BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028M24

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006355233.1|  PREDICTED: threonine--tRNA ligase, mitochond...    368   6e-120   Solanum tuberosum [potatoes]
ref|XP_004246064.1|  PREDICTED: threonine--tRNA ligase, mitochond...    364   2e-118   Solanum lycopersicum
ref|XP_009622103.1|  PREDICTED: threonine--tRNA ligase, mitochond...    362   2e-117   Nicotiana tomentosiformis
ref|XP_009794575.1|  PREDICTED: threonine--tRNA ligase, mitochond...    360   2e-116   Nicotiana sylvestris
ref|XP_006355966.1|  PREDICTED: threonine--tRNA ligase, mitochond...    357   2e-115   Solanum tuberosum [potatoes]
ref|XP_004238685.1|  PREDICTED: threonine--tRNA ligase, mitochond...    356   6e-115   Solanum lycopersicum
ref|XP_004170956.1|  PREDICTED: threonine--tRNA ligase, mitochond...    334   1e-111   
gb|KGN49712.1|  hypothetical protein Csa_5G080780                       333   3e-111   Cucumis sativus [cucumbers]
gb|KDO82534.1|  hypothetical protein CISIN_1g0066801mg                  332   7e-111   Citrus sinensis [apfelsine]
ref|XP_010274327.1|  PREDICTED: threonine--tRNA ligase, mitochond...    345   9e-111   Nelumbo nucifera [Indian lotus]
ref|XP_006438443.1|  hypothetical protein CICLE_v100308251mg            331   3e-110   
ref|XP_010272819.1|  PREDICTED: threonine--tRNA ligase, mitochond...    342   2e-109   Nelumbo nucifera [Indian lotus]
gb|EPS72288.1|  hypothetical protein M569_02470                         340   3e-109   Genlisea aurea
ref|XP_011076219.1|  PREDICTED: threonine--tRNA ligase, mitochond...    340   6e-109   Sesamum indicum [beniseed]
gb|ADE77216.1|  unknown                                                 320   3e-107   Picea sitchensis
ref|XP_008460557.1|  PREDICTED: threonine--tRNA ligase, mitochond...    335   9e-107   Cucumis melo [Oriental melon]
gb|EYU25062.1|  hypothetical protein MIMGU_mgv1a002240mg                333   2e-106   Erythranthe guttata [common monkey flower]
emb|CDP00192.1|  unnamed protein product                                334   2e-106   Coffea canephora [robusta coffee]
ref|XP_004142299.1|  PREDICTED: threonine--tRNA ligase, mitochond...    333   5e-106   Cucumis sativus [cucumbers]
ref|XP_010100498.1|  Threonine--tRNA ligase                             330   1e-105   
ref|XP_002265302.1|  PREDICTED: threonine--tRNA ligase, mitochond...    331   2e-105   Vitis vinifera
gb|KHN12091.1|  Threonine--tRNA ligase, mitochondrial                   328   2e-105   Glycine soja [wild soybean]
ref|XP_003613276.1|  Threonyl-tRNA synthetase                           331   3e-105   Medicago truncatula
ref|XP_006483810.1|  PREDICTED: threonine--tRNA ligase, mitochond...    330   4e-105   Citrus sinensis [apfelsine]
ref|XP_003519592.1|  PREDICTED: threonine--tRNA ligase, mitochond...    330   4e-105   Glycine max [soybeans]
ref|XP_010533069.1|  PREDICTED: threonine--tRNA ligase, mitochond...    330   7e-105   Tarenaya hassleriana [spider flower]
gb|KHN00337.1|  Threonine--tRNA ligase, mitochondrial                   330   8e-105   Glycine soja [wild soybean]
ref|XP_006346202.1|  PREDICTED: threonine--tRNA ligase, mitochond...    320   9e-105   Solanum tuberosum [potatoes]
ref|XP_010644571.1|  PREDICTED: threonine--tRNA ligase, mitochond...    328   1e-104   Vitis vinifera
ref|XP_004489863.1|  PREDICTED: threonine--tRNA ligase, mitochond...    329   1e-104   Cicer arietinum [garbanzo]
ref|XP_003517788.1|  PREDICTED: threonine--tRNA ligase, mitochond...    328   2e-104   Glycine max [soybeans]
ref|XP_007157476.1|  hypothetical protein PHAVU_002G072800g             328   2e-104   Phaseolus vulgaris [French bean]
ref|XP_002311580.2|  Threonyl-tRNA synthetase family protein            327   6e-104   Populus trichocarpa [western balsam poplar]
gb|KDP21323.1|  hypothetical protein JCGZ_21794                         326   1e-103   Jatropha curcas
ref|XP_011025470.1|  PREDICTED: threonine--tRNA ligase, mitochond...    326   2e-103   Populus euphratica
ref|XP_009360487.1|  PREDICTED: threonine--tRNA ligase, mitochond...    324   3e-103   Pyrus x bretschneideri [bai li]
ref|XP_006378416.1|  Threonyl-tRNA synthetase family protein            325   4e-103   
gb|KDO82533.1|  hypothetical protein CISIN_1g0066801mg                  313   4e-103   Citrus sinensis [apfelsine]
ref|XP_006836673.1|  hypothetical protein AMTR_s00088p00069780          325   7e-103   
ref|XP_009412586.1|  PREDICTED: threonine--tRNA ligase, mitochond...    325   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008340003.1|  PREDICTED: threonine--tRNA ligase, mitochond...    323   2e-102   
ref|XP_010551550.1|  PREDICTED: threonine--tRNA ligase, mitochond...    323   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_008361801.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    323   3e-102   
gb|EEC83306.1|  hypothetical protein OsI_28675                          310   4e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_010913364.1|  PREDICTED: threonine--tRNA ligase, mitochond...    323   4e-102   Elaeis guineensis
ref|XP_004296467.2|  PREDICTED: threonine--tRNA ligase, mitochond...    323   4e-102   Fragaria vesca subsp. vesca
ref|XP_009599596.1|  PREDICTED: threonine--tRNA ligase, mitochond...    312   1e-101   Nicotiana tomentosiformis
ref|XP_011021655.1|  PREDICTED: threonine--tRNA ligase, mitochond...    320   1e-101   Populus euphratica
gb|KJB48103.1|  hypothetical protein B456_008G053600                    314   8e-101   Gossypium raimondii
ref|XP_007225203.1|  hypothetical protein PRUPE_ppa002055mg             319   1e-100   Prunus persica
ref|XP_008221771.1|  PREDICTED: threonine--tRNA ligase, mitochond...    319   1e-100   Prunus mume [ume]
ref|XP_008802022.1|  PREDICTED: threonine--tRNA ligase, mitochond...    317   7e-100   Phoenix dactylifera
ref|XP_010044651.1|  PREDICTED: threonine--tRNA ligase, mitochond...    316   2e-99    Eucalyptus grandis [rose gum]
ref|XP_004510448.1|  PREDICTED: threonine--tRNA ligase, mitochond...    308   4e-99    
gb|KJB48102.1|  hypothetical protein B456_008G053600                    314   8e-99    Gossypium raimondii
ref|XP_010688668.1|  PREDICTED: threonine--tRNA ligase, mitochond...    312   2e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007044584.1|  Threonyl-tRNA synthetase isoform 3                 312   3e-98    
emb|CAC79651.1|  threonyl-tRNA synthetase                               307   4e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007044582.1|  Threonyl-tRNA synthetase isoform 1                 312   5e-98    
gb|EEE68426.1|  hypothetical protein OsJ_26793                          310   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659275.1|  PREDICTED: threonine--tRNA ligase, mitochond...    310   3e-97    Oryza brachyantha
ref|NP_001061475.1|  Os08g0295300                                       310   4e-97    
dbj|BAI39857.1|  putative threonyl-tRNA synthetase                      310   5e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_004500860.1|  PREDICTED: threonine--tRNA ligase, mitochond...    302   2e-96    Cicer arietinum [garbanzo]
ref|XP_004973168.1|  PREDICTED: threonine--tRNA ligase, mitochond...    306   2e-95    Setaria italica
ref|XP_006394912.1|  hypothetical protein EUTSA_v10003725mg             303   8e-95    Eutrema salsugineum [saltwater cress]
emb|CDX80596.1|  BnaC07g28480D                                          303   1e-94    
ref|XP_009151164.1|  PREDICTED: threonine--tRNA ligase, mitochond...    303   2e-94    Brassica rapa
ref|XP_009111770.1|  PREDICTED: threonine--tRNA ligase, mitochond...    302   3e-94    Brassica rapa
gb|KFK26446.1|  hypothetical protein AALP_AA8G249500                    302   3e-94    Arabis alpina [alpine rockcress]
dbj|BAJ93554.1|  predicted protein                                      301   8e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004968434.1|  PREDICTED: threonine--tRNA ligase, mitochond...    301   2e-93    Setaria italica
emb|CDX87030.1|  BnaC09g03450D                                          300   2e-93    
ref|XP_002464119.1|  hypothetical protein SORBIDRAFT_01g012680          300   3e-93    Sorghum bicolor [broomcorn]
ref|XP_008664856.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    300   4e-93    Zea mays [maize]
ref|XP_003573669.1|  PREDICTED: threonine--tRNA ligase, mitochond...    298   2e-92    Brachypodium distachyon [annual false brome]
emb|CDM81189.1|  unnamed protein product                                296   4e-92    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008644625.1|  PREDICTED: threonine--tRNA ligase, mitochond...    296   6e-92    
ref|XP_006289423.1|  hypothetical protein CARUB_v10002922mg             295   1e-91    Capsella rubella
ref|XP_002521030.1|  threonyl-tRNA synthetase, putative                 294   2e-91    
ref|XP_010027611.1|  PREDICTED: threonine--tRNA ligase, mitochond...    286   4e-91    
ref|XP_010027610.1|  PREDICTED: threonine--tRNA ligase, mitochond...    286   6e-91    Eucalyptus grandis [rose gum]
gb|AAK82468.1|  AT5g26830/F2P16_90                                      292   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872240.1|  AT5g26830/F2P16_90                                 293   9e-91    Arabidopsis lyrata subsp. lyrata
gb|KCW54156.1|  hypothetical protein EUGRSUZ_I00127                     285   1e-90    Eucalyptus grandis [rose gum]
ref|NP_198035.2|  threonyl-tRNA synthetase                              293   1e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CAA74705.1|  threonyl-tRNA synthetase                               293   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237148.1|  PREDICTED: threonine--tRNA ligase, mitochond...    290   2e-90    
ref|XP_010493938.1|  PREDICTED: threonine--tRNA ligase, mitochond...    291   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010027608.1|  PREDICTED: threonine--tRNA ligase, mitochond...    285   6e-90    Eucalyptus grandis [rose gum]
ref|XP_007199721.1|  hypothetical protein PRUPE_ppa002288mg             290   1e-89    Prunus persica
ref|XP_010455043.1|  PREDICTED: threonine--tRNA ligase, mitochond...    289   4e-89    Camelina sativa [gold-of-pleasure]
ref|XP_007200687.1|  hypothetical protein PRUPE_ppa017189mg             287   8e-89    Prunus persica
ref|XP_001784310.1|  predicted protein                                  286   2e-88    
ref|XP_010497266.1|  PREDICTED: probable threonine--tRNA ligase, ...    273   3e-88    Camelina sativa [gold-of-pleasure]
gb|AAB61048.1|  Similar to threonyl-tRNA synthetase; coded for by...    283   3e-87    Arabidopsis thaliana [mouse-ear cress]
gb|EMT11254.1|  Threonyl-tRNA synthetase, mitochondrial                 288   1e-86    
emb|CDY19754.1|  BnaA09g04070D                                          276   2e-85    Brassica napus [oilseed rape]
ref|XP_010476961.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    272   3e-85    Camelina sativa [gold-of-pleasure]
gb|KDO82535.1|  hypothetical protein CISIN_1g0066801mg                  262   7e-84    Citrus sinensis [apfelsine]
ref|XP_002989766.1|  hypothetical protein SELMODRAFT_447798             267   3e-82    
gb|EMS59266.1|  Threonyl-tRNA synthetase, mitochondrial                 274   1e-81    Triticum urartu
ref|XP_002890262.1|  hypothetical protein ARALYDRAFT_889225             264   2e-80    
ref|XP_002892976.1|  hypothetical protein ARALYDRAFT_472010             259   3e-80    
ref|XP_006303967.1|  hypothetical protein CARUB_v10008857mg             259   1e-79    
ref|XP_004304268.2|  PREDICTED: threonine--tRNA ligase, mitochond...    264   2e-79    Fragaria vesca subsp. vesca
ref|XP_010480524.1|  PREDICTED: probable threonine--tRNA ligase, ...    254   2e-76    
ref|XP_006303165.1|  hypothetical protein CARUB_v10008521mg             253   3e-76    Capsella rubella
emb|CDY21715.1|  BnaA09g44660D                                          253   4e-76    Brassica napus [oilseed rape]
ref|XP_009117622.1|  PREDICTED: threonine--tRNA ligase, mitochond...    251   1e-75    Brassica rapa
dbj|BAN16553.1|  ADB6244                                                241   6e-75    Acytostelium subglobosum
ref|XP_001696198.1|  hypothetical protein CHLREDRAFT_167047             248   6e-74    Chlamydomonas reinhardtii
ref|XP_002989765.1|  hypothetical protein SELMODRAFT_130418             246   1e-73    
ref|XP_002991732.1|  hypothetical protein SELMODRAFT_134156             246   1e-73    
ref|NP_173238.1|  threonyl-tRNA synthetase                              241   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002946221.1|  hypothetical protein VOLCADRAFT_102823             246   3e-73    Volvox carteri f. nagariensis
ref|XP_005844334.1|  hypothetical protein CHLNCDRAFT_49107              241   4e-72    Chlorella variabilis
dbj|GAM29123.1|  hypothetical protein SAMD00019534_122990               242   2e-71    Acytostelium subglobosum LB1
ref|XP_009117636.1|  PREDICTED: threonine--tRNA ligase, mitochond...    235   3e-71    Brassica rapa
ref|XP_003288175.1|  threonyl-tRNA synthetase                           241   6e-71    Dictyostelium purpureum
ref|XP_636821.1|  threonyl-tRNA synthetase                              240   6e-71    Dictyostelium discoideum AX4
gb|EFA77297.1|  threonyl-tRNA synthetase                                240   1e-70    Heterostelium album PN500
ref|XP_002677200.1|  threonyl-tRNA synthetase                           239   1e-70    Naegleria gruberi strain NEG-M
ref|XP_011397153.1|  Threonine-tRNA ligase, mitochondrial               240   1e-70    Auxenochlorella protothecoides
ref|XP_004351232.1|  threonyl-tRNA synthetase                           239   2e-70    Cavenderia fasciculata
ref|XP_004182642.1|  hypothetical protein TBLA_0J01260                  240   2e-70    Tetrapisispora blattae CBS 6284
ref|XP_007514880.1|  threonyl-tRNA synthetase                           239   2e-70    Bathycoccus prasinos
ref|XP_007044585.1|  Threonyl-tRNA synthetase isoform 4                 237   2e-70    
ref|XP_005648591.1|  threonyl-tRNA synthetase                           239   3e-70    Coccomyxa subellipsoidea C-169
ref|XP_007044583.1|  Threonyl-tRNA synthetase isoform 2                 237   3e-70    
ref|XP_006071988.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   8e-70    
ref|XP_004085211.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    225   9e-70    
emb|CDQ73765.1|  unnamed protein product                                224   1e-69    Oncorhynchus mykiss
ref|XP_009117635.1|  PREDICTED: threonine--tRNA ligase, mitochond...    230   2e-69    Brassica rapa
emb|CDJ83831.1|  Aminoacyl-tRNA synthetase and Anticodon-binding ...    229   2e-69    Haemonchus contortus [red stomach worm]
ref|XP_001623293.1|  predicted protein                                  233   2e-69    Nematostella vectensis
ref|XP_003080220.1|  putative threonyl-tRNA synthetase (ISS)            235   3e-69    
ref|XP_003058283.1|  predicted protein                                  236   3e-69    Micromonas pusilla CCMP1545
ref|XP_011499017.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    236   3e-69    Ceratosolen solmsi marchali
emb|CEF98631.1|  Anticodon-binding                                      235   4e-69    Ostreococcus tauri
ref|XP_002499537.1|  predicted protein                                  236   4e-69    Micromonas commoda
ref|XP_004933460.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   7e-69    Bombyx mori [silk moth]
ref|XP_005774035.1|  threonine-tRNA ligase                              234   9e-69    Emiliania huxleyi CCMP1516
ref|XP_004933459.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    235   9e-69    Bombyx mori [silk moth]
ref|XP_005758375.1|  threonine-tRNA ligase                              234   1e-68    Emiliania huxleyi CCMP1516
emb|CDY21726.1|  BnaA09g44770D                                          228   1e-68    Brassica napus [oilseed rape]
ref|XP_002595927.1|  hypothetical protein BRAFLDRAFT_268618             234   1e-68    Branchiostoma floridae
pdb|4HWT|A  Chain A, Crystal Structure Of Human Threonyl-trna Syn...    227   2e-68    Homo sapiens [man]
pdb|4P3N|A  Chain A, Structural Basis For Full-spectrum Inhibitio...    227   2e-68    Homo sapiens [man]
gb|EDL82978.1|  threonyl-tRNA synthetase, isoform CRA_b                 228   2e-68    Rattus norvegicus [brown rat]
emb|CDX81854.1|  BnaC08g37470D                                          228   2e-68    
ref|NP_723726.1|  Threonyl-tRNA synthetase, isoform C                   233   2e-68    Drosophila melanogaster
gb|KGK38420.1|  hypothetical protein JL09_g2427                         234   2e-68    Pichia kudriavzevii
ref|XP_004531261.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    233   3e-68    Ceratitis capitata [medfly]
gb|EPY73150.1|  threonine--tRNA ligase, cytoplasmic                     232   3e-68    Camelus ferus
ref|XP_005650255.1|  threonyl-tRNA synthetase                           236   3e-68    Coccomyxa subellipsoidea C-169
gb|AAN71609.1|  RH56418p                                                233   3e-68    Drosophila melanogaster
emb|CDF89359.1|  ZYBA0S04-02388g1_1                                     234   3e-68    Zygosaccharomyces bailii CLIB 213
emb|CDW52205.1|  threonyl tRNA synthetase, cytoplasmic                  233   3e-68    Trichuris trichiura
ref|XP_449908.1|  hypothetical protein                                  233   3e-68    [Candida] glabrata
ref|XP_003674309.1|  hypothetical protein NCAS_0A13710                  234   3e-68    Naumovozyma castellii CBS 4309
ref|XP_011212426.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    233   4e-68    Bactrocera dorsalis [papaya fruit fly]
ref|XP_010208524.1|  PREDICTED: probable threonine--tRNA ligase 2...    221   4e-68    Colius striatus
ref|XP_004349538.1|  threonyl-tRNA synthetase                           233   4e-68    Capsaspora owczarzaki ATCC 30864
ref|XP_001969762.1|  GG23767                                            233   4e-68    Drosophila erecta
ref|XP_008213480.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    233   4e-68    Nasonia vitripennis
gb|EMP39003.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        227   5e-68    Chelonia mydas [green seaturtle]
ref|XP_003729486.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    231   5e-68    Strongylocentrotus purpuratus [purple urchin]
ref|XP_001989177.1|  GH11579                                            228   5e-68    Drosophila grimshawi
ref|NP_723725.1|  Threonyl-tRNA synthetase, isoform A                   233   5e-68    Drosophila melanogaster
ref|XP_001603180.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    233   5e-68    Nasonia vitripennis
gb|AAM50188.1|  GH20022p                                                233   5e-68    Drosophila melanogaster
ref|XP_002079196.1|  GD23818                                            233   5e-68    Drosophila simulans
ref|XP_002042027.1|  GM26732                                            233   5e-68    Drosophila sechellia
ref|XP_003955557.1|  hypothetical protein KAFR_0B01230                  233   6e-68    Kazachstania africana CBS 2517
ref|XP_002002014.1|  GI17149                                            232   6e-68    
ref|XP_003397155.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    233   7e-68    
gb|EDZ71519.1|  YIL078Wp-like protein                                   232   7e-68    Saccharomyces cerevisiae AWRI1631
ref|XP_004531260.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    233   8e-68    Ceratitis capitata [medfly]
gb|AJR37072.1|  Ths1p                                                   233   8e-68    Saccharomyces cerevisiae YJM195
gb|AJR47138.1|  Ths1p                                                   233   8e-68    Saccharomyces cerevisiae YJM1342
gb|EDV09560.1|  threonyl-tRNA synthetase                                233   8e-68    Saccharomyces cerevisiae RM11-1a
emb|CAA26666.1|  unnamed protein product                                233   8e-68    Saccharomyces cerevisiae [brewer's yeast]
ref|XP_003489967.1|  PREDICTED: threonyl-tRNA synthetase, cytopla...    232   8e-68    
gb|AJR45798.1|  Ths1p                                                   233   8e-68    Saccharomyces cerevisiae YJM1307
ref|NP_116578.3|  threonine--tRNA ligase THS1                           233   8e-68    Saccharomyces cerevisiae S288C
ref|XP_003503703.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     232   9e-68    Cricetulus griseus [Chinese hamsters]
gb|EIW09934.1|  Ths1p                                                   233   9e-68    Saccharomyces cerevisiae CEN.PK113-7D
gb|AAH04621.1|  Tars protein                                            226   9e-68    Mus musculus [mouse]
ref|XP_011342020.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    232   9e-68    Ooceraea biroi
gb|EDN61420.1|  threonyl-tRNA synthetase                                233   9e-68    Saccharomyces cerevisiae YJM789
gb|AJR39322.1|  Ths1p                                                   232   9e-68    Saccharomyces cerevisiae YJM470
gb|EWG95461.1|  Ths1p                                                   232   9e-68    Saccharomyces cerevisiae R103
gb|AJR38945.1|  Ths1p                                                   232   9e-68    Saccharomyces cerevisiae YJM453
gb|EEU08659.1|  Ths1p                                                   232   9e-68    Saccharomyces cerevisiae JAY291
gb|EHN06623.1|  Ths1p                                                   232   9e-68    Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_002088448.1|  Aats-thr                                           233   9e-68    Drosophila yakuba
ref|XP_319682.4|  AGAP008929-PA                                         233   9e-68    Anopheles gambiae str. PEST
ref|XP_011212417.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    233   9e-68    Bactrocera dorsalis [papaya fruit fly]
gb|EGA78432.1|  Ths1p                                                   232   1e-67    Saccharomyces cerevisiae Vin13
gb|AJR53093.1|  Ths1p                                                   232   1e-67    Saccharomyces cerevisiae YJM1549
ref|XP_001965104.1|  GF21565                                            233   1e-67    Drosophila ananassae
ref|XP_001642915.1|  hypothetical protein Kpol_411p2                    232   1e-67    Vanderwaltozyma polyspora DSM 70294
gb|KHJ41146.1|  hypothetical protein D918_08732                         231   1e-67    Trichuris suis
ref|XP_009238891.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   1e-67    
gb|EHN01906.1|  Ths1p                                                   232   1e-67    Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_004088253.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   1e-67    
ref|XP_006194878.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     231   1e-67    Camelus ferus
ref|XP_011342019.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    232   1e-67    Ooceraea biroi
ref|XP_004349666.1|  threonine-tRNA ligase                              231   1e-67    Acanthamoeba castellanii str. Neff
ref|XP_002052626.1|  GJ17652                                            232   2e-67    Drosophila virilis
gb|ETN67379.1|  threonyl-tRNA synthetase                                231   2e-67    Anopheles darlingi [American malaria mosquito]
ref|XP_005325709.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    231   3e-67    Ictidomys tridecemlineatus
ref|XP_005556719.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   3e-67    
ref|XP_004088252.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   3e-67    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005320129.1|  PREDICTED: probable threonine--tRNA ligase 2...    231   3e-67    
gb|ELK31735.1|  Threonyl-tRNA synthetase, cytoplasmic                   229   3e-67    Myotis davidii
ref|XP_001950747.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    231   3e-67    
ref|XP_003475575.2|  PREDICTED: probable threonine--tRNA ligase 2...    231   3e-67    
ref|XP_005003846.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    231   3e-67    
ref|XP_003470228.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    231   4e-67    
ref|XP_002714160.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     231   4e-67    Oryctolagus cuniculus [domestic rabbit]
ref|XP_005325710.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    231   4e-67    
ref|XP_967345.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic ...    230   4e-67    Tribolium castaneum [rust-red flour beetle]
gb|EFA05822.1|  hypothetical protein TcasGA2_TC008604                   230   4e-67    
ref|XP_005556718.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   4e-67    
