532  SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFPLP  353
              G  YELGGPE+ T+ ++ E +  +       V +PF +AK  A      L+  P  + 
Sbjct  209  RPGATYELGGPEVMTMREVIEDIVKITYRDTMLVSLPFALAKFQA----FFLQFAPGDMK  264

Query  352  -TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             TP     D +E L +D +VSE A    LT E LG+ P  L+     YL +YRK G
Sbjct  265  LTP-----DQVELLRSDNVVSEAAKAAGLTLEGLGVTPDSLEAVAPSYLWRYRKTG  315



>ref|WP_012067733.1| MULTISPECIES: 3-beta-hydroxy-delta(5)-steroid dehydrogenase [Sinorhizobium]
 ref|YP_001329189.1| NADH dehydrogenase (ubiquinone) [Sinorhizobium medicae WSM419]
 gb|ABR62354.1| NADH dehydrogenase (ubiquinone) [Sinorhizobium medicae WSM419]
Length=326

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 100/185 (54%), Gaps = 13/185 (7%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            +P A IL+P+++ G ED   N +A+ A+    LPLIGGG T+ QPVYVTDVA A+  S+ 
Sbjct  147  LPTAVILRPSIIFGPEDGFFNKFAEMARFSPVLPLIGGGNTRFQPVYVTDVAEAVARSV-  205

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
            D   + G +YELGGP++ +  +  ++M   I     +V +PF IA  + +   L    VP
Sbjct  206  DGKLAGGTIYELGGPQVLSFRECLDIMLKTIDRKRSFVSLPFGIASLMGSVASL----VP  261

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGGP  197
            F  P       D +  L +D +VS  A     TF  +GI P  L+     YL++YR  G 
Sbjct  262  FIEPP---LTADQVVLLKSDNVVSAMAETEGRTFAGIGIEPTMLESILPTYLVRYRPHG-  317

Query  196  QYGST  182
            QY  T
Sbjct  318  QYTRT  322



>ref|WP_037104352.1| 3-beta hydroxysteroid dehydrogenase [Rhizobium sp. OK665]
Length=326

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 100/193 (52%), Gaps = 13/193 (7%)
 Frame = -3

Query  742  RGCXREIPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASA  563
            R     +P A IL+P+++ G ED   N +A+ ++    LPL+GGG T  QPVYVTDVA A
Sbjct  141  RAILETVPNAVILRPSIVFGPEDGFFNKFAEMSRFSPVLPLVGGGETAFQPVYVTDVAEA  200

Query  562  IIASLKDDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPREL  383
            +  S++    + GK+YE+GGP++ T     E++   I      + VPF IA  I +   L
Sbjct  201  VAKSVEGK-VAKGKIYEIGGPDVLTFKNCLEILMKTIDRKRTLLPVPFGIASMIGSVASL  259

Query  382  LLKKVPFPLPTPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQ  215
                VPF  P       D +  L +D +VS NA     T +  GI P  ++     Y+++
Sbjct  260  ----VPFITPP---LTSDQVTLLKSDNVVSANAQTEGRTLQAFGIAPTSVEAVLPSYVVR  312

Query  214  YRKGGPQYGSTVS  176
            YR  G QY  + S
Sbjct  313  YRPQG-QYSRSGS  324



>ref|WP_036515289.1| 3-beta hydroxysteroid dehydrogenase [Oceanicaulis sp. HL-87]
Length=315

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 95/175 (54%), Gaps = 5/175 (3%)
 Frame = -3

Query  724  IPEATILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLK  545
            IP AT+L+P+++ G ED   N +AQ A     LPLIGGG T  QPV+  DV +AI+A+L+
Sbjct  140  IPTATVLRPSIVFGAEDSFFNRFAQMALYTPALPLIGGGKTLFQPVWAGDVGAAILAALE  199

Query  544  DDGTSMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVP  365
                + GK YELGGP  ++  QL + +   I+     V VP+  A  I    E +   +P
Sbjct  200  SP-AAQGKTYELGGPATYSFKQLLQYITATIQRPRLLVPVPWLAAYGIGFAGE-IAGALP  257

Query  364  FPLPTPSIFNLDVIEALTTDTLVSENALTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
            F    P++   D +  L TD +VS       DLGI P  ++     YL ++RKGG
Sbjct  258  F---VPTVLTRDQVTLLKTDNVVSGTLPGLSDLGIRPDSVEAIVPSYLYRFRKGG  309



>ref|WP_024920181.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Afipia]
Length=322

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 98/176 (56%), Gaps = 15/176 (9%)
 Frame = -3

Query  712  TILKPAVMIGTEDRILNPWAQFAKNYGFLPLIGGGTTKIQPVYVTDVASAIIASLKDDGT  533
            TIL+P+V+ G ED+  N +A  A+    LPLIGGG TK+QPVYV DVA+A +A   D  T
Sbjct  150  TILRPSVVFGPEDQFTNRFAGLARISPVLPLIGGGLTKLQPVYVGDVANA-VADAVDGKT  208

Query  532  SMGKVYELGGPEIFTVHQLAELMYDVIREWPRYVKVPFPIAKAIATPRELLLKKVPFPLP  353
              G  YELGGPE+ T+ ++ E +  +       V +PF +AK  A      L+  P  + 
Sbjct  209  RPGATYELGGPEVMTMREVIEDIVKITYRDTMLVSLPFALAKFQA----FFLQFAPGDMK  264

Query  352  -TPSIFNLDVIEALTTDTLVSENA----LTFEDLGIVPHKLKGYPVEYLIQYRKGG  200
             TP     D +E L +D +VSE A    LT E LG+ P  L+     YL +YRK G
Sbjct  265  LTP-----DQVELLRSDNVVSEAAKAAGLTLEGLGVTPDSLEAVAPSYLWRYRKTG  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630