ref|XP_004059038.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   4e-67    
ref|XP_004372697.1|  PREDICTED: probable threonine--tRNA ligase 2...    231   4e-67    Trichechus manatus latirostris
emb|CCD74804.1|  unnamed protein product                                218   4e-67    Schistosoma mansoni
ref|XP_001418868.1|  predicted protein                                  229   4e-67    Ostreococcus lucimarinus CCE9901
ref|XP_001658309.1|  AAEL001206-PA                                      230   4e-67    Aedes aegypti
gb|EFB17446.1|  hypothetical protein PANDA_008118                       229   4e-67    Ailuropoda melanoleuca
ref|XP_006875438.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    230   4e-67    Chrysochloris asiatica
ref|XP_008198247.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    230   4e-67    Tribolium castaneum [rust-red flour beetle]
gb|EDL03283.1|  threonyl-tRNA synthetase, isoform CRA_a                 227   5e-67    Mus musculus [mouse]
ref|NP_983365.1|  ACL039Wp                                              230   5e-67    Eremothecium gossypii ATCC 10895
ref|XP_010168916.1|  PREDICTED: probable threonine--tRNA ligase 2...    223   5e-67    Antrostomus carolinensis
ref|XP_004059037.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   5e-67    
ref|XP_004698143.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   5e-67    Echinops telfairi [lesser hedgehog tenrec]
ref|NP_001125825.1|  threonine--tRNA ligase, cytoplasmic                227   5e-67    Pongo abelii [orang utan]
ref|XP_004678135.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     230   6e-67    Condylura cristata
ref|XP_003688670.1|  hypothetical protein TPHA_0P00780                  230   6e-67    Tetrapisispora phaffii CBS 4417
ref|XP_004088251.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   6e-67    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006875437.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    230   6e-67    Chrysochloris asiatica
ref|XP_002919483.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     230   6e-67    Ailuropoda melanoleuca
ref|XP_008690887.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     230   6e-67    Ursus maritimus [white bear]
ref|XP_006148565.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     230   6e-67    Tupaia chinensis
ref|XP_004325399.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   7e-67    
gb|KFB38665.1|  AGAP008929-PA-like protein                              230   7e-67    Anopheles sinensis
ref|XP_004623299.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    231   7e-67    
ref|XP_004385288.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   7e-67    
ref|XP_001513531.2|  PREDICTED: probable threonine--tRNA ligase 2...    229   8e-67    
ref|XP_005320128.1|  PREDICTED: probable threonine--tRNA ligase 2...    231   8e-67    
ref|XP_009163294.1|  hypothetical protein T265_01087                    230   8e-67    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_006761862.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   9e-67    
ref|XP_004412948.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   9e-67    Odobenus rosmarus divergens
ref|XP_005320127.1|  PREDICTED: probable threonine--tRNA ligase 2...    231   9e-67    Ictidomys tridecemlineatus
dbj|BAG59361.1|  unnamed protein product                                227   9e-67    Homo sapiens [man]
ref|XP_006199708.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    229   9e-67    
gb|EDL07239.1|  threonyl-tRNA synthetase-like 2, isoform CRA_b          226   9e-67    Mus musculus [mouse]
ref|XP_011192188.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   9e-67    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_002942619.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   1e-66    Xenopus tropicalis [western clawed frog]
gb|EAX10803.1|  threonyl-tRNA synthetase, isoform CRA_a                 228   1e-66    Homo sapiens [man]
ref|XP_005872671.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   1e-66    Myotis brandtii
ref|XP_005694881.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   1e-66    
ref|XP_006090155.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   1e-66    Myotis lucifugus
ref|XP_004059036.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   1e-66    
gb|EHJ63622.1|  hypothetical protein KGM_17077                          229   1e-66    
gb|AGO11222.1|  AaceriACL039Wp                                          229   1e-66    Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_006996688.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   1e-66    Peromyscus maniculatus bairdii
emb|CDK25861.1|  unnamed protein product                                229   1e-66    Kuraishia capsulata CBS 1993
ref|XP_004385287.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   1e-66    
ref|XP_005556717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   1e-66    Macaca fascicularis [crab eating macaque]
ref|XP_008046647.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   1e-66    Carlito syrichta
ref|XP_007959499.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   1e-66    Chlorocebus sabaeus
ref|XP_002014541.1|  GL19239                                            229   1e-66    Drosophila persimilis
gb|EHH61622.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        224   1e-66    Macaca fascicularis [crab eating macaque]
ref|XP_008472446.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     226   1e-66    
gb|AJR38174.1|  Ths1p                                                   229   1e-66    Saccharomyces cerevisiae YJM326
ref|XP_003274971.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   1e-66    
ref|NP_001006977.1|  threonine--tRNA ligase, cytoplasmic                228   1e-66    
ref|XP_011264917.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   2e-66    
dbj|BAG53144.1|  unnamed protein product                                227   2e-66    
ref|XP_008833678.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   2e-66    
gb|KFD69339.1|  hypothetical protein M514_10343                         234   2e-66    
ref|XP_009812579.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    221   2e-66    
gb|EPQ11689.1|  Threonyl-tRNA synthetase, cytoplasmic                   229   2e-66    
ref|XP_004879581.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   2e-66    
ref|XP_006003382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    226   2e-66    
ref|XP_011264916.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   2e-66    
gb|KFD48788.1|  hypothetical protein M513_10343                         234   2e-66    
ref|XP_005556716.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   2e-66    
ref|XP_004088250.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   2e-66    
ref|XP_009206493.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   2e-66    
ref|XP_009447608.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   2e-66    
ref|XP_004059034.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   2e-66    
ref|XP_005983077.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   2e-66    
ref|XP_006232130.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   2e-66    
gb|EHH26432.1|  hypothetical protein EGK_16408                          229   2e-66    
ref|XP_011264915.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   2e-66    
gb|EJW79603.1|  hypothetical protein WUBG_09488                         220   2e-66    
gb|EHH54185.1|  hypothetical protein EGM_14968                          229   2e-66    
ref|XP_007959500.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   2e-66    
ref|XP_011192187.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    229   2e-66    
ref|XP_010586388.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    228   2e-66    
ref|XP_008153032.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   3e-66    
ref|XP_008153034.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   3e-66    
dbj|GAA47460.1|  threonyl-tRNA synthetase                               228   3e-66    
ref|XP_011290653.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   3e-66    
ref|NP_001029542.1|  threonine--tRNA ligase, cytoplasmic                228   3e-66    
ref|XP_008990455.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   3e-66    
emb|CDH13485.1|  Threonine--tRNA ligase, cytoplasmic                    228   3e-66    
ref|XP_007097493.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     228   3e-66    
gb|KFQ16963.1|  putative threonine--tRNA ligase 2, cytoplasmic          227   3e-66    
ref|XP_004059035.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   3e-66    
ref|XP_007466902.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    226   3e-66    
ref|XP_005178933.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   3e-66    
ref|XP_010852134.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   3e-66    
ref|XP_003899597.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   4e-66    
ref|XP_005356692.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     228   4e-66    
ref|XP_003936261.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     228   4e-66    
ref|XP_005887778.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   4e-66    
ref|XP_001498225.2|  PREDICTED: threonine--tRNA ligase, cytoplasmic     228   4e-66    
ref|XP_004385286.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   4e-66    
ref|XP_004583694.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     228   4e-66    
ref|XP_007192302.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     228   4e-66    
gb|AIC63184.1|  TARS                                                    228   4e-66    
gb|ABM82342.1|  threonyl-tRNA synthetase                                228   4e-66    
gb|AAH10578.2|  Threonyl-tRNA synthetase                                228   4e-66    
ref|NP_689508.3|  threonine--tRNA ligase, cytoplasmic isoform 1         228   4e-66    
ref|XP_001153971.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   4e-66    
ref|XP_006020081.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   4e-66    
dbj|BAD96524.1|  threonyl-tRNA synthetase variant                       228   5e-66    
ref|XP_003793022.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     227   5e-66    
ref|XP_009927442.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    220   5e-66    
ref|XP_003703597.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   5e-66    
ref|NP_149065.2|  threonine--tRNA ligase, cytoplasmic                   227   5e-66    
ref|XP_005178932.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   6e-66    
ref|XP_004017114.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     227   6e-66    
gb|AAH55371.1|  Threonyl-tRNA synthetase                                227   6e-66    
ref|XP_002745122.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   6e-66    
gb|KFV63505.1|  putative threonine--tRNA ligase 2, cytoplasmic          226   6e-66    
ref|XP_003667634.1|  hypothetical protein NDAI_0A02330                  228   6e-66    
emb|CCK69517.1|  hypothetical protein KNAG_0C04150                      227   6e-66    
ref|XP_006268868.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   6e-66    
ref|XP_009206495.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    228   6e-66    
ref|XP_005983076.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   6e-66    
dbj|BAB26799.1|  unnamed protein product                                227   7e-66    
ref|XP_003760006.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     229   7e-66    
ref|XP_010354694.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     227   7e-66    
ref|NP_001245367.1|  threonine--tRNA ligase, cytoplasmic isoform 2      228   7e-66    
dbj|BAO41767.1|  threonyl-tRNA synthetase                               227   7e-66    
ref|XP_004852724.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   7e-66    
ref|XP_004852723.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   7e-66    
ref|XP_003981521.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     227   7e-66    
ref|XP_008561545.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    223   8e-66    
ref|XP_005381767.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   8e-66    
ref|XP_007535845.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     227   8e-66    
ref|XP_006612937.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   9e-66    
ref|XP_004266073.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     225   9e-66    
ref|XP_003683234.1|  hypothetical protein TDEL_0H01640                  227   1e-65    
ref|XP_536509.3|  PREDICTED: threonine--tRNA ligase, cytoplasmic        227   1e-65    
ref|XP_005357853.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   1e-65    
gb|EKC29157.1|  Threonyl-tRNA synthetase, cytoplasmic                   217   1e-65    
ref|XP_010598480.1|  PREDICTED: probable threonine--tRNA ligase 2...    227   1e-65    
ref|XP_008685799.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   1e-65    
ref|XP_009695024.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   1e-65    
ref|XP_002069231.1|  GK21088                                            226   1e-65    
ref|XP_007466903.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    226   1e-65    
ref|XP_008942445.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    227   1e-65    
emb|CBK21096.2|  unnamed protein product                                227   1e-65    
gb|ETE72689.1|  putative threonyl-tRNA synthetase 2, cytoplasmic        222   1e-65    
gb|KFP03020.1|  putative threonine--tRNA ligase 2, cytoplasmic          226   1e-65    
ref|XP_006612938.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    226   1e-65    
dbj|BAE31895.1|  unnamed protein product                                226   1e-65    
ref|XP_008685800.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   1e-65    
ref|XP_010166514.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     221   1e-65    
ref|XP_455348.1|  hypothetical protein                                  227   1e-65    
ref|XP_004990683.1|  threonyl-tRNA synthetase isoform 2                 227   1e-65    
ref|XP_005357852.1|  PREDICTED: probable threonine--tRNA ligase 2...    228   1e-65    
ref|XP_002496040.1|  ZYRO0C09086p                                       226   1e-65    
ref|XP_004431940.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   1e-65    
ref|XP_008847768.1|  PREDICTED: probable threonine--tRNA ligase 2...    227   1e-65    
ref|XP_009909554.1|  PREDICTED: probable threonine--tRNA ligase 2...    227   1e-65    
gb|EFZ18882.1|  hypothetical protein SINV_16250                         227   1e-65    
gb|EFA85860.1|  threonyl-tRNA synthetase                                226   1e-65    
gb|ELV13451.1|  putative threonyl-tRNA synthetase 2, cytoplasmic        228   1e-65    
ref|XP_011158574.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    226   1e-65    
ref|XP_008494852.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   1e-65    
ref|XP_011158573.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    226   2e-65    
ref|XP_002195014.2|  PREDICTED: probable threonine--tRNA ligase 2...    226   2e-65    
ref|XP_008561546.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    223   2e-65    
ref|XP_003691478.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    226   2e-65    
ref|XP_007954753.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     226   2e-65    
gb|EDM08409.1|  threonyl-tRNA synthetase-like 2, isoform CRA_b          226   2e-65    
ref|XP_010636533.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   2e-65    
gb|AAH39225.1|  Threonyl-tRNA synthetase-like 2                         227   2e-65    
gb|KFQ42737.1|  putative threonine--tRNA ligase 2, cytoplasmic          225   2e-65    
ref|XP_007440622.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   2e-65    
ref|XP_006136948.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   2e-65    
ref|NP_758514.2|  probable threonine--tRNA ligase 2, cytoplasmic        227   2e-65    
gb|KFP63323.1|  putative threonine--tRNA ligase 2, cytoplasmic          225   2e-65    
emb|CDO95602.1|  unnamed protein product                                226   2e-65    
ref|XP_006118795.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    225   2e-65    
ref|XP_006162810.1|  PREDICTED: probable threonine--tRNA ligase 2...    227   2e-65    
dbj|BAG38072.1|  unnamed protein product                                226   2e-65    
gb|KFV55276.1|  Threonine--tRNA ligase, cytoplasmic                     218   2e-65    
ref|XP_010014179.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   2e-65    
ref|XP_003133916.3|  PREDICTED: threonine--tRNA ligase, cytoplasm...    225   2e-65    
dbj|BAB71554.1|  unnamed protein product                                219   2e-65    
ref|XP_005521510.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   2e-65    
gb|AAH74887.1|  TARSL2 protein                                          220   2e-65    
ref|XP_002116349.1|  hypothetical protein TRIADDRAFT_50865              225   2e-65    
ref|XP_008685798.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   2e-65    
gb|KFQ99509.1|  putative threonine--tRNA ligase 2, cytoplasmic          225   3e-65    
gb|KFV92314.1|  putative threonine--tRNA ligase 2, cytoplasmic          225   3e-65    
ref|XP_001845897.1|  threonyl-tRNA synthetase                           225   3e-65    
ref|XP_007638354.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   3e-65    
ref|XP_004738119.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     225   3e-65    
gb|EHH27645.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        225   3e-65    
ref|XP_007120316.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    225   3e-65    
ref|XP_007487558.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     225   3e-65    
ref|XP_009576132.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   3e-65    
ref|XP_007056480.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   3e-65    
ref|XP_010148223.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     221   3e-65    
ref|XP_002432585.1|  Threonyl-tRNA synthetase, cytoplasmic, putative    225   4e-65    
gb|KDR13507.1|  Threonyl-tRNA synthetase, cytoplasmic                   226   4e-65    
ref|XP_007095949.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   4e-65    
ref|XP_007855570.1|  threonyl-trna synthetase                           225   4e-65    
gb|KFP47497.1|  putative threonine--tRNA ligase 2, cytoplasmic          224   4e-65    
gb|KFP70847.1|  putative threonine--tRNA ligase 2, cytoplasmic          224   4e-65    
ref|XP_007630822.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   4e-65    
ref|XP_008120289.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    226   4e-65    
ref|XP_004431939.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   4e-65    
ref|XP_003648097.1|  hypothetical protein Ecym_7461                     225   4e-65    
ref|XP_009291630.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    222   4e-65    
ref|XP_004894553.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     225   4e-65    
gb|KFO53391.1|  putative threonine--tRNA ligase 2, cytoplasmic          224   4e-65    
ref|XP_010141938.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     224   4e-65    
ref|XP_009934283.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   4e-65    
ref|XP_001491149.3|  PREDICTED: probable threonine--tRNA ligase 2...    226   4e-65    
gb|KGL77238.1|  putative threonine--tRNA ligase 2, cytoplasmic          224   5e-65    
gb|KFO94418.1|  Threonine--tRNA ligase, cytoplasmic                     224   5e-65    
gb|EPQ10677.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        222   5e-65    
gb|EDM08408.1|  threonyl-tRNA synthetase-like 2, isoform CRA_a          226   5e-65    
ref|XP_004693013.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   5e-65    
gb|AAH69346.1|  TARSL2 protein                                          219   5e-65    
ref|XP_007988793.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   5e-65    
ref|XP_008286368.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     225   5e-65    
gb|KFO72069.1|  putative threonine--tRNA ligase 2, cytoplasmic          224   5e-65    
ref|XP_536172.2|  PREDICTED: probable threonine--tRNA ligase 2, c...    226   5e-65    
ref|XP_006559720.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   5e-65    
ref|XP_009076978.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   6e-65    
ref|XP_003738717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   6e-65    
gb|KFU87220.1|  putative threonine--tRNA ligase 2, cytoplasmic          224   6e-65    
ref|XP_004605618.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     224   6e-65    
ref|XP_010187513.1|  PREDICTED: probable threonine--tRNA ligase 2...    222   6e-65    
ref|XP_006559719.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   6e-65    
ref|XP_008636148.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   6e-65    
ref|XP_007872125.1|  hypothetical protein PNEG_00254                    224   6e-65    
ref|XP_003978376.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   6e-65    
ref|XP_006975908.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   7e-65    
ref|XP_011230585.1|  PREDICTED: probable threonine--tRNA ligase 2...    226   7e-65    
ref|XP_005560684.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   7e-65    
ref|XP_011274772.1|  threonyl-tRNA synthetase                           225   7e-65    
ref|XP_010224537.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     224   7e-65    
ref|XP_005145729.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   7e-65    
ref|XP_004413032.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   8e-65    
ref|XP_011055937.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   8e-65    
ref|XP_005560685.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   8e-65    
ref|XP_011281034.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   8e-65    
gb|KFM08256.1|  putative threonine--tRNA ligase 2, cytoplasmic          223   8e-65    
ref|XP_004413033.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   8e-65    
ref|XP_009679777.1|  PREDICTED: probable threonine--tRNA ligase 2...    221   8e-65    
ref|XP_005285035.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   8e-65    
ref|XP_004652577.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic     224   8e-65    
ref|XP_007557944.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   9e-65    
ref|XP_008051015.1|  PREDICTED: probable threonine--tRNA ligase 2...    221   9e-65    
ref|XP_007557945.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   9e-65    
dbj|BAC27235.1|  unnamed protein product                                224   9e-65    
gb|EHB09296.1|  Threonyl-tRNA synthetase, cytoplasmic                   225   9e-65    
gb|ERE78099.1|  putative threonyl-tRNA synthetase 2, cytoplasmic        225   9e-65    
gb|EOA97118.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        224   9e-65    
ref|XP_010379975.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   9e-65    
gb|KGL73538.1|  Threonine--tRNA ligase, cytoplasmic                     223   1e-64    
ref|XP_009278712.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   1e-64    
ref|XP_010379973.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   1e-64    
ref|XP_010212954.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   1e-64    
ref|XP_007375178.1|  hypothetical protein SPAPADRAFT_61003              224   1e-64    
ref|XP_011281033.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   1e-64    
ref|XP_007958117.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   1e-64    
ref|XP_009992825.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   1e-64    
ref|XP_007958118.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   1e-64    
ref|XP_010606023.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    223   1e-64    
ref|XP_001373323.3|  PREDICTED: probable threonine--tRNA ligase 2...    225   1e-64    
ref|XP_009209274.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   1e-64    
ref|XP_009553641.1|  PREDICTED: probable threonine--tRNA ligase 2...    224   1e-64    
ref|XP_005419820.1|  PREDICTED: probable threonine--tRNA ligase 2...    225   1e-64    
ref|XP_005094375.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    224   1e-64    
ref|XP_006733411.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    223   1e-64    



>ref|XP_006355233.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=676

 Score =   368 bits (944),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  ++ALNE GKPWEINEGDGAFYGPKIDISV DAMKRKFQCATLQLDFQLPQRFNL
Sbjct  475  KAEAALSEALNEHGKPWEINEGDGAFYGPKIDISVSDAMKRKFQCATLQLDFQLPQRFNL  534

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ++
Sbjct  535  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQSY  594

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             ++LR++IH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EAT+G+VSVRVRD P
Sbjct  595  ALKLREQIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEATSGQVSVRVRDKP  654

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            DH+VMTVD LLAHFKD++AS++
Sbjct  655  DHQVMTVDVLLAHFKDMVASFQ  676



>ref|XP_004246064.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=676

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  ++ALNE GKPWEINEGDGAFYGPKIDISV DAMKRKFQCATLQLDFQLPQRFNL
Sbjct  475  KAEAALSEALNEHGKPWEINEGDGAFYGPKIDISVSDAMKRKFQCATLQLDFQLPQRFNL  534

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ++
Sbjct  535  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQSY  594

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             ++LR++IH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA++G+VSVRVRD P
Sbjct  595  ALKLREQIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEASSGQVSVRVRDKP  654

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            DH+VMTVD LLA FKD++AS++
Sbjct  655  DHQVMTVDVLLAQFKDMVASFQ  676



>ref|XP_009622103.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana tomentosiformis]
Length=721

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              +AL+EFGKPWE NEGDGAFYGPKIDISV DAM+RKFQCATLQLDFQLPQRFNLSYSAE
Sbjct  525  LAEALDEFGKPWEKNEGDGAFYGPKIDISVSDAMRRKFQCATLQLDFQLPQRFNLSYSAE  584

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ++ +ELR
Sbjct  585  DENKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQSYALELR  644

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            +RIH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA++ +VSVRVRD PDH+VM
Sbjct  645  ERIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEASSRQVSVRVRDKPDHQVM  704

Query  110  TVDELLAHFKDLMASYK  60
            TVD+LL HFKD++AS++
Sbjct  705  TVDDLLGHFKDMVASFQ  721



>ref|XP_009794575.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana sylvestris]
Length=725

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              +AL+EFGKPWE NEGDGAFYGPKIDISV DAM+RKFQCATLQLDFQLPQRFNL+YSAE
Sbjct  529  LAEALDEFGKPWEKNEGDGAFYGPKIDISVSDAMRRKFQCATLQLDFQLPQRFNLAYSAE  588

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQ++ +ELR
Sbjct  589  DENKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQSYALELR  648

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            +RIH+AG++VDVDTSDRTIQKKVREAQVAQYNYILVVGE EA++ +VSVRVRD PDH+VM
Sbjct  649  ERIHDAGYYVDVDTSDRTIQKKVREAQVAQYNYILVVGEAEASSRQVSVRVRDKPDHQVM  708

Query  110  TVDELLAHFKDLMASYK  60
            TV +LLAHFKD++AS++
Sbjct  709  TVGDLLAHFKDMVASFQ  725



>ref|XP_006355966.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=725

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -1

Query  635  NEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR  456
            NEFGKPWEINEGDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR
Sbjct  534  NEFGKPWEINEGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR  593

Query  455  ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRIHE  276
            ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS ++  ELR+RIH+
Sbjct  594  ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSLSYAFELRERIHD  653

Query  275  AGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDEL  96
            AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE E ++G+VSVRVR  PDH+VMTVD L
Sbjct  654  AGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEAEVSSGQVSVRVRSKPDHEVMTVDGL  713

Query  95   LAHFKDLMASYK  60
            L HFKDL+AS++
Sbjct  714  LTHFKDLVASFQ  725



>ref|XP_004238685.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=725

 Score =   356 bits (914),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -1

Query  635  NEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR  456
            NEFGKPWEINEGDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR
Sbjct  534  NEFGKPWEINEGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR  593

Query  455  ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRIHE  276
            ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKS ++  ELR+RIH+
Sbjct  594  ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSLSYAFELRERIHD  653

Query  275  AGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDEL  96
            AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE EA++G+VSVRVR   DH+VMTVD L
Sbjct  654  AGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEAEASSGQVSVRVRSKSDHEVMTVDGL  713

Query  95   LAHFKDLMASYK  60
            L HFKDL+AS++
Sbjct  714  LTHFKDLVASFQ  725



>ref|XP_004170956.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=305

 Score =   334 bits (857),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF L
Sbjct  104  KAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPARFEL  163

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  164  YYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  223

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  224  ALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKA  283

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+++ LL HFK+ +A++
Sbjct  284  DHSVMSIESLLNHFKEEVAAF  304



>gb|KGN49712.1| hypothetical protein Csa_5G080780 [Cucumis sativus]
Length=321

 Score =   333 bits (855),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF L
Sbjct  120  KAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPARFEL  179

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  180  YYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  239

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  240  ALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKA  299

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+++ LL HFK+ +A++
Sbjct  300  DHSVMSIESLLNHFKEEVAAF  320



>gb|KDO82534.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=291

 Score =   332 bits (850),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  90   KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFNL  149

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  150  GYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  209

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVRD  
Sbjct  210  ALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKSGQVSVRVRDQG  269

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            DH  M++++LL HFK+ + +++
Sbjct  270  DHSNMSIEDLLKHFKEKLEAFQ  291



>ref|XP_010274327.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=729

 Score =   345 bits (886),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  528  KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVFDALKRKFQCATLQLDFQLPSRFNL  587

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  588  SYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAVVCPVSEKSQPY  647

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  648  ALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKS  707

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH V +++ELL HFK+ +A++
Sbjct  708  DHSVKSIEELLTHFKEEVAAF  728



>ref|XP_006438443.1| hypothetical protein CICLE_v100308251mg, partial [Citrus clementina]
 gb|ESR51683.1| hypothetical protein CICLE_v100308251mg, partial [Citrus clementina]
Length=315

 Score =   331 bits (848),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  114  KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFNL  173

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  174  GYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  233

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVRD  
Sbjct  234  ALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKSGQVSVRVRDQG  293

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            DH  M++++LL HFK+ + +++
Sbjct  294  DHSNMSIEDLLKHFKEKLEAFQ  315



>ref|XP_010272819.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nelumbo 
nucifera]
Length=726

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  525  KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVFDALKRKFQCATLQLDFQLPSRFNL  584

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  585  SYSAEDEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  644

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  645  ALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKA  704

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            DH V ++ +LL HFK+ +A+++
Sbjct  705  DHSVKSIQDLLTHFKEEVAAFR  726



>gb|EPS72288.1| hypothetical protein M569_02470 [Genlisea aurea]
Length=690

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   DALNEFGKPWEINE DGAFYGPKIDISV DAMKRKFQCATLQLDFQLP RFNL
Sbjct  489  KAEAALADALNEFGKPWEINEADGAFYGPKIDISVSDAMKRKFQCATLQLDFQLPARFNL  548

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDKSQ++
Sbjct  549  SYSAEDETKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDKSQSY  608

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +E+++RIH+AG++VDVDT+DRTI KKVREAQVAQYNYILVVGEKE  TG+V+VRVRD  
Sbjct  609  ALEVKNRIHDAGYYVDVDTTDRTINKKVREAQVAQYNYILVVGEKEVGTGQVAVRVRDNS  668

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D  +M++D+LL  FK  +A+++
Sbjct  669  DTNLMSIDDLLNRFKSEVAAHR  690



>ref|XP_011076219.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Sesamum indicum]
Length=722

 Score =   340 bits (873),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              DALNEFGKPWEINEGDGAFYGPKIDISV DAM+RKFQCATLQLDFQLP RFNLSYSAE
Sbjct  526  LADALNEFGKPWEINEGDGAFYGPKIDISVSDAMRRKFQCATLQLDFQLPARFNLSYSAE  585

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDKS ++ +++R
Sbjct  586  DETKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDKSHSYALQVR  645

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            DRIH+AGF+VDVDT+DRTI KKVREAQ+AQYNYILVVGEKE  TG+V+VRVRD  D  + 
Sbjct  646  DRIHDAGFYVDVDTTDRTINKKVREAQLAQYNYILVVGEKEVGTGQVAVRVRDNFDANLK  705

Query  110  TVDELLAHFKDLMASYK  60
            ++D+LL +FKD +A+++
Sbjct  706  SIDDLLNYFKDEVAAFR  722



>gb|ADE77216.1| unknown [Picea sitchensis]
Length=215

 Score =   320 bits (819),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALN FGKPW+INEGDGAFYGPKIDI+V DA+KRKFQCAT+QLDFQLP RF+LSYS E
Sbjct  19   LTEALNAFGKPWQINEGDGAFYGPKIDITVFDALKRKFQCATIQLDFQLPIRFDLSYSTE  78

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRERPVMIHRAILGSVERM AILLEH+ GKWPFWLSPRQA+VCPVS+KS  + + +R
Sbjct  79   DEAKRERPVMIHRAILGSVERMLAILLEHYAGKWPFWLSPRQAIVCPVSEKSSDYALRVR  138

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            D+IH+AG++VDVDTSDR IQKK+REAQ+AQYNYILVVGE+EA TG+VSVR+RD   H+V 
Sbjct  139  DQIHQAGYYVDVDTSDRKIQKKIREAQLAQYNYILVVGEEEANTGQVSVRIRDKSAHEVR  198

Query  110  TVDELLAHFKDLMASY  63
            ++DELL  F++ + ++
Sbjct  199  SMDELLKLFREEIEAF  214



>ref|XP_008460557.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Cucumis melo]
Length=724

 Score =   335 bits (859),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF L
Sbjct  523  KAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPTRFEL  582

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  583  YYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  642

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             M++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  643  AMKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKA  702

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+V+ LL HFK+ +A++
Sbjct  703  DHSVMSVESLLNHFKEEVAAF  723



>gb|EYU25062.1| hypothetical protein MIMGU_mgv1a002240mg [Erythranthe guttata]
Length=696

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +ALNEFGKPW+INE DGAFYGPKIDI+V DAM R FQCATLQLDFQLP RFNL
Sbjct  495  KAEAALEEALNEFGKPWKINEADGAFYGPKIDITVFDAMGRDFQCATLQLDFQLPARFNL  554

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  555  SYSAEDETKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQQY  614

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +E+RDRIH+AGF+VDVDT+DRTI KKVREAQ+AQYNYILVVGEKE  TG+V+VRVRDI 
Sbjct  615  ALEVRDRIHDAGFYVDVDTTDRTINKKVREAQMAQYNYILVVGEKEVGTGQVAVRVRDIN  674

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D  + ++D++L  FKD  AS+K
Sbjct  675  DANLQSIDDVLNRFKDETASFK  696



>emb|CDP00192.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +ALNEFGKPW+INEGDGAFYGPKIDISV DAM+R+FQCATLQLDFQLP RFNL
Sbjct  526  KAEAALKEALNEFGKPWQINEGDGAFYGPKIDISVNDAMRRQFQCATLQLDFQLPSRFNL  585

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SY+AEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  586  SYTAEDENKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  645

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             ++LRD+IH+AG++VDVD +DRTIQKKVREAQVAQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  646  ALKLRDQIHDAGYYVDVDATDRTIQKKVREAQVAQYNYILVVGEEEAKTGQVSVRVRDKA  705

Query  125  DHKVMTVDELLAHFKDLMASYK  60
             H V +V+ELL+  K+ +A+++
Sbjct  706  SHSVKSVEELLSDLKNEVAAFR  727



>ref|XP_004142299.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=724

 Score =   333 bits (854),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF L
Sbjct  523  KAEAALTEALNEFGKPWQIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPARFEL  582

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  583  YYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  642

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD IH AG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  643  ALKVRDLIHHAGYFVDVDVTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKA  702

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+++ LL HFK+ +A++
Sbjct  703  DHSVMSIESLLNHFKEEVAAF  723



>ref|XP_010100498.1| Threonine--tRNA ligase [Morus notabilis]
 gb|EXB82632.1| Threonine--tRNA ligase [Morus notabilis]
Length=625

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 179/195 (92%), Gaps = 0/195 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  424  KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPARFEL  483

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+KRE PVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  484  YYSAEDEAKREAPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  543

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVR+R+  
Sbjct  544  ALKVRDQIHDAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEANTGQVSVRLRNSY  603

Query  125  DHKVMTVDELLAHFK  81
            DH VM+++ELL HFK
Sbjct  604  DHSVMSMEELLQHFK  618



>ref|XP_002265302.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Vitis vinifera]
 emb|CBI32119.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+AL++ GKPWEINEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF+L
Sbjct  485  KAEAALTEALDQSGKPWEINEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPSRFDL  544

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  545  SYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  604

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  605  ALKVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKG  664

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+++ LL+ FK  +A++
Sbjct  665  DHSVMSMENLLSFFKSEIAAF  685



>gb|KHN12091.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=599

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S   +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  398  KAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDRFKL  457

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  458  EFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  517

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVRD+ 
Sbjct  518  ALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNFILVVGEEEANSGQVSVRVRDLA  577

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +HKVM++++LL HF+D  A+++
Sbjct  578  EHKVMSIEKLLEHFRDKTAAFE  599



>ref|XP_003613276.1| Threonyl-tRNA synthetase [Medicago truncatula]
 gb|AES96234.1| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago 
truncatula]
Length=711

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +AL+EFGKPW++NEGDGAFYGPKIDISV DA++RKFQCATLQLDFQLP RF L
Sbjct  510  KAEASLKEALDEFGKPWQLNEGDGAFYGPKIDISVSDALRRKFQCATLQLDFQLPDRFKL  569

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA++CPVS+KSQA+
Sbjct  570  EFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAILCPVSEKSQAY  629

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  630  ALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVRDKA  689

Query  125  DHKVMTVDELLAHFKD  78
            DH VMT++ LL HFKD
Sbjct  690  DHSVMTIENLLEHFKD  705



>ref|XP_006483810.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Citrus 
sinensis]
Length=718

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  517  KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFNL  576

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  577  GYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  636

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD I+ AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVRD  
Sbjct  637  ALQVRDHIYRAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKSGQVSVRVRDQG  696

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            DH  M++++LL HFK+ + +++
Sbjct  697  DHSNMSIEDLLKHFKEKLEAFQ  718



>ref|XP_003519592.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=710

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S   +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  509  KAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALGRKFQCATLQLDFQLPDRFKL  568

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQA+
Sbjct  569  EFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQAY  628

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD+ 
Sbjct  629  ALQVRDQIHQAGYYVDADTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDLA  688

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +HKVM++++LL HF+D  A+++
Sbjct  689  EHKVMSIEKLLEHFRDKAAAFE  710



>ref|XP_010533069.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=714

 Score =   330 bits (845),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +ALN FGKPW++NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L YSAEDE
Sbjct  520  EALNAFGKPWQLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYSAEDE  579

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS  + ++++++
Sbjct  580  AKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSSPYALKVKEQ  639

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            +H AG++VDVDTSDR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVRVRD  DHKVM++
Sbjct  640  VHNAGYYVDVDTSDRKIQKKVREAQLAQYNFILVVGEEEAATGQVSVRVRDKSDHKVMSI  699

Query  104  DELLAHFKDLMASY  63
            ++LL HFKD +A+Y
Sbjct  700  EDLLNHFKDEVAAY  713



>gb|KHN00337.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=725

 Score =   330 bits (846),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S   +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  524  KAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALGRKFQCATLQLDFQLPDRFKL  583

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQA+
Sbjct  584  EFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQAY  643

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD+ 
Sbjct  644  ALQVRDQIHQAGYYVDADTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDLA  703

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +HKVM++++LL HF+D  A+++
Sbjct  704  EHKVMSIEKLLEHFRDKAAAFE  725



>ref|XP_006346202.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=413

 Score =   320 bits (821),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              +ALNEFGKPWEIN+GDGAFYGPKIDISV DAMKR  QCATLQLDFQLP+RFNL Y AE
Sbjct  217  LAEALNEFGKPWEINKGDGAFYGPKIDISVSDAMKRNLQCATLQLDFQLPERFNLLYVAE  276

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
             +  RERPVMIHRAILGSVERMFAIL EH+KGKWPFWLSPRQA+VCPVS+KSQ++  E+ 
Sbjct  277  YDQIRERPVMIHRAILGSVERMFAILFEHYKGKWPFWLSPRQAIVCPVSNKSQSYAFEIW  336

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
             R+H+A +HVD+D SD+T+ KKVREAQ+ QYNYILVVGE+EA  G+VSVRVRD  DH+VM
Sbjct  337  KRLHDARYHVDIDVSDKTVGKKVREAQLVQYNYILVVGEEEAKNGQVSVRVRDKRDHQVM  396

Query  110  TVDELLAHFKDLMASYK  60
            TVDELL  FKD++AS++
Sbjct  397  TVDELLDQFKDMVASFQ  413



>ref|XP_010644571.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Vitis 
vinifera]
 emb|CBI39735.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALN+ GKPWEINEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF+L
Sbjct  485  KAEAALTEALNQSGKPWEINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPSRFDL  544

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  545  SYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  604

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA T +VSVRVRD  
Sbjct  605  ALQVRDQIHQAGYYVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEANTRQVSVRVRDKG  664

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+++ LL++FK   A++
Sbjct  665  DHSVMSMENLLSYFKSETAAF  685



>ref|XP_004489863.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=719

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +AL+EFGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  518  KAENSLKEALDEFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDRFKL  577

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA++CPVS+KSQA+
Sbjct  578  EFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAILCPVSEKSQAY  637

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  638  ALKVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNYILVVGEEEANTGQVSVRVRDKA  697

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+++ LL HF+D +A++
Sbjct  698  DHSVMSIENLLKHFEDEVAAF  718



>ref|XP_003517788.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=717

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S   +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  516  KAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDRFKL  575

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  576  EFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  635

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG+HVD DT+DR IQKKVREAQ+AQYN+ILVVGE+EA +G+VSVRVRD+ 
Sbjct  636  ALQVRDQIHQAGYHVDADTTDRKIQKKVREAQLAQYNFILVVGEEEANSGQVSVRVRDLA  695

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +HKVM++++LL HF+D  A+++
Sbjct  696  EHKVMSIEKLLEHFRDKTAAFE  717



>ref|XP_007157476.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
 gb|ESW29470.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
Length=707

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S   +AL++FGKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  506  KAESALKEALDDFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCATLQLDFQLPDRFKL  565

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +SAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQA+
Sbjct  566  EFSAEDEAKIERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQAY  625

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG+ VD DT+DR IQKKVREAQ+AQ+NYILVVGE+EA TG+VSVRVRD  
Sbjct  626  ALQVRDQIHQAGYQVDADTTDRKIQKKVREAQLAQFNYILVVGEEEANTGQVSVRVRDKG  685

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DHKVM++++LL HF+D  A++
Sbjct  686  DHKVMSIEDLLKHFRDEAAAF  706



>ref|XP_002311580.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE88947.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=715

 Score =   327 bits (839),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+AL+EFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF L YSAE
Sbjct  519  LTEALDEFGKPWKIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFKLEYSAE  578

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE++ E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++ +++R
Sbjct  579  DEARSEAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSYALQVR  638

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            D+IHEAG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E+ TG+VSVRVRD  DH VM
Sbjct  639  DQIHEAGYYVDVDATDRKIQKKVREAQLAQYNYILVVGEEESKTGQVSVRVRDNADHSVM  698

Query  110  TVDELLAHFKDLMASYK  60
            +++ LL  FK+L+A ++
Sbjct  699  SIESLLGLFKELVADFR  715



>gb|KDP21323.1| hypothetical protein JCGZ_21794 [Jatropha curcas]
Length=676

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+EFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L YSAEDE+
Sbjct  483  ALDEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDRFELEYSAEDEA  542

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +  +++ +I
Sbjct  543  KRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPYAEQVQAQI  602

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            H+AG+HVDVDT+DR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVRVRD  DH VM+++
Sbjct  603  HKAGYHVDVDTTDRKIQKKVREAQLAQYNFILVVGEEEAKTGQVSVRVRDKGDHSVMSME  662

Query  101  ELLAHFKDLMASY  63
             LL HF+D +A++
Sbjct  663  SLLKHFEDEVAAF  675



>ref|XP_011025470.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=715

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+AL+EFGKPW+I+EGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF + YSAE
Sbjct  519  LTEALDEFGKPWKIDEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFKVEYSAE  578

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++ +++R
Sbjct  579  DEAKSEAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSYALQVR  638

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            D+IHEAG+ VDVD +DR IQKKVREAQ+AQYNYILVVGE+E+ TG+VSVRVRD  DH VM
Sbjct  639  DQIHEAGYFVDVDATDRKIQKKVREAQLAQYNYILVVGEEESKTGQVSVRVRDNADHSVM  698

Query  110  TVDELLAHFKDLMASYK  60
            +++ LL  FK+L+A ++
Sbjct  699  SIESLLGLFKELVADFR  715



>ref|XP_009360487.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009363511.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
Length=676

 Score =   324 bits (831),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 176/196 (90%), Gaps = 1/196 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATLQLDFQLPQ+F L
Sbjct  474  KAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATLQLDFQLPQKFEL  533

Query  485  SYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
            +YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQA+VCPVSDKSQ 
Sbjct  534  NYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQAIVCPVSDKSQP  593

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + +E+RDRIH+AG++VDVDT+DRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RVRD 
Sbjct  594  YALEVRDRIHQAGYYVDVDTTDRTIQKKVREAQIAQYNYILVVGEEEVKTGQVSLRVRDK  653

Query  128  PDHKVMTVDELLAHFK  81
             D  VMT+D LL HFK
Sbjct  654  GDVSVMTMDNLLQHFK  669



>ref|XP_006378416.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|ERP56213.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=696

 Score =   325 bits (833),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              +ALNEFGKPW+ NEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF L YSAE
Sbjct  500  LAEALNEFGKPWKFNEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFKLEYSAE  559

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+K E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++ ++++
Sbjct  560  DEAKSETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSYALQVQ  619

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            D+IHEAG+ VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVR+RD  DH VM
Sbjct  620  DQIHEAGYFVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRMRDNADHSVM  679

Query  110  TVDELLAHFKDLMASYK  60
            +++ LL  FKD +A ++
Sbjct  680  SIESLLKLFKDAVADFR  696



>gb|KDO82533.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=325

 Score =   313 bits (802),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 182/236 (77%), Gaps = 34/236 (14%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  90   KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFNL  149

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  150  GYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  209

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKK---------------------------------  225
             +++RD I+ AG++VDVDT+DR IQKK                                 
Sbjct  210  ALQVRDHIYRAGYYVDVDTTDRKIQKKPNSFVHARSTYIEVVFSCWEELVAGINIYPIRV  269

Query  224  -VREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  60
             VREAQ+AQYN+ILVVGE+EA +G+VSVRVRD  DH  M++++LL HFK+ + +++
Sbjct  270  SVREAQLAQYNFILVVGEEEAKSGQVSVRVRDQGDHSNMSIEDLLKHFKEKLEAFQ  325



>ref|XP_006836673.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
 gb|ERM99526.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
Length=723

 Score =   325 bits (832),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 178/195 (91%), Gaps = 0/195 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +AL+EFG+ WEIN GDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL+YSAEDE
Sbjct  529  EALDEFGRDWEINTGDGAFYGPKIDISVFDALKRKFQCATLQLDFQLPARFNLTYSAEDE  588

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQA+ +++RD+
Sbjct  589  AKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQAYALKVRDQ  648

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            IH+AG++VDVDT+DR IQKKVREAQ+AQYNYILVVGE+EA T +VSVRVRD  DH V  +
Sbjct  649  IHQAGYYVDVDTTDRKIQKKVREAQLAQYNYILVVGEEEANTNQVSVRVRDKSDHSVKFM  708

Query  104  DELLAHFKDLMASYK  60
            ++LL  F++  A+++
Sbjct  709  EDLLTQFREDTAAFR  723



>ref|XP_009412586.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   325 bits (833),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  ++ALNEFG+PW+INEGDGAFYGPKIDI V DA+ RKFQCATLQLDFQLP RF L
Sbjct  530  KAEAALSEALNEFGRPWQINEGDGAFYGPKIDIGVFDALNRKFQCATLQLDFQLPLRFKL  589

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++
Sbjct  590  SYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSY  649

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++ D+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  650  AQQVHDKIHQAGYYVDADLTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVRDGS  709

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH VM+++ LL HFK+ +A++
Sbjct  710  DHSVMSLEALLEHFKEEVAAF  730



>ref|XP_008340003.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Malus 
domestica]
Length=676

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATLQLDFQLPQ+F L
Sbjct  474  KAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATLQLDFQLPQKFEL  533

Query  485  SYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQA+VCPVSDKSQ 
Sbjct  534  YYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQAIVCPVSDKSQP  593

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            +  E+RDRIHEAG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RVRD 
Sbjct  594  YAQEVRDRIHEAGYYVDVDTSDRTIQKKVREAQIAQYNYILVVGEEEVKTGQVSLRVRDH  653

Query  128  PDHKVMTVDELLAHFK  81
             D  VMT++ LL HFK
Sbjct  654  GDVTVMTMENLLQHFK  669



>ref|XP_010551550.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=717

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 172/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +ALN FGKPW++NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L YSAEDE
Sbjct  523  EALNAFGKPWQLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYSAEDE  582

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +KRERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KS  + +++RD+
Sbjct  583  AKRERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSSPYALKVRDQ  642

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            IH+AG++VDVD SDR IQKKVREAQ+AQYNYILVVGE EA TG+VSVRVRD  DH V ++
Sbjct  643  IHDAGYYVDVDLSDRKIQKKVREAQLAQYNYILVVGEDEAKTGQVSVRVRDKSDHSVKSI  702

Query  104  DELLAHFKDLMASY  63
            + LL  FKD  A+Y
Sbjct  703  EGLLQQFKDEAAAY  716



>ref|XP_008361801.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Malus domestica]
Length=731

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   DALNEFGKPW+INEGDGAFYGPKIDISV DA+ RK+QCATLQLDFQLPQ+F L
Sbjct  529  KAEAALADALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKYQCATLQLDFQLPQKFEL  588

Query  485  SYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE +E K ERPVMIHRA+LGSVERMFAILLE++KGKWPFWLSPRQA+VCPVSDKSQ 
Sbjct  589  YYSAEGEEGKLERPVMIHRAVLGSVERMFAILLENYKGKWPFWLSPRQAIVCPVSDKSQP  648

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            +  E+RDRIHEAG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RVRD 
Sbjct  649  YAQEVRDRIHEAGYYVDVDTSDRTIQKKVREAQIAQYNYILVVGEEEVKTGQVSLRVRDH  708

Query  128  PDHKVMTVDELLAHFK  81
             D  VMT++ LL HFK
Sbjct  709  GDVTVMTMENLLQHFK  724



>gb|EEC83306.1| hypothetical protein OsI_28675 [Oryza sativa Indica Group]
Length=306

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  105  KAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  164

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S  +
Sbjct  165  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNSVEY  224

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVRD  
Sbjct  225  AKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVRDKA  284

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +   +++D+++  FK+ +A+YK
Sbjct  285  ELATVSIDDIITRFKEEVAAYK  306



>ref|XP_010913364.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Elaeis guineensis]
Length=727

 Score =   323 bits (827),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             TDALNEFG+PW+INEGDGAFYGPKIDI V DA+KRKFQC TLQLDFQLP RF LSYSAE
Sbjct  531  LTDALNEFGRPWQINEGDGAFYGPKIDIGVFDALKRKFQCGTLQLDFQLPLRFKLSYSAE  590

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VC VS+KS+ +  ++R
Sbjct  591  DEKKMERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCNVSEKSEDYAKQVR  650

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            D+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  DH  M
Sbjct  651  DQIHQAGYYVDADITDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVRDGSDHSTM  710

Query  110  TVDELLAHFKDLMASY  63
            +++ LL HFK+  A+Y
Sbjct  711  SMEALLTHFKEEAAAY  726



>ref|XP_004296467.2| PREDICTED: threonine--tRNA ligase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=732

 Score =   323 bits (828),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 177/202 (88%), Gaps = 1/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  530  KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPARFEL  589

Query  485  SYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDKSQ 
Sbjct  590  YYSAEGEEGKREAPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDKSQP  649

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            +  ++RDRI +AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VSVRVRD 
Sbjct  650  YAQQVRDRIFQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEVKTGQVSVRVRDK  709

Query  128  PDHKVMTVDELLAHFKDLMASY  63
             D  VM++D LL HFK+ + ++
Sbjct  710  GDSNVMSMDGLLEHFKNEVEAF  731



>ref|XP_009599596.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=405

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 174/197 (88%), Gaps = 1/197 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              +AL EFGKPW   EGDGAFYGPKIDI+V DAM R+FQCATLQLDFQLP+RF L+Y AE
Sbjct  210  LVEALEEFGKPWGRKEGDGAFYGPKIDITVSDAMNREFQCATLQLDFQLPERFELTYKAE  269

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D S  ERPVMIHRAILGSVERMFAIL EHF+GKWPFWLSPRQAMVCPVS+KSQ++ +ELR
Sbjct  270  DGSD-ERPVMIHRAILGSVERMFAILCEHFEGKWPFWLSPRQAMVCPVSNKSQSYALELR  328

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
             +IH+AG++VDV+TSD+T+QKKVREAQ A+YNYILVVGE EA +G+VSVRVRD  D +VM
Sbjct  329  KQIHDAGYYVDVETSDKTLQKKVREAQEAKYNYILVVGEAEAKSGQVSVRVRDNRDIQVM  388

Query  110  TVDELLAHFKDLMASYK  60
            TVD+LL HFKD++AS++
Sbjct  389  TVDDLLHHFKDIVASFQ  405



>ref|XP_011021655.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=678

 Score =   320 bits (820),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  635  NEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR  456
            NEFGKPW+ NEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RF L YSAEDE+K 
Sbjct  487  NEFGKPWKFNEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFKLEYSAEDEAKS  546

Query  455  ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRIHE  276
            E PVMIHRAILGSVERMFA+LLEH+KGKWPFWLSPRQA+VCPVS+KSQ++ ++++D+IHE
Sbjct  547  ETPVMIHRAILGSVERMFAVLLEHYKGKWPFWLSPRQAIVCPVSEKSQSYALQVQDQIHE  606

Query  275  AGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDEL  96
            AG+ VD DT+DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  DH VM+++ L
Sbjct  607  AGYFVDADTTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVRDNADHSVMSIESL  666

Query  95   LAHFKDLMASYK  60
            L  FKD ++ ++
Sbjct  667  LKLFKDAVSDFR  678



>gb|KJB48103.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=533

 Score =   314 bits (805),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALN+ GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP+RF L YSAE
Sbjct  337  LTEALNQSGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPERFKLEYSAE  396

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ + M++R
Sbjct  397  DEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQQYAMQVR  456

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            D IHEAG++VDVD +DR IQKK+REAQ+AQYN+ILVVGE+E  T +VSVRVRD  D   M
Sbjct  457  DWIHEAGYYVDVDMTDRKIQKKIREAQLAQYNFILVVGEEEMNTKKVSVRVRDSGDFSGM  516

Query  110  TVDELLAHFK  81
            ++++LL HF+
Sbjct  517  SIEDLLNHFQ  526



>ref|XP_007225203.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
 gb|EMJ26402.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
Length=724

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNE GKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  522  KAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPTRFEL  581

Query  485  SYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDKSQ 
Sbjct  582  YYSAEGEEGKRETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDKSQP  641

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + +E+R+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RVRD 
Sbjct  642  YALEVRNRIHQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEVKTGQVSLRVRDK  701

Query  128  PDHKVMTVDELLAHFK  81
             D  VM+++ LL HFK
Sbjct  702  GDVTVMSMENLLQHFK  717



>ref|XP_008221771.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Prunus 
mume]
Length=721

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNE GKPW++NEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  519  KAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPARFEL  578

Query  485  SYSAE-DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE +E KRE PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVSDKSQ 
Sbjct  579  YYSAEGEEGKRETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSDKSQP  638

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + +E+R+RIH+AG++VDVDTSDRTIQKKVREAQ+AQYNYILVVGE+E  TG+VS+RVRD 
Sbjct  639  YALEVRNRIHQAGYYVDVDTSDRTIQKKVREAQMAQYNYILVVGEEEVKTGQVSLRVRDK  698

Query  128  PDHKVMTVDELLAHFK  81
             D  VM+++ LL HFK
Sbjct  699  GDVTVMSMENLLQHFK  714



>ref|XP_008802022.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Phoenix dactylifera]
Length=727

 Score =   317 bits (812),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  +DALNEFG+PW INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  526  KAEAALSDALNEFGRPWLINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  585

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VC VS+KS+ +
Sbjct  586  SYSAEDEKKMERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCNVSEKSEDY  645

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++RD+IH+AG++VD D +DR IQKKVREAQ+AQYNYILVVGE+EA TG+VSVRVRD  
Sbjct  646  AKQVRDQIHQAGYYVDADITDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVSVRVRDGS  705

Query  125  DHKVMTVDELLAHFKDLMASY  63
            DH   +++ LL H K+ +A+Y
Sbjct  706  DHSTKSMEALLTHLKEEVAAY  726



>ref|XP_010044651.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW86747.1| hypothetical protein EUGRSUZ_B03357 [Eucalyptus grandis]
Length=737

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  635  NEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR  456
            NE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF LSYSAEDE K 
Sbjct  546  NESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPARFELSYSAEDEGKT  605

Query  455  ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRIHE  276
            E PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ++ +++RD+IH+
Sbjct  606  ETPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQSYALKVRDQIHD  665

Query  275  AGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDEL  96
            AG++VDVD +DR IQKKVREAQ+AQYN+ILVVGE+EA TG+VSVRVRD  DH VM V++L
Sbjct  666  AGYYVDVDETDRKIQKKVREAQLAQYNFILVVGEEEANTGQVSVRVRDKSDHSVMRVEDL  725

Query  95   LAHFKDLMASY  63
            L  F++ +A++
Sbjct  726  LKFFQEEVAAF  736



>ref|XP_004510448.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=458

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 173/202 (86%), Gaps = 1/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +AL+EFGKPW++NEGDGAFYGPKIDISV DA+ RKFQC TLQLDFQLP  F L
Sbjct  256  KAENELREALDEFGKPWQLNEGDGAFYGPKIDISVSDALSRKFQCGTLQLDFQLPDSFKL  315

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +S EDE+K ERPVMIHR+ILGSVE MFAILLEH+KGKWPFWLSPRQA++CPVS+KSQA+
Sbjct  316  EFSTEDEAKIERPVMIHRSILGSVESMFAILLEHYKGKWPFWLSPRQAILCPVSEKSQAY  375

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IHE G+HVD DT+D  IQKKV EA++AQYNYILVVGE EA TG+VSV+VRD  
Sbjct  376  ALQVRDQIHEEGYHVDADTTDMEIQKKVEEARLAQYNYILVVGEDEANTGQVSVQVRDNE  435

Query  125  DHK-VMTVDELLAHFKDLMASY  63
            DH  +M+++ LL HFKD +A++
Sbjct  436  DHSIIMSIENLLKHFKDEVAAF  457



>gb|KJB48102.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=714

 Score =   314 bits (804),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALN+ GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP+RF L YSAE
Sbjct  518  LTEALNQSGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPERFKLEYSAE  577

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ + M++R
Sbjct  578  DEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQQYAMQVR  637

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            D IHEAG++VDVD +DR IQKK+REAQ+AQYN+ILVVGE+E  T +VSVRVRD  D   M
Sbjct  638  DWIHEAGYYVDVDMTDRKIQKKIREAQLAQYNFILVVGEEEMNTKKVSVRVRDSGDFSGM  697

Query  110  TVDELLAHFK  81
            ++++LL HF+
Sbjct  698  SIEDLLNHFQ  707



>ref|XP_010688668.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=688

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 174/201 (87%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNE GKPW++NEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  487  KAEAALTEALNESGKPWQLNEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPLRFNL  546

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+KRERPV+IHRAILGSVERMFAILLEH+KGKWP WLSPRQA+VC VS+KS A+
Sbjct  547  SYSAEDEAKRERPVIIHRAILGSVERMFAILLEHYKGKWPLWLSPRQAIVCNVSEKSSAY  606

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+ D+IH+AG+ VDVDTSDRTI KKVREAQ++QYNYILVVGEK+A    V+VRVRD  
Sbjct  607  AHEVCDQIHKAGYFVDVDTSDRTINKKVREAQLSQYNYILVVGEKDAENRVVTVRVRDKN  666

Query  125  DHKVMTVDELLAHFKDLMASY  63
            +H  M+V+ LL HF + + +Y
Sbjct  667  EHSPMSVENLLKHFGEEVKAY  687



>ref|XP_007044584.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
 gb|EOY00416.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
Length=686

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L YSAE
Sbjct  490  LTEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDRFKLEYSAE  549

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KSQ +  E++
Sbjct  550  DEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKSQDYAREVQ  609

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            ++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVRD  D   M
Sbjct  610  EQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVRDKGDLTSM  669

Query  110  TVDELLAHFKDLMASY  63
            +++ LL H KD +A++
Sbjct  670  SIEGLLQHLKDEIAAF  685



>emb|CAC79651.1| threonyl-tRNA synthetase [Oryza sativa Japonica Group]
Length=531

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  330  KAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  389

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S  +
Sbjct  390  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNSVEY  449

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+ YILVVG +EA TG+VSVRVRD  
Sbjct  450  AKQVRVRIHEAGFHVAIDETDRTIQKKVREAQLAQFKYILVVGAQEAETGQVSVRVRDKA  509

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +   +++D+++  FK+ +A+YK
Sbjct  510  ELATVSIDDIITRFKEEVAAYK  531



>ref|XP_007044582.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY00414.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=715

 Score =   312 bits (799),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALNE GKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L YSAE
Sbjct  519  LTEALNESGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDRFKLEYSAE  578

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KSQ +  E++
Sbjct  579  DEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKSQDYAREVQ  638

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            ++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVRD  D   M
Sbjct  639  EQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVRDKGDLTSM  698

Query  110  TVDELLAHFKDLMASY  63
            +++ LL H KD +A++
Sbjct  699  SIEGLLQHLKDEIAAF  714



>gb|EEE68426.1| hypothetical protein OsJ_26793 [Oryza sativa Japonica Group]
Length=701

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  500  KAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  559

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S  +
Sbjct  560  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNSVEY  619

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVRD  
Sbjct  620  AKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVRDKA  679

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +   +++D+++  FK+ +A+YK
Sbjct  680  ELATVSIDDIITRFKEEVAAYK  701



>ref|XP_006659275.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Oryza 
brachyantha]
Length=696

 Score =   310 bits (793),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  495  KAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  554

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S  +
Sbjct  555  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNSVEY  614

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVRD  
Sbjct  615  AKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVRDKA  674

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +   +++D+++  FK+ +A+YK
Sbjct  675  ELATVSIDDIITRFKEEVAAYK  696



>ref|NP_001061475.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAD01219.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAD01414.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF23389.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAG91912.1| unnamed protein product [Oryza sativa Japonica Group]
Length=745

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  544  KAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  603

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S  +
Sbjct  604  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNSVEY  663

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVRD  
Sbjct  664  AKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVRDKA  723

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +   +++D+++  FK+ +A+YK
Sbjct  724  ELATVSIDDIITRFKEEVAAYK  745



>dbj|BAI39857.1| putative threonyl-tRNA synthetase [Oryza sativa Indica Group]
Length=749

 Score =   310 bits (794),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  548  KAEQQLTEALNEFGKPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  607

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC +S  S  +
Sbjct  608  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSISSNSVEY  667

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++R RIHEAGFHV +D +DRTIQKKVREAQ+AQ+NYILVVG +EA TG+VSVRVRD  
Sbjct  668  AKQVRARIHEAGFHVAIDETDRTIQKKVREAQLAQFNYILVVGAQEAETGQVSVRVRDKA  727

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +   +++D+++  FK+ +A+YK
Sbjct  728  ELATVSIDDIITRFKEEVAAYK  749



>ref|XP_004500860.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=508

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +AL+EFGKPW++ EG+GAFYGPKIDISV DA  RKFQC TLQLDFQLP  F L
Sbjct  307  KTENALREALDEFGKPWQLIEGEGAFYGPKIDISVSDAFSRKFQCGTLQLDFQLPDSFKL  366

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             +S EDE+K ERPVMIHR+ILGSVE MFAILLEH+KGKWPFWLSPRQA++CPVS+KSQA+
Sbjct  367  EFSTEDEAKTERPVMIHRSILGSVEHMFAILLEHYKGKWPFWLSPRQAILCPVSEKSQAY  426

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AG++VDVDT+D  IQKKV EA+V QYNYILVVGE+EA TG+VSV++RD  
Sbjct  427  ALQVRDQIHQAGYYVDVDTTDSKIQKKVHEARVTQYNYILVVGEEEANTGQVSVQLRDKE  486

Query  125  DHKVMTVDELLAHFKD  78
            DH V+++++LL HFKD
Sbjct  487  DHCVLSIEDLLKHFKD  502



>ref|XP_004973168.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=739

 Score =   306 bits (783),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+IN+GDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  538  KAEQQLTEALNEFGKPWQINKGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  597

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  598  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGSVEY  657

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++  R+HEAGFHVD+D SDRTIQKKVREAQ+AQ+NYILVVG +EA TG V VRVRD  
Sbjct  658  AKQVLARLHEAGFHVDIDMSDRTIQKKVREAQMAQFNYILVVGAQEAETGNVCVRVRDSA  717

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D   M VD L+  F++  A++K
Sbjct  718  DLATMNVDGLITRFREETAAFK  739



>ref|XP_006394912.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
 gb|ESQ32198.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
Length=712

 Score =   303 bits (777),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGK W++NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L YSA+DE+
Sbjct  519  ALDAFGKKWQLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYSADDEA  578

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS+ + +E+  +I
Sbjct  579  KRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKSEEYALEVEKKI  638

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            HEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V +++
Sbjct  639  HEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAKTGQVSVRLRDSAAHSVKSIE  698

Query  101  ELLAHFKDLMASYK  60
            +LL  FK   A Y+
Sbjct  699  DLLEEFKTKTAEYQ  712



>emb|CDX80596.1| BnaC07g28480D [Brassica napus]
Length=714

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGK W++NEGDGAFYGPKIDI+V DA+ RKFQCATLQLDFQLP RF L YS +DE+
Sbjct  521  ALDAFGKTWQLNEGDGAFYGPKIDITVSDALNRKFQCATLQLDFQLPDRFKLEYSGDDEA  580

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS+ + ++++++I
Sbjct  581  KRNRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKSEEYALKVKEQI  640

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            HEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V ++D
Sbjct  641  HEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIRDSAAHSVKSID  700

Query  101  ELLAHFKDLMASYK  60
            +LL  FK   A Y+
Sbjct  701  DLLEEFKTKTAEYQ  714



>ref|XP_009151164.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
 emb|CDX88245.1| BnaA06g28360D [Brassica napus]
Length=718

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGK W++NEGDGAFYGPKIDI+V DA+ RKFQCATLQLDFQLP RF L YS +DE+
Sbjct  525  ALDAFGKTWQLNEGDGAFYGPKIDITVSDALNRKFQCATLQLDFQLPDRFKLEYSGDDEA  584

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS+ + ++++++I
Sbjct  585  KRNRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKSEEYALKVKEQI  644

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            HEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V ++D
Sbjct  645  HEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIRDSAAHSVKSID  704

Query  101  ELLAHFKDLMASYK  60
            +LL  FK   A Y+
Sbjct  705  DLLEEFKTKTAEYQ  718



>ref|XP_009111770.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brassica rapa]
Length=707

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L YSA+DE+
Sbjct  514  ALDAFGKTWVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYSADDEA  573

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS+ + ++++ +I
Sbjct  574  KRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKSEEYALQVKKQI  633

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            HEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V +++
Sbjct  634  HEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIRDSAAHSVKSIE  693

Query  101  ELLAHFKDLMASYK  60
             LL  FK   A Y+
Sbjct  694  NLLEEFKTKTAEYQ  707



>gb|KFK26446.1| hypothetical protein AALP_AA8G249500 [Arabis alpina]
Length=714

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGKPW +N GDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L Y+AEDE+
Sbjct  521  ALDAFGKPWLLNPGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYAAEDEA  580

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            K ERPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS+ + +++++RI
Sbjct  581  KIERPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKSEIYALQVKERI  640

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            H+AG++VD D SDR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V ++D
Sbjct  641  HQAGYYVDADISDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLRDSAAHLVKSID  700

Query  101  ELLAHFKDLMASYK  60
            +LL  FK   A Y+
Sbjct  701  DLLEDFKAKTAEYQ  714



>dbj|BAJ93554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   301 bits (770),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  510  KAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  569

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S A+
Sbjct  570  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSSNSLAY  629

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+  +IH AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G+V +RVRD  
Sbjct  630  AKEVHAQIHAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKVVLRVRDKA  689

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D    ++ +++A F D +AS+K
Sbjct  690  DLSTESIADVIARFSDEVASFK  711



>ref|XP_004968434.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=741

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            + T+ALNEFG PW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF LSYSA
Sbjct  544  QLTEALNEFGMPWQINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKLSYSA  603

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            EDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +  ++
Sbjct  604  EDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGSVEYAKQV  663

Query  293  RDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
              R+HEAGFHVD+D SDRTIQKKVREAQVAQ+NY LVVG +EA TG VSVRVR       
Sbjct  664  LARLHEAGFHVDIDMSDRTIQKKVREAQVAQFNYTLVVGAQEAETGNVSVRVRGSDGLAT  723

Query  113  MTVDELLAHFKDLMASYK  60
            M++D L+  F++ +A++K
Sbjct  724  MSLDGLITRFREEIAAFK  741



>emb|CDX87030.1| BnaC09g03450D [Brassica napus]
Length=719

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L YSA+DE+
Sbjct  526  ALDAFGKKWVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYSADDEA  585

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KR+RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VCP+S KS+ + ++++ +I
Sbjct  586  KRQRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCPISKKSEEYALQVKKQI  645

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            HEAG++VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V +++
Sbjct  646  HEAGYYVDADITDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRIRDSAAHSVKSIE  705

Query  101  ELLAHFKDLMASYK  60
             LL  FK   + Y+
Sbjct  706  NLLEEFKTKTSEYQ  719



>ref|XP_002464119.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
 gb|EER91117.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
Length=739

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  538  KAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPIRFKL  597

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  598  AYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGSVEY  657

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++   +HEAGFH D+D SDRTIQKKVREAQ+AQ+NYILVVG +EA TG + VRVRD  
Sbjct  658  AKQVLATLHEAGFHADIDASDRTIQKKVREAQLAQFNYILVVGAQEAETGNICVRVRDNA  717

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D   M+VD  +   K+ +A+++
Sbjct  718  DLATMSVDGFVTRLKEEIAAFR  739



>ref|XP_008664856.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Zea mays]
Length=737

 Score =   300 bits (767),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  536  KAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPIRFKL  595

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  596  TYSAEDEAKIERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCSVSSGSVEY  655

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++   +HEA FHVD+D SDRTIQKKVREAQVAQ+NYILVVG +EA TG V VRVRD  
Sbjct  656  AKQVLAMLHEADFHVDIDVSDRTIQKKVREAQVAQFNYILVVGAQEAETGNVCVRVRDNA  715

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D   M+VD L+   ++ + ++K
Sbjct  716  DLATMSVDGLITRLREEIVAFK  737



>ref|XP_003573669.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=736

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+AL+EFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  535  KAEQQLTEALDEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  594

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SYSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  595  SYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSSNSLEY  654

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+  +IH AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA TG+V +RVRD  
Sbjct  655  AKEVHAKIHAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAETGKVVLRVRDKA  714

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            +    ++ +++  F D +AS++
Sbjct  715  ELSTESIADVITRFSDEIASFQ  736



>emb|CDM81189.1| unnamed protein product [Triticum aestivum]
Length=706

 Score =   296 bits (758),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  505  KAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  564

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  565  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSANSLTY  624

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G+VS+RVRD  
Sbjct  625  AKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKVSLRVRDRA  684

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D    ++ +++A F D +AS++
Sbjct  685  DLSTESIADVIARFNDEVASFQ  706



>ref|XP_008644625.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Zea mays]
 gb|AFW68051.1| hypothetical protein ZEAMMB73_499676 [Zea mays]
Length=739

 Score =   296 bits (759),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 164/202 (81%), Gaps = 0/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INEGDGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  538  KAEQQLTEALNEFGKPWKINEGDGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPIRFKL  597

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERM AILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  598  AYSAEDEAKIERPVMIHRAILGSVERMLAILLEHYNGKWPLWLSPRQAIVCSVSSGSVEY  657

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++   +HEAGFHVD+D SDRTIQKKVREAQ+AQ+NYILVVG +EA TG + VRVRD  
Sbjct  658  AKQVLATLHEAGFHVDIDASDRTIQKKVREAQLAQFNYILVVGAQEAETGNICVRVRDNA  717

Query  125  DHKVMTVDELLAHFKDLMASYK  60
            D    +VD  +   ++ +A++K
Sbjct  718  DLVTTSVDGFITRLREEIAAFK  739



>ref|XP_006289423.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
 gb|EOA22321.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
Length=713

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP+RF L Y+AEDE
Sbjct  519  EAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPERFKLEYAAEDE  578

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +KR RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +  +++ +
Sbjct  579  AKRGRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQKYAEKVQKQ  638

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V ++
Sbjct  639  IHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLRDSAAHSVKSI  698

Query  104  DELLAHFKDLMASY  63
            ++LL  FK   A +
Sbjct  699  EDLLEEFKSKTAEF  712



>ref|XP_002521030.1| threonyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF41447.1| threonyl-tRNA synthetase, putative [Ricinus communis]
Length=691

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 158/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S    AL++FGKPW+INEGDGAFYGPKIDISV DA+ RKFQCATLQLDFQLP RF L
Sbjct  513  KAESSLKSALDDFGKPWQINEGDGAFYGPKIDISVSDALNRKFQCATLQLDFQLPDRFEL  572

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+KRERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  573  EYSAEDEAKRERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQEY  632

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVS  147
             ++++D+IH+AG+++DVD +DR IQKKVREAQ+AQYNYILVVGE+EA TG+V+
Sbjct  633  AVQVQDQIHKAGYYIDVDLTDRKIQKKVREAQLAQYNYILVVGEEEAKTGQVA  685



>ref|XP_010027611.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X3 [Eucalyptus grandis]
Length=418

 Score =   286 bits (731),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S  T+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP RF L
Sbjct  217  KAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVRFGL  276

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS+++
Sbjct  277  SYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKSRSY  336

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  RD  
Sbjct  337  SLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHARDEA  396

Query  125  DHKVMTVDELLAHFKDLMASY  63
            D  VMT+ +LL  FK+  A++
Sbjct  397  DKIVMTIADLLKVFKEKSAAF  417



>ref|XP_010027610.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Eucalyptus grandis]
Length=432

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S  T+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP RF L
Sbjct  231  KAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVRFGL  290

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS+++
Sbjct  291  SYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKSRSY  350

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  RD  
Sbjct  351  SLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHARDEA  410

Query  125  DHKVMTVDELLAHFKDLMASY  63
            D  VMT+ +LL  FK+  A++
Sbjct  411  DKIVMTIADLLKVFKEKSAAF  431



>gb|AAK82468.1| AT5g26830/F2P16_90 [Arabidopsis thaliana]
 gb|AAO64760.1| At5g26830/F2P16_90 [Arabidopsis thaliana]
Length=676

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RFNL
Sbjct  475  KAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIRFNL  534

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +
Sbjct  535  EYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQQY  594

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVRVRD  
Sbjct  595  AEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRVRDNA  654

Query  125  DHKVMTVDELLAHFKDLMASY  63
             H V ++++LL  FK   A +
Sbjct  655  AHSVKSIEDLLEEFKAKTAEF  675



>ref|XP_002872240.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48499.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   293 bits (750),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RFNL Y+AEDE
Sbjct  519  EAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIRFNLEYAAEDE  578

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +K+ +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +  +++  
Sbjct  579  AKKAKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQKYAEKVQKE  638

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            IH+AGF++D D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V ++
Sbjct  639  IHDAGFYIDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLRDSAAHSVKSI  698

Query  104  DELLAHFKDLMASY  63
            ++LL  FK  +A +
Sbjct  699  EDLLEEFKAKIAEF  712



>gb|KCW54156.1| hypothetical protein EUGRSUZ_I00127 [Eucalyptus grandis]
Length=448

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S  T+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP RF L
Sbjct  247  KAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVRFGL  306

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS+++
Sbjct  307  SYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKSRSY  366

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  RD  
Sbjct  367  SLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHARDEA  426

Query  125  DHKVMTVDELLAHFKDLMASY  63
            D  VMT+ +LL  FK+  A++
Sbjct  427  DKIVMTIADLLKVFKEKSAAF  447



>ref|NP_198035.2| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|O04630.3|SYTM_ARATH RecName: Full=Threonine--tRNA ligase, mitochondrial; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93610.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RFNL
Sbjct  508  KAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIRFNL  567

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +
Sbjct  568  EYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQQY  627

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVRVRD  
Sbjct  628  AEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRVRDNA  687

Query  125  DHKVMTVDELLAHFKDLMASY  63
             H V ++++LL  FK   A +
Sbjct  688  AHSVKSIEDLLEEFKAKTAEF  708



>emb|CAA74705.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RFNL
Sbjct  508  KAEADLKEAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIRFNL  567

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             Y+AEDE+K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +
Sbjct  568  EYAAEDEAKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQQY  627

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              +++ +I +AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVRVRD  
Sbjct  628  AEKVQKQIKDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRVRDNA  687

Query  125  DHKVMTVDELLAHFKDLMASY  63
             H V ++++LL  FK   A +
Sbjct  688  AHSVKSIEDLLEEFKAKTAEF  708



>ref|XP_008237148.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like, partial 
[Prunus mume]
Length=648

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 167/202 (83%), Gaps = 1/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATLQLDFQLP RF L
Sbjct  446  KAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALSRDHQLATLQLDFQLPDRFKL  505

Query  485  SYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQA+VCPVS  +  
Sbjct  506  YYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQAIVCPVSHTALP  565

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + +++RD+IH+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E   G+VSVRVRD 
Sbjct  566  YALQVRDQIHQAGYYVDVDTSDKTIQKKVRQAQIAQYNYILVVGGEEVQNGQVSVRVRDK  625

Query  128  PDHKVMTVDELLAHFKDLMASY  63
             D  VM+++ LL HFKD + ++
Sbjct  626  GDVTVMSMESLLQHFKDQVEAF  647



>ref|XP_010493938.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Camelina 
sativa]
Length=712

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L Y+AEDE
Sbjct  518  EAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYAAEDE  577

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +KR +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +  +++  
Sbjct  578  AKRVKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQKYAEKVQKE  637

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V ++
Sbjct  638  IHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLRDSAAHSVKSI  697

Query  104  DELLAHFKDLMASY  63
            ++LL  FK   A +
Sbjct  698  EDLLEEFKAKTAEF  711



>ref|XP_010027608.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010027609.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Eucalyptus grandis]
Length=505

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ S  T+ALNEFGK W+ +EG+GAFYGPKIDI+V DA  RKFQCATLQLDFQLP RF L
Sbjct  304  KAESALTEALNEFGKRWQKDEGEGAFYGPKIDITVFDAFNRKFQCATLQLDFQLPVRFGL  363

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SY+AE ESK E PVMIHRA+LGSVERMFAILLEH++GKWPFWLSPRQA+V PVS+KS+++
Sbjct  364  SYTAEYESKSETPVMIHRAVLGSVERMFAILLEHYQGKWPFWLSPRQAIVFPVSEKSRSY  423

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
             +++RD+IH+AGF+VD D +DR IQ+KV EA++ QYNYILVVGE+ A TG+V+V  RD  
Sbjct  424  SLKVRDQIHDAGFYVDFDETDRKIQEKVSEARLVQYNYILVVGEEAAGTGQVTVHARDEA  483

Query  125  DHKVMTVDELLAHFKDLMASY  63
            D  VMT+ +LL  FK+  A++
Sbjct  484  DKIVMTIADLLKVFKEKSAAF  504



>ref|XP_007199721.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
 gb|EMJ00920.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
Length=691

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 166/202 (82%), Gaps = 1/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATLQLDFQLP RF L
Sbjct  489  KAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALSRDHQLATLQLDFQLPDRFKL  548

Query  485  SYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQA+VCPVS  +  
Sbjct  549  YYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQAIVCPVSHTALP  608

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + +++RD IH+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E   G+VSVRVRD 
Sbjct  609  YALQVRDCIHQAGYYVDVDTSDKTIQKKVRQAQIAQYNYILVVGGEEVQNGQVSVRVRDK  668

Query  128  PDHKVMTVDELLAHFKDLMASY  63
             D  VM+++ LL HFKD + ++
Sbjct  669  GDVTVMSMESLLQHFKDQVEAF  690



>ref|XP_010455043.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Camelina sativa]
Length=716

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +A+  FGKP  +N+GDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L Y+AEDE
Sbjct  522  EAIEAFGKPLVLNKGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPARFKLEYAAEDE  581

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            ++R +PVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +  +++  
Sbjct  582  AQRGKPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQKYAEKVQKE  641

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            IH+AGF+VD D +DR I KKVREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V ++
Sbjct  642  IHDAGFYVDADLTDRKIDKKVREAQLAQYNYILVVGETEAATGQVSVRLRDSAAHSVKSI  701

Query  104  DELLAHFKDLMASY  63
            ++LL  FK   A +
Sbjct  702  EDLLEEFKAKTAEF  715



>ref|XP_007200687.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
 gb|EMJ01886.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
Length=689

 Score =   287 bits (735),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 167/202 (83%), Gaps = 1/202 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +   +AL EFGKPWE+NEGDGAFYGPKIDI+V DA+ R  Q ATLQLDFQLP RF L
Sbjct  487  KAEAALKEALIEFGKPWEVNEGDGAFYGPKIDITVSDALNRDHQLATLQLDFQLPDRFKL  546

Query  485  SYSAEDE-SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
             YSAE E  K ERPVMIHRA+LGSVERM A+LLEH+KGKWPFWLSPRQA+VCPVS  +  
Sbjct  547  YYSAEGEDGKMERPVMIHRAVLGSVERMLAVLLEHYKGKWPFWLSPRQAIVCPVSHTALP  606

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + +++RD++H+AG++VDVDTSD+TIQKKVR+AQ+AQYNYILVVG +E   G+VSVRVRD 
Sbjct  607  YALQVRDQLHQAGYYVDVDTSDKTIQKKVRQAQMAQYNYILVVGAEEVQNGQVSVRVRDK  666

Query  128  PDHKVMTVDELLAHFKDLMASY  63
             D  VM+++ LL HF+D + ++
Sbjct  667  GDVTVMSMEGLLQHFEDQVEAF  688



>ref|XP_001784310.1| predicted protein [Physcomitrella patens]
 gb|EDQ50872.1| predicted protein [Physcomitrella patens]
Length=685

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            ALN FGKPW+INE DGAFYGPKIDI+V DA+KRKFQCAT+QLDFQLP RFNLSYS EDE+
Sbjct  492  ALNAFGKPWQINEADGAFYGPKIDITVFDALKRKFQCATIQLDFQLPIRFNLSYSTEDEA  551

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KRE+PV+IHRAILGSVERMFAILLEH+ GKWPFWLSPRQ +VCPVS+K   + +E+RD I
Sbjct  552  KREKPVIIHRAILGSVERMFAILLEHYAGKWPFWLSPRQCIVCPVSEKFTHYAVEVRDAI  611

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            + AG+  + D +DR +QKK+REAQ+AQ+NYILVVGE+E +  +V++R RD   H   +V 
Sbjct  612  NAAGYFCEADVTDRKLQKKIREAQLAQFNYILVVGEEETSKKQVNIRTRDNVVHGTKSVT  671

Query  101  ELLAHFKDLMASYK  60
            ELLA F+   A Y+
Sbjct  672  ELLADFQKETAEYR  685



>ref|XP_010497266.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic, partial 
[Camelina sativa]
Length=260

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE-DE  465
            AL++FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLP+RF L Y  +  +
Sbjct  62   ALDDFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPERFKLKYKTKVKQ  121

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
             K  RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VC +S+   ++  E++ +
Sbjct  122  DKPVRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCSLSENYSSYAKEVQKQ  181

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP----DHK  117
            IH+AG++VD+D SDR+I KKV EA+ A YNYILVVG+KEATTG+V+VR+R+ P    D  
Sbjct  182  IHDAGYYVDIDESDRSISKKVAEARAAPYNYILVVGQKEATTGQVTVRLREDPAGRKDLP  241

Query  116  VMTVDELLAHFKDLMASY  63
             M++D LL  FK    +Y
Sbjct  242  EMSIDSLLDEFKYKTVNY  259



>gb|AAB61048.1| Similar to threonyl-tRNA synthetase; coded for by A. thaliana 
cDNA R65376 [Arabidopsis thaliana]
Length=702

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 163/207 (79%), Gaps = 13/207 (6%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +A+  FGKP  +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RFNL Y+AEDE
Sbjct  495  EAIEAFGKPLVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPIRFNLEYAAEDE  554

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +K+ RPVMIHRA+LGSVERMFAILLEH+KGKWPFW+SPRQA+VCP+S+KSQ +  +++ +
Sbjct  555  AKKSRPVMIHRAVLGSVERMFAILLEHYKGKWPFWISPRQAIVCPISEKSQQYAEKVQKQ  614

Query  284  IHEAGFHVDVDTSDRTIQKK-------------VREAQVAQYNYILVVGEKEATTGEVSV  144
            I +AGF+VD D +DR I KK             VREAQ+AQYNYILVVGE EA TG+VSV
Sbjct  615  IKDAGFYVDADLTDRKIDKKVNDFGSCSKFCSVVREAQLAQYNYILVVGETEAATGQVSV  674

Query  143  RVRDIPDHKVMTVDELLAHFKDLMASY  63
            RVRD   H V ++++LL  FK   A +
Sbjct  675  RVRDNAAHSVKSIEDLLEEFKAKTAEF  701



>gb|EMT11254.1| Threonyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1098

 Score =   288 bits (738),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  440  KAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  499

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  500  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSANSLTY  559

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G+VS+RVRD  
Sbjct  560  AKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKVSLRVRDRA  619

Query  125  DHKVMTVDELLA  90
            D    ++ +++A
Sbjct  620  DLSTESIADVIA  631



>emb|CDY19754.1| BnaA09g04070D [Brassica napus]
Length=609

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 157/194 (81%), Gaps = 6/194 (3%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGK W +NEGDGAFYGPKIDI+V DAM RKFQCATLQLDFQLP RF L YSA+DE+
Sbjct  422  ALDAFGKKWVLNEGDGAFYGPKIDITVSDAMNRKFQCATLQLDFQLPDRFKLEYSADDEA  481

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            KR+RPVMIHRA+LGSVERMFAI+LEH+KGKWPFWLSPRQA+VCP+S KS+ + ++++ +I
Sbjct  482  KRQRPVMIHRAVLGSVERMFAIVLEHYKGKWPFWLSPRQAIVCPISKKSEEYALQVKKQI  541

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
            HEAG++      +  +   VREAQ+AQYNYILVVGE EA TG+VSVR+RD   H V +++
Sbjct  542  HEAGYY------ETILGLGVREAQLAQYNYILVVGETEAATGQVSVRIRDSAAHSVKSIE  595

Query  101  ELLAHFKDLMASYK  60
             LL  FK   A Y+
Sbjct  596  NLLEEFKTKTAEYQ  609



>ref|XP_010476961.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase, 
cytoplasmic [Camelina sativa]
Length=453

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 5/198 (3%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE-DE  465
            AL++FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLP+RF L Y  +  +
Sbjct  255  ALDDFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPERFKLKYKTKVKQ  314

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
             K  RPVMIHRA+LGSVERMFAILLEH+KGKWPFWLSPRQA+VC +S+   ++  E++ +
Sbjct  315  DKPVRPVMIHRAVLGSVERMFAILLEHYKGKWPFWLSPRQAIVCSLSENYSSYAKEVQKQ  374

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP----DHK  117
            IH+AG++VD+D SDR+I KKV EA+ A YNYILVVG+KEATTG+V+VR+R+ P    D  
Sbjct  375  IHDAGYYVDIDESDRSISKKVAEARAAPYNYILVVGQKEATTGQVTVRLREDPAGRKDLP  434

Query  116  VMTVDELLAHFKDLMASY  63
             M++D LL  FK    +Y
Sbjct  435  EMSIDSLLDEFKYKTVNY  452



>gb|KDO82535.1| hypothetical protein CISIN_1g0066801mg, partial [Citrus sinensis]
Length=266

 Score =   262 bits (669),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T+ALNEFGKPW+INEGDGAFYGPKIDISV DA+KRKFQCATLQLDFQLP RFNL
Sbjct  90   KAEAALTEALNEFGKPWQINEGDGAFYGPKIDISVSDALKRKFQCATLQLDFQLPDRFNL  149

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS+KSQ +
Sbjct  150  GYSAEDEAKTERPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSEKSQPY  209

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKV  222
             +++RD I+ AG++VDVDT+DR IQKKV
Sbjct  210  ALQVRDHIYRAGYYVDVDTTDRKIQKKV  237



>ref|XP_002989766.1| hypothetical protein SELMODRAFT_447798 [Selaginella moellendorffii]
 gb|EFJ09243.1| hypothetical protein SELMODRAFT_447798 [Selaginella moellendorffii]
Length=564

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+QLDFQ P RF LSYSAE
Sbjct  366  LADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATIQLDFQSPIRFKLSYSAE  425

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+K ERPV+IHRAILGS+ERMFAILLE   GKWPFWLSPRQA+V  +S+K + +  E+R
Sbjct  426  DEAKIERPVIIHRAILGSIERMFAILLEDNAGKWPFWLSPRQAIVLTISEKFKDYAEEVR  485

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK-V  114
             ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E   GEV+VR R     +  
Sbjct  486  AKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQEKGEVNVRTRGSKGQRGC  545

Query  113  MTVDELLAHFKDLMASY  63
            +T+++L+A F+DL+A+Y
Sbjct  546  ITIEKLIAEFQDLVANY  562



>gb|EMS59266.1| Threonyl-tRNA synthetase, mitochondrial [Triticum urartu]
Length=1047

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 147/172 (85%), Gaps = 0/172 (0%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  + T+ALNEFGKPW+INE DGAFYGPKIDI V DA+KRKFQCATLQLDFQLP RF L
Sbjct  461  KAEQQLTEALNEFGKPWKINEADGAFYGPKIDIGVFDALKRKFQCATLQLDFQLPLRFKL  520

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            +YSAEDE+K ERPVMIHRAILGSVERMFAILLEH+ GKWP WLSPRQA+VC VS  S  +
Sbjct  521  TYSAEDEAKLERPVMIHRAILGSVERMFAILLEHYNGKWPLWLSPRQAIVCCVSANSLTY  580

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEV  150
              E+  +I  AGFHVD+D +DRTIQKKVREAQ+AQ+NYILVVG KEA +G++
Sbjct  581  AKEVHAQIRAAGFHVDIDMTDRTIQKKVREAQLAQFNYILVVGAKEAESGKI  632



>ref|XP_002890262.1| hypothetical protein ARALYDRAFT_889225 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66521.1| hypothetical protein ARALYDRAFT_889225 [Arabidopsis lyrata subsp. 
lyrata]
Length=620

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 161/194 (83%), Gaps = 4/194 (2%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +ALN+FGK W  N+GDG FYGPKIDI+V DAMKRKFQCAT+QLDF LP RF L YSAEDE
Sbjct  430  EALNDFGKTWVKNKGDGEFYGPKIDITVYDAMKRKFQCATIQLDFHLPDRFKLEYSAEDE  489

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            ++ E  V+IHRA+LGSVER+FAILLE +KGK PFWLSPRQA+VC VS+ S+++  ++RD+
Sbjct  490  TEIESSVLIHRAVLGSVERLFAILLEQYKGKLPFWLSPRQAIVCSVSEDSRSYANKVRDQ  549

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            IHEAG++VDVDT+DRT+ +KV+EAQVAQYNYIL VG++EA TG+V+V +RD    ++M+ 
Sbjct  550  IHEAGYYVDVDTTDRTVSEKVQEAQVAQYNYILAVGDEEARTGQVTVWLRD----EMMSF  605

Query  104  DELLAHFKDLMASY  63
            + LL  FK   A++
Sbjct  606  ETLLDEFKLKTANF  619



>ref|XP_002892976.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69235.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ FGKPW IN+GDGAFYGPKIDI+V DAMKRKFQCATLQLDFQLP  F L Y  + ++
Sbjct  262  ALDNFGKPWVINKGDGAFYGPKIDITVSDAMKRKFQCATLQLDFQLPACFKLKYITK-KN  320

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            ++ERPVMIHRA+LGS+ERMFAILLEH+KG WPFWLSPRQA+VC +S+   ++  +++ +I
Sbjct  321  EKERPVMIHRAVLGSIERMFAILLEHYKGIWPFWLSPRQAIVCSLSEDYSSYAKQVQKQI  380

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP----DHKV  114
             EAG++VD+D SDR+I KKV +A+ A YNYILVVG+KEATTG+V+VR+R+ P    D   
Sbjct  381  QEAGYYVDIDESDRSICKKVADARAAPYNYILVVGQKEATTGQVTVRLREDPAGRKDLPE  440

Query  113  MTVDELLAHFK  81
            M++D LL  FK
Sbjct  441  MSIDSLLDEFK  451



>ref|XP_006303967.1| hypothetical protein CARUB_v10008857mg [Capsella rubella]
 gb|EOA36865.1| hypothetical protein CARUB_v10008857mg [Capsella rubella]
Length=521

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 158/197 (80%), Gaps = 4/197 (2%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA--ED  468
            AL EFGKP+ +N+GDG F GPKIDI++ DAMK+  QC TLQLDFQLP  F L YS+  ED
Sbjct  324  ALEEFGKPFLLNKGDGEFCGPKIDITIFDAMKKNIQCGTLQLDFQLPDSFKLEYSSSTED  383

Query  467  ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRD  288
            E KRERPVMIHRA+LGSVE M AILLEH++GKWPFWLSPRQA+VC  S K  ++  ++RD
Sbjct  384  EVKRERPVMIHRAVLGSVEHMIAILLEHYEGKWPFWLSPRQAIVCSSSKKHHSYAEKVRD  443

Query  287  RIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR--DIPDHKV  114
            +IHEAG++VDVD SDR I++KVREAQVAQYN++LVVG++EATTG+V+V++R  D     V
Sbjct  444  QIHEAGYYVDVDVSDRDIREKVREAQVAQYNFVLVVGDEEATTGQVTVQLREEDGSYFPV  503

Query  113  MTVDELLAHFKDLMASY  63
            M+++ LL  FK   A+Y
Sbjct  504  MSIETLLDVFKLKSANY  520



>ref|XP_004304268.2| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467923.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467924.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=746

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 160/200 (80%), Gaps = 4/200 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQ--RFNLSYS  477
             T+ALN+FG PW+INEGDGAFYGPKID  VC+A+K+KFQCAT+QLDFQLP   +F+L Y+
Sbjct  546  LTEALNDFGMPWQINEGDGAFYGPKIDFGVCNALKKKFQCATIQLDFQLPDCAQFDLHYT  605

Query  476  AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGME  297
            ++ + K E+PVMIHRA+ GS ER   ILLEH+KGKWPFWLSPRQ +VC V+ + +A+ ++
Sbjct  606  SDKQGKGEKPVMIHRAVFGSFERFIGILLEHYKGKWPFWLSPRQLIVCSVTQEFEAYAVQ  665

Query  296  LRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDH-  120
            +++RI   G+HVDVD SDR++ KK+REAQVAQYNY+LVVG+KEA + +VSVR RD  D  
Sbjct  666  VQERIRRDGYHVDVDISDRSMSKKIREAQVAQYNYVLVVGDKEAKSDQVSVRARDKQDEL  725

Query  119  -KVMTVDELLAHFKDLMASY  63
              VM++D+LL   K+ + ++
Sbjct  726  MGVMSIDDLLRELKNKVEAF  745



>ref|XP_010480524.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=668

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS--AED  468
            AL +FGKP+ IN+GDG  YGPKIDI++ DAMKR FQCATLQLDFQLP+ F L YS  AED
Sbjct  477  ALKDFGKPFLINKGDGEIYGPKIDITLSDAMKRNFQCATLQLDFQLPESFTLEYSSSAED  536

Query  467  ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRD  288
            E+K E+PV+IHRA+LGSVERMF+ILLE  KGKWPFWLSPRQA+VC  S   +++  ++RD
Sbjct  537  ETKSEQPVLIHRAVLGSVERMFSILLEQCKGKWPFWLSPRQAIVCSSSKDDRSYADKVRD  596

Query  287  RIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            +IH+AG++VD DT+DR + +KV+EAQVA+YNYILVVGE++A  G+V+V +RD    +VM+
Sbjct  597  QIHKAGYYVDADTTDRNVSEKVKEAQVARYNYILVVGEEDARRGQVTVWLRD----EVMS  652

Query  107  VDELLAHFKDLMASY  63
            ++ LL  FK   A++
Sbjct  653  IEALLDEFKLKTANF  667



>ref|XP_006303165.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
 gb|EOA36063.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
Length=664

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 158/195 (81%), Gaps = 6/195 (3%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS--AED  468
            AL +FGKP+ +N+GDGAF+GPK+DI+V DAMKR FQCATLQLDFQLP  F L YS  AED
Sbjct  473  ALKDFGKPFFVNKGDGAFHGPKVDITVSDAMKRNFQCATLQLDFQLPDCFKLEYSSLAED  532

Query  467  ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRD  288
            E+KRE+PV+IHRA+LGSVERMFAILLE  KGKWPFWLSPRQ +VC +    +++  ++RD
Sbjct  533  ETKREKPVLIHRAVLGSVERMFAILLEQNKGKWPFWLSPRQVIVCSLLKDDRSYAEKVRD  592

Query  287  RIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            +IH+AG++ DVDT+DR I +KV EAQVA+YNYILVVG++EA  G+V+V +RD    +VM+
Sbjct  593  QIHQAGYYDDVDTTDRNISEKVEEAQVARYNYILVVGDEEARRGQVTVWLRD----EVMS  648

Query  107  VDELLAHFKDLMASY  63
            ++ LL  FK   A++
Sbjct  649  IETLLDEFKLKTANF  663



>emb|CDY21715.1| BnaA09g44660D [Brassica napus]
Length=628

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 150/196 (77%), Gaps = 2/196 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +AL +FGKP+ +N G G FYGPKIDI+V DAMK   QCATLQLDFQLP  F L Y+A  E
Sbjct  432  EALEDFGKPFLVNRGAGEFYGPKIDITVSDAMKSYVQCATLQLDFQLPALFELEYTAMAE  491

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
               + PVMIHRA+LGSVERMF  L+EH+KGKWPFWLSPRQA+VC +S  S  +  ++R++
Sbjct  492  GSSDTPVMIHRAVLGSVERMFTTLVEHYKGKWPFWLSPRQAIVCSLSKDSHEYAEKVREQ  551

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR--DIPDHKVM  111
            IHEAG++VDVD +DR I KKVREAQVAQYNYILVVG +E TTG V+VR R  D+ +  V+
Sbjct  552  IHEAGYYVDVDITDRNISKKVREAQVAQYNYILVVGAEETTTGHVTVRRRNEDLSEFPVL  611

Query  110  TVDELLAHFKDLMASY  63
            +V+ LL  FK   A++
Sbjct  612  SVENLLDEFKLKTANF  627



>ref|XP_009117622.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
Length=628

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 150/196 (77%), Gaps = 2/196 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +AL +FGKP+ +N G G FYGPKIDI+V DAMK   QCATLQLDFQLP  F L Y+A  E
Sbjct  432  EALEDFGKPFLVNRGAGEFYGPKIDITVSDAMKSYVQCATLQLDFQLPALFELEYTAMAE  491

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
               + PVMIHRA+LGSVERMF  L+EH+KGKWPFWLSPRQA+VC +S  S  +  ++R++
Sbjct  492  GSSDTPVMIHRAVLGSVERMFTTLVEHYKGKWPFWLSPRQAIVCSLSKDSHEYAEKVREQ  551

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVR--DIPDHKVM  111
            IHEAG++VDVD +DR I KKVREAQVAQYNYIL+VG +E TTG V+VR R  D+ +  V+
Sbjct  552  IHEAGYYVDVDITDRNISKKVREAQVAQYNYILLVGAEETTTGHVTVRRRNEDLSEFPVL  611

Query  110  TVDELLAHFKDLMASY  63
            +V+ LL  FK   A++
Sbjct  612  SVENLLDEFKLKTANF  627



>dbj|BAN16553.1| ADB6244 [Acytostelium subglobosum]
Length=339

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 143/199 (72%), Gaps = 0/199 (0%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            ++  DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF L Y 
Sbjct  141  NQLRDALNKFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATIQLDFQLPIRFELEYM  200

Query  476  AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGME  297
                 +R RPV+IHRAILGSVERM AIL+EH  GKWPFWLSPRQ +V  VS+K   +G +
Sbjct  201  GSGPEERHRPVIIHRAILGSVERMMAILIEHTGGKWPFWLSPRQVLVATVSEKYIEYGQQ  260

Query  296  LRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            +   + +AGF  +VD SD+T+ KK+REAQ+AQYNYILVVGE+E T   V+VR RD     
Sbjct  261  VAASLTDAGFFCEVDVSDKTLPKKIREAQLAQYNYILVVGEEETTNKTVNVRTRDNAVRG  320

Query  116  VMTVDELLAHFKDLMASYK  60
             ++V  L+   K +   +K
Sbjct  321  SISVQALIDELKQVSKEFK  339



>ref|XP_001696198.1| hypothetical protein CHLREDRAFT_167047 [Chlamydomonas reinhardtii]
 gb|EDP08175.1| predicted protein [Chlamydomonas reinhardtii]
Length=688

 Score =   248 bits (633),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 142/189 (75%), Gaps = 4/189 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             TDALN  GK W +N GDGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF L Y++E
Sbjct  470  LTDALNSTGKAWVLNPGDGAFYGPKIDITVYDALRRKFQCATVQLDFQLPIRFGLEYASE  529

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
                 ERPV++HRA+LGSVERMFAIL EHF GKWPFWL+PRQ MV P+S+ S  +   +R
Sbjct  530  -AGTLERPVIVHRAVLGSVERMFAILTEHFAGKWPFWLNPRQVMVVPISENSVEYAFTVR  588

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDH---  120
              +  AG H DVD++DR +QKKVREAQ+AQYNYILVVGE E T   V+VR RD   H   
Sbjct  589  KELRSAGLHCDVDSTDRKMQKKVREAQLAQYNYILVVGEAEKTAQTVNVRTRDNVVHGMF  648

Query  119  KVMTVDELL  93
            K+  V EL+
Sbjct  649  KLSDVRELM  657



>ref|XP_002989765.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
 gb|EFJ09242.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
Length=647

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 135/170 (79%), Gaps = 0/170 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+QLDFQ P RF LSYSAE
Sbjct  474  LADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATIQLDFQSPIRFKLSYSAE  533

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+K ERPV+IHRAILGS+ERMFAILLE   GKWPFWLSPRQA+V  +S+K + +  E+R
Sbjct  534  DEAKIERPVIIHRAILGSIERMFAILLEDNAGKWPFWLSPRQAIVLTISEKFKDYAEEVR  593

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  141
             ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E   GEV  +
Sbjct  594  AKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQEKGEVRTK  643



>ref|XP_002991732.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
 gb|EFJ07136.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
Length=647

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 135/170 (79%), Gaps = 0/170 (0%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              DALN   KPW++NEGDGAFYGPKIDI V DA+ RKFQCAT+QLDFQ P RF LSYSAE
Sbjct  474  LADALNAHAKPWQMNEGDGAFYGPKIDIQVSDALNRKFQCATIQLDFQSPIRFKLSYSAE  533

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+K ERPV+IHRAILGSVERMFAILLE   GKWPFWLSPRQA+V  +S+K + +  E+R
Sbjct  534  DEAKIERPVIIHRAILGSVERMFAILLEDNVGKWPFWLSPRQAIVLTISEKFKDYAEEVR  593

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVR  141
             ++H AGF VDVD SDR + KKVREAQ+A YNY+LVVG  E   GEV  +
Sbjct  594  AKLHAAGFEVDVDVSDRKVDKKVREAQMAHYNYLLVVGAMEQEKGEVRTK  643



>ref|NP_173238.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|Q8GZ45.2|SYTC_ARATH RecName: Full=Probable threonine--tRNA ligase, cytoplasmic; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS [Arabidopsis 
thaliana]
 gb|AAF97275.1|AC034106_18 Strong similarity to threonyl-tRNA synthetase from Arabidopsis 
thaliana gb|Y14329 and is a member of the tRNA synthetase 
PF|00587 class II [Arabidopsis thaliana]
 gb|AEE29656.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=458

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 151/191 (79%), Gaps = 5/191 (3%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL++FGKPW I EGDGAFYGPKIDI+V DA  RKFQCAT+QLDFQLP  F L Y +E ++
Sbjct  262  ALDDFGKPWVIKEGDGAFYGPKIDITVSDARNRKFQCATIQLDFQLPACFKLKYLSE-KN  320

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            + E PVMIH A+LGS+ERMFAILLEH+KG WPFWLSPRQA+VC +S+   ++  +++ +I
Sbjct  321  EMEAPVMIHSAVLGSIERMFAILLEHYKGIWPFWLSPRQAIVCSLSEDCSSYAKQVQKQI  380

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP----DHKV  114
            +E G++VD+D SDR+++KKV +A+ A YNYILVVG+KE  TG+V+VR+R+ P    D   
Sbjct  381  NEVGYYVDIDESDRSLRKKVADARDAPYNYILVVGQKEVATGQVTVRLREDPEGRKDLPE  440

Query  113  MTVDELLAHFK  81
            M+++ LL  FK
Sbjct  441  MSIESLLDEFK  451



>ref|XP_002946221.1| hypothetical protein VOLCADRAFT_102823 [Volvox carteri f. nagariensis]
 gb|EFJ53216.1| hypothetical protein VOLCADRAFT_102823 [Volvox carteri f. nagariensis]
Length=691

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALN  G+ W +N GDGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF L Y++E
Sbjct  473  LTEALNSTGREWVLNPGDGAFYGPKIDITVYDALRRKFQCATVQLDFQLPIRFGLEYASE  532

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
              +  ERPV++HRA+LGSVERMFAIL EHF GKWPFWL+PRQ MV P+S+ S  +  ++R
Sbjct  533  SGT-LERPVIVHRAVLGSVERMFAILTEHFAGKWPFWLNPRQVMVVPISENSSQYAFDVR  591

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
              +  AG HVDVD SDR +QKKVREAQ+AQYNYILVVGE E     V+VR RD   H + 
Sbjct  592  RELRAAGLHVDVDASDRKMQKKVREAQLAQYNYILVVGEAEKAEQTVNVRTRDNVVHGMF  651

Query  110  TVDEL  96
             ++++
Sbjct  652  KLEDV  656



>ref|XP_005844334.1| hypothetical protein CHLNCDRAFT_49107 [Chlorella variabilis]
 gb|EFN52232.1| hypothetical protein CHLNCDRAFT_49107 [Chlorella variabilis]
Length=570

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 145/192 (76%), Gaps = 5/192 (3%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +ALN  G+ WE+N GDGAFYGPKIDI+V DA++RK+QCAT+QLDFQ P RFNL Y AED 
Sbjct  355  EALNATGREWEMNPGDGAFYGPKIDITVFDALRRKYQCATVQLDFQFPIRFNLEYVAEDG  414

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            S R+RPV++HRAILGS ERMFAIL EH+ GKWP W+SPRQ M+ P+S+    +   +R +
Sbjct  415  S-RQRPVIVHRAILGSAERMFAILTEHWGGKWPLWISPRQVMIVPISEAVYDYASAVRRQ  473

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            +  AGFHVD D +DR +QKKVREAQ++QYNYILVVGE+E   G V+VR RD   H + + 
Sbjct  474  LRSAGFHVDADMADRKMQKKVREAQLSQYNYILVVGEEERVAGTVNVRTRDNQVHGMHS-  532

Query  104  DELLAHFKDLMA  69
               LA   D+M+
Sbjct  533  ---LAGVIDVMS  541



>dbj|GAM29123.1| hypothetical protein SAMD00019534_122990 [Acytostelium subglobosum 
LB1]
Length=708

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 143/199 (72%), Gaps = 0/199 (0%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            ++  DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF L Y 
Sbjct  510  NQLRDALNKFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATIQLDFQLPIRFELEYM  569

Query  476  AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGME  297
                 +R RPV+IHRAILGSVERM AIL+EH  GKWPFWLSPRQ +V  VS+K   +G +
Sbjct  570  GSGPEERHRPVIIHRAILGSVERMMAILIEHTGGKWPFWLSPRQVLVATVSEKYIEYGQQ  629

Query  296  LRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            +   + +AGF  +VD SD+T+ KK+REAQ+AQYNYILVVGE+E T   V+VR RD     
Sbjct  630  VAASLTDAGFFCEVDVSDKTLPKKIREAQLAQYNYILVVGEEETTNKTVNVRTRDNAVRG  689

Query  116  VMTVDELLAHFKDLMASYK  60
             ++V  L+   K +   +K
Sbjct  690  SISVQALIDELKQVSKEFK  708



>ref|XP_009117636.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Brassica rapa]
Length=435

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 150/218 (69%), Gaps = 31/218 (14%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              +AL EFGKP+ +N G+GAF GPKIDI++ DAMKRKFQCA++QLDFQLP  F L YS  
Sbjct  214  LVEALQEFGKPFIVNRGEGAFCGPKIDITLSDAMKRKFQCASIQLDFQLPDHFKLRYSPS  273

Query  470  DESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  345
            DE K+E                  RPVMIHR +LGS ERM AILL H+KGKWPFW+SPRQ
Sbjct  274  DEEKKENVMIHSKVLGTEDKEKGVRPVMIHRTVLGSFERMLAILLNHYKGKWPFWISPRQ  333

Query  344  AMVCPVSDKS--QAHGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEK  171
             +VC  S+    +++  E+R +IHEAG+HVDVDT+DR I +KV EA++AQYNYILVVG++
Sbjct  334  VIVCSSSNNENHRSYAEEVRRQIHEAGYHVDVDTTDRNISEKVGEAEIAQYNYILVVGDE  393

Query  170  EATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  81
            E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  394  EVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  428



>ref|XP_003288175.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
 gb|EGC35308.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
Length=713

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            ALN FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF+L Y ++D +
Sbjct  519  ALNRFGKPWQLNPGDGAFYGPKIDIQIYDCLKRAHQCATIQLDFQLPIRFDLEYQSDDAT  578

Query  461  K-RERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQA+V  V+ +   +G ++  +
Sbjct  579  DVKKRPVIIHRAILGSVERMMAILMEHTAGKWPFWVSPRQAIVVTVAKQHNEYGHKVAKQ  638

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            I E G++ D+D SD+TI KKVREAQ+AQYNYILVVG++E    +V+VR RD      ++V
Sbjct  639  ISELGYYCDIDESDKTIGKKVREAQLAQYNYILVVGQEEIDNNKVNVRTRDNVVRGSISV  698

Query  104  DELLAHFKDLMASYK  60
            +EL+A F  L   +K
Sbjct  699  EELVAEFAVLSKEFK  713



>ref|XP_636821.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
 sp|Q54J66.1|SYTC1_DICDI RecName: Full=Probable threonine--tRNA ligase 1, cytoplasmic; 
AltName: Full=Threonyl-tRNA synthetase; Short=ThrRS [Dictyostelium 
discoideum]
 gb|EAL63315.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
Length=710

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            ALN+FGKPW++N  DGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF+L Y ++D +
Sbjct  516  ALNKFGKPWKLNPKDGAFYGPKIDIHITDCLKRSHQCATIQLDFQLPIRFDLEYQSDDAA  575

Query  461  K-RERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            + ++RPV+IHRAILGSVERM AIL+EH  GKWP W+SPRQA+V  V+     +G ++   
Sbjct  576  ELKKRPVIIHRAILGSVERMMAILIEHTGGKWPLWVSPRQAIVVTVNKTHNEYGQKVCKE  635

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            I +AGF+ D+D SD+TI KKVREAQ+AQYNYILVVG++E     V+VR RD      +TV
Sbjct  636  ISDAGFYCDIDDSDKTISKKVREAQLAQYNYILVVGQEEINGNTVNVRTRDNVVRGSLTV  695

Query  104  DELLAHFKDLMASYK  60
            ++L++ FK L+  +K
Sbjct  696  NDLISEFKQLVKEFK  710



>gb|EFA77297.1| threonyl-tRNA synthetase [Polysphondylium pallidum PN500]
Length=716

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 138/188 (73%), Gaps = 0/188 (0%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            DALN+FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF L Y     
Sbjct  522  DALNKFGKPWKLNPGDGAFYGPKIDIQIFDVLKRAHQCATIQLDFQLPIRFELEYMGSGP  581

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
             +R RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQ +V  VS+K   +   +   
Sbjct  582  EERHRPVIIHRAILGSVERMMAILIEHTAGKWPFWVSPRQVLVATVSEKFADYAKSVTKT  641

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            + +AGF+ DVD SD+T+ KKVREAQ++QYNYILVVGE+E     V+VR RD      +TV
Sbjct  642  LTDAGFYADVDLSDKTLPKKVREAQLSQYNYILVVGEEELNNNTVNVRTRDNVVRGSITV  701

Query  104  DELLAHFK  81
            D L+  FK
Sbjct  702  DALIEEFK  709



>ref|XP_002677200.1| threonyl-tRNA synthetase [Naegleria gruberi]
 gb|EFC44456.1| threonyl-tRNA synthetase [Naegleria gruberi]
Length=672

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 148/195 (76%), Gaps = 2/195 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            ALNEFG  W+ NEGDGAFYGPKIDI + DA+KR+ QCAT+QLDFQLP RF+L+Y+AED++
Sbjct  479  ALNEFGHSWQKNEGDGAFYGPKIDILISDALKREHQCATVQLDFQLPIRFDLTYAAEDKT  538

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            +  RPV++HRAI GS+ER  AI  EHF GKWPFWLSPRQA+V PVS+K   +  +++ R+
Sbjct  539  E-SRPVIVHRAIFGSLERFLAIATEHFGGKWPFWLSPRQAIVVPVSNKCNEYAEKVQKRL  597

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI-PDHKVMTV  105
            HEA ++VDVD S   I KK+R AQ++QYNYILVVG KE  +  V++R+RD   +  V T+
Sbjct  598  HEAKYYVDVDLSSNRIDKKIRNAQLSQYNYILVVGPKEMESDSVNIRIRDSDKEQGVKTI  657

Query  104  DELLAHFKDLMASYK  60
            +ELL  F+     +K
Sbjct  658  EELLIEFEGNKVQFK  672



>ref|XP_011397153.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24266.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
Length=727

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +AL+  G  WE+NEGDGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF L Y AED 
Sbjct  520  NALDASGHAWELNEGDGAFYGPKIDITVHDALRRKFQCATVQLDFQLPLRFGLQYVAED-  578

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
               + PV+IHRA+LGSVERMFAIL E+F G+WP WLSPRQ MV P+SD S  + +E+RD 
Sbjct  579  GGFQVPVIIHRAVLGSVERMFAILTENFAGRWPLWLSPRQVMVVPISDSSYDYALEVRDA  638

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            +  AGFHV+VD +DR +QKKVREAQVAQ+NYILVVG  E     V+VR RD   H    +
Sbjct  639  VRGAGFHVEVDLADRKMQKKVREAQVAQFNYILVVGAAEREQRTVNVRTRDNQVHGQRQL  698

Query  104  DELL  93
            D++L
Sbjct  699  DDVL  702



>ref|XP_004351232.1| threonyl-tRNA synthetase [Dictyostelium fasciculatum]
 gb|EGG14724.1| threonyl-tRNA synthetase [Dictyostelium fasciculatum]
Length=706

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL  FGKPW++N GDGAFYGPKIDI + D +KR  QCAT+QLDFQLP RF L Y  +   
Sbjct  513  ALTNFGKPWKLNPGDGAFYGPKIDIHITDVLKRSHQCATIQLDFQLPIRFELEYMTDKAE  572

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
              +RPV+IHRAILGSVERM AIL+EH  GKWPFW+SPRQA++ PVS +   +  +L+ +I
Sbjct  573  DLQRPVIIHRAILGSVERMMAILIEHTGGKWPFWVSPRQAIIVPVSQQFNEYADQLQKKI  632

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
             +AGF+ DVD SD+T+ KKVREAQ+AQYNYILVVG+KE     V VR RD      +++D
Sbjct  633  VDAGFYCDVDGSDKTLPKKVREAQLAQYNYILVVGQKEKDENTVGVRTRDNVVRDAISLD  692

Query  101  ELLAHF  84
             LLA F
Sbjct  693  ALLAEF  698



>ref|XP_004182642.1| hypothetical protein TBLA_0J01260 [Tetrapisispora blattae CBS 
6284]
 emb|CCH63123.1| hypothetical protein TBLA_0J01260 [Tetrapisispora blattae CBS 
6284]
Length=741

 Score =   240 bits (612),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 143/202 (71%), Gaps = 7/202 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            ++   AL  +G  WEINEGDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  530  TKLASALKSWGGKWEINEGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  589

Query  476  AED---ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            A+D   E   ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q++
Sbjct  590  AQDNKSEEAYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQILVVPVGVKYQSY  649

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+RD+ H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RDI 
Sbjct  650  AQEIRDKFHNAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNENSVNIRNRDIM  709

Query  125  DHK----VMTVDELLAHFKDLM  72
            + +     + VD +L   K+L+
Sbjct  710  EQQGKNATVNVDVVLKQMKNLL  731



>ref|XP_007514880.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO15120.1| threonyl-tRNA synthetase [Bathycoccus prasinos]
Length=715

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL   GK WE+N GDGAFYGPKIDI+V DA++R+FQCAT+QLDFQLP RF+L+Y  E  +
Sbjct  497  ALKASGKEWELNPGDGAFYGPKIDIAVFDALRRRFQCATVQLDFQLPIRFDLAYQNE-HN  555

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            + ERP++IHRA+LGSVERMFAIL EH+ GKWP+WLSPRQ M+ P+S+ S  +  ++R RI
Sbjct  556  EDERPIIIHRAVLGSVERMFAILTEHYAGKWPYWLSPRQVMIVPISELSLEYAKDVRRRI  615

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
             +AG HV+VD SDR +QKKVREAQ+ Q+NYILVVGE+E T   V+VR RD   H    ++
Sbjct  616  RKAGHHVEVDASDRKMQKKVREAQLEQFNYILVVGEQEKTNDTVNVRTRDNQVHGERKLE  675

Query  101  ELL  93
            +L+
Sbjct  676  DLI  678



>ref|XP_007044585.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
 gb|EOY00417.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
Length=616

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 141/196 (72%), Gaps = 31/196 (16%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALNE GKPW                               QLDFQLP RF L YSAE
Sbjct  451  LTEALNESGKPW-------------------------------QLDFQLPDRFKLEYSAE  479

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KSQ +  E++
Sbjct  480  DEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKSQDYAREVQ  539

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            ++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVRD  D   M
Sbjct  540  EQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVRDKGDLTSM  599

Query  110  TVDELLAHFKDLMASY  63
            +++ LL H KD +A++
Sbjct  600  SIEGLLQHLKDEIAAF  615



>ref|XP_005648591.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE24047.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=765

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+  G+PWE+N  DGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF L Y+ +  +
Sbjct  550  ALDSTGQPWELNPADGAFYGPKIDITVFDALRRKFQCATVQLDFQLPIRFGLQYATDKLN  609

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            + ERPV++HRAILGSVERMFAIL EH+ GKWPFWLSPRQ MV P+S+ S  +  E+R  +
Sbjct  610  EFERPVIVHRAILGSVERMFAILTEHYAGKWPFWLSPRQVMVVPISEASAEYAQEVRRTL  669

Query  281  HEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVD  102
              A F VDVD +D  +QKKVREAQ+AQYNYILVVGEKE     V+VR RD   H    + 
Sbjct  670  RNARFFVDVDLADNKMQKKVREAQLAQYNYILVVGEKEREQKTVNVRTRDNVVHGEHALS  729

Query  101  ELL  93
            E++
Sbjct  730  EVV  732



>ref|XP_007044583.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
 gb|EOY00415.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
Length=645

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 141/196 (72%), Gaps = 31/196 (16%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T+ALNE GKPW                               QLDFQLP RF L YSAE
Sbjct  480  LTEALNESGKPW-------------------------------QLDFQLPDRFKLEYSAE  508

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            DE+KRE+PVMIHRAILGSVERMFAILLEH+KGKWPFWLSPRQA+VCPVS KSQ +  E++
Sbjct  509  DEAKREKPVMIHRAILGSVERMFAILLEHYKGKWPFWLSPRQAIVCPVSAKSQDYAREVQ  568

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
            ++IH AG++VDVD +DR IQKKVREAQ+AQYNYILVVGE+E  T +VSVRVRD  D   M
Sbjct  569  EQIHGAGYYVDVDLTDRKIQKKVREAQLAQYNYILVVGEEEMNTKQVSVRVRDKGDLTSM  628

Query  110  TVDELLAHFKDLMASY  63
            +++ LL H KD +A++
Sbjct  629  SIEGLLQHLKDEIAAF  644



>ref|XP_006071988.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Bubalus bubalis]
Length=367

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 140/194 (72%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ + D 
Sbjct  165  NSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDG  224

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              +++PV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  225  DDKKKPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  284

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H   T
Sbjct  285  FHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERT  344

Query  107  VDELLAHFKDLMAS  66
            + E +   + L  S
Sbjct  345  ISETIERLQQLKHS  358



>ref|XP_004085211.2| PREDICTED: threonine--tRNA ligase, cytoplasmic-like, partial 
[Oryzias latipes]
Length=234

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y +
Sbjct  29   QLENSLNEFGEKWVLNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLAYVS  88

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             +   ++RPV+IHRAILGSVERM AIL E++ GKWP WLSPRQ M+ PV    + +  ++
Sbjct  89   HEGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPLWLSPRQVMLVPVGPTCEEYAEKV  148

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            +   H +GF  DVD     T+ KK+R AQ++QYN+ILVVGEKE T+  V+VR RD   H 
Sbjct  149  KQEFHSSGFMADVDLDPSCTLNKKIRNAQLSQYNFILVVGEKEKTSNTVNVRTRDNKVHG  208

Query  116  VMTVDELLAHFKDLMAS  66
              +V+E +   K L AS
Sbjct  209  ECSVEECIQRLKRLKAS  225



>emb|CDQ73765.1| unnamed protein product [Oncorhynchus mykiss]
Length=215

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
             +  ++LNEFG+PW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ 
Sbjct  9    GQLENSLNEFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTFV  68

Query  476  AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGME  297
             +D   + +PV+IHRAILGSVERM AIL E++ GKWP WLSPRQ M  PV+   + +   
Sbjct  69   GKDGDDKGKPVIIHRAILGSVERMIAILTENYAGKWPLWLSPRQVMFVPVNPTCEEYAKR  128

Query  296  LRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDH  120
            +  +  EAGF  D D  S   + KK+R AQ+AQYN+ILVVGEKE  T  V+VR RD   H
Sbjct  129  MCKQFVEAGFMADADLDSSCLLNKKIRNAQLAQYNFILVVGEKEKLTNSVNVRTRDNKVH  188

Query  119  KVMTVDELLAHFKDLMAS  66
              ++V E+LA    L  S
Sbjct  189  GELSVSEVLARLTLLKES  206



>ref|XP_009117635.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Brassica rapa]
Length=436

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 150/219 (68%), Gaps = 32/219 (15%)
 Frame = -1

Query  650  FTDALNEFGKPW-EINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
              +AL EFGKP+  +N G+GAF GPKIDI++ DAMKRKFQCA++QLDFQLP  F L YS 
Sbjct  214  LVEALQEFGKPFIVVNRGEGAFCGPKIDITLSDAMKRKFQCASIQLDFQLPDHFKLRYSP  273

Query  473  EDESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  348
             DE K+E                  RPVMIHR +LGS ERM AILL H+KGKWPFW+SPR
Sbjct  274  SDEEKKENVMIHSKVLGTEDKEKGVRPVMIHRTVLGSFERMLAILLNHYKGKWPFWISPR  333

Query  347  QAMVCPVSDKS--QAHGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGE  174
            Q +VC  S+    +++  E+R +IHEAG+HVDVDT+DR I +KV EA++AQYNYILVVG+
Sbjct  334  QVIVCSSSNNENHRSYAEEVRRQIHEAGYHVDVDTTDRNISEKVGEAEIAQYNYILVVGD  393

Query  173  KEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  81
            +E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  394  EEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  429



>emb|CDJ83831.1| Aminoacyl-tRNA synthetase and Anticodon-binding domain containing 
protein, partial [Haemonchus contortus]
Length=390

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            ALNE G+PW++NEGDGAFYGPKIDIS+ DA++R  QCAT+QLDFQLPQRF+LSY  E + 
Sbjct  178  ALNESGRPWKLNEGDGAFYGPKIDISIQDALRRNHQCATIQLDFQLPQRFDLSYFDE-KG  236

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            +++RPVMIHRA+LGSVERM AIL E++ GKWPFWLSPRQA V  V +    +  ++++++
Sbjct  237  EKQRPVMIHRAVLGSVERMAAILTENYGGKWPFWLSPRQAKVITVHESVNPYARQVKEKL  296

Query  281  HEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            + AGF V+ D     T+ K++R AQ+AQ+N+ILVVG+KE   G V+VR RD      +++
Sbjct  297  YNAGFEVEFDEGCSDTLNKQIRNAQLAQFNFILVVGQKEVEHGTVNVRTRDNAVRGEVSI  356

Query  104  DELLAHFKDLMASY  63
            D+LLA F+     Y
Sbjct  357  DDLLAKFRRFADEY  370



>ref|XP_001623293.1| predicted protein [Nematostella vectensis]
 gb|EDO31193.1| predicted protein [Nematostella vectensis]
Length=559

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 139/192 (72%), Gaps = 1/192 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            ALN FG+ W +N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP+RFNL+Y   +  
Sbjct  358  ALNGFGQAWVLNPGDGAFYGPKIDIQIQDALRRYHQCATIQLDFQLPERFNLTYVTGEGD  417

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            +R+RPV++HRAILGSVERM AIL E F GKWPFWLSPRQA+V P+  K   +  ++   I
Sbjct  418  ERKRPVIVHRAILGSVERMIAILTESFGGKWPFWLSPRQAIVIPIGPKYDEYAQKVMSDI  477

Query  281  HEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
              AG+HVD D     T+ KKVR AQ+AQYN+I VVGEKEATTG V+VR RD   H   +V
Sbjct  478  LAAGYHVDADLDHGTTLNKKVRNAQLAQYNFIFVVGEKEATTGTVNVRTRDNKVHGEFSV  537

Query  104  DELLAHFKDLMA  69
            + +L  F  L +
Sbjct  538  EAVLNKFATLTS  549



>ref|XP_003080220.1| putative threonyl-tRNA synthetase (ISS) [Ostreococcus tauri]
Length=673

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 145/193 (75%), Gaps = 2/193 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T ALN  G+ W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RF+L
Sbjct  463  KAEAALTAALNRSGRDWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRFDL  522

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA-  309
            SY  E+ ++  RP++IHRAILGSVERMF IL EHF GKWPFWLSP+Q M+ P+SD +   
Sbjct  523  SYVDEN-NEPTRPIIIHRAILGSVERMFGILTEHFAGKWPFWLSPKQVMIVPISDSASGE  581

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + ME++  + + GFHV+VD SDR +QKKVREAQ+ Q+NYILV GE E     V+VR RD 
Sbjct  582  YCMEVKRMLRKEGFHVEVDNSDRKMQKKVREAQLEQFNYILVCGESEKVNRTVNVRTRDN  641

Query  128  PDHKVMTVDELLA  90
              H    V++L+ 
Sbjct  642  KVHGEHKVEDLIT  654



>ref|XP_003058283.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58234.1| predicted protein [Micromonas pusilla CCMP1545]
Length=725

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            +ALN+ GK W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RFNLSY  E+ 
Sbjct  496  NALNKSGKEWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRFNLSYVTEN-  554

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            ++  RP++IHRAILGSVERMFAIL EHF GK+P+WLSP+Q M+ P+S+ S+ + +E++ +
Sbjct  555  NEPARPIIIHRAILGSVERMFAILTEHFAGKYPYWLSPKQVMLVPISEASREYALEVKKQ  614

Query  284  IHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            + +AG H  VD +DR +QKKVREAQ+  +NYILVVGE E T   V+VR RD   H  + +
Sbjct  615  LRKAGHHAQVDETDRKMQKKVREAQLEHWNYILVVGEGEKTNRTVNVRTRDNVVHGEVKL  674

Query  104  DELLA  90
            +EL+ 
Sbjct  675  EELMT  679



>ref|XP_011499017.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, cytoplasmic 
[Ceratosolen solmsi marchali]
Length=700

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             +++L+ FG+PW +N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY  E
Sbjct  497  LSESLDTFGQPWTLNPGDGAFYGPKIDITIMDALKRPHQCATIQLDFQLPIRFNLSYVNE  556

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               ++ RPV+IHRAILGSVERM AILLE + GKWPFWLSPRQA+V PV      + +E+R
Sbjct  557  -AGEKTRPVIIHRAILGSVERMIAILLESYAGKWPFWLSPRQAIVIPVGPSVDDYALEVR  615

Query  290  DRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            DRI + GF  +V+     T+ KK+R AQ+ Q+NYILVVGEKE ++  V+VR RD   H  
Sbjct  616  DRIFKCGFMTEVNVDHSVTLNKKIRNAQLDQFNYILVVGEKEKSSSTVNVRTRDNKVHGQ  675

Query  113  MTVDELLAHFKDLMAS  66
            + +DEL+  F++L+ +
Sbjct  676  IEIDELMKKFENLIET  691



>emb|CEF98631.1| Anticodon-binding [Ostreococcus tauri]
Length=693

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 145/193 (75%), Gaps = 2/193 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +  T ALN  G+ W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RF+L
Sbjct  483  KAEAALTAALNRSGRDWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRFDL  542

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA-  309
            SY  E+ ++  RP++IHRAILGSVERMF IL EHF GKWPFWLSP+Q M+ P+SD +   
Sbjct  543  SYVDEN-NEPTRPIIIHRAILGSVERMFGILTEHFAGKWPFWLSPKQVMIVPISDSASGE  601

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            + ME++  + + GFHV+VD SDR +QKKVREAQ+ Q+NYILV GE E     V+VR RD 
Sbjct  602  YCMEVKRMLRKEGFHVEVDNSDRKMQKKVREAQLEQFNYILVCGESEKVNRTVNVRTRDN  661

Query  128  PDHKVMTVDELLA  90
              H    V++L+ 
Sbjct  662  KVHGEHKVEDLIT  674



>ref|XP_002499537.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60795.1| predicted protein [Micromonas sp. RCC299]
Length=722

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = -1

Query  635  NEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDESKR  456
            N  GK W++N GDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RFNLSY +E  ++ 
Sbjct  495  NGTGKEWKLNPGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRFNLSYVSE-ANEP  553

Query  455  ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRIHE  276
            ERP++IHRAILGSVERMFAIL EHF GKWPFWLSPRQ M+ P+S++S+ +  E+R  + +
Sbjct  554  ERPIIIHRAILGSVERMFAILTEHFAGKWPFWLSPRQVMIVPISEQSRDYAHEVRSVLRK  613

Query  275  AGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRD  132
             GF+ +VD SDR +QKKVREAQ+ Q+NYILVVGE E T   V++R RD
Sbjct  614  EGFYCEVDDSDRKMQKKVREAQLEQWNYILVVGEGEKTNRTVNIRTRD  661



>ref|XP_004933460.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Bombyx mori]
Length=713

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 146/196 (74%), Gaps = 2/196 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            D+LN+FGKPW++N GDGAFYGPKIDI++ DA++R  QCAT+QLDFQLP+RFNL+Y +E  
Sbjct  510  DSLNKFGKPWQLNPGDGAFYGPKIDITIQDALRRSHQCATIQLDFQLPERFNLTYVSETG  569

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
             K+ RPV+IHRA+LGSVERM AIL E + GKWP WLSPRQ  V PV      + +++ D+
Sbjct  570  DKK-RPVIIHRAVLGSVERMVAILSESYAGKWPLWLSPRQLRVVPVGPAFDDYAVQVNDK  628

Query  284  IHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            +  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E  +G V+VR RD   H  M+
Sbjct  629  LFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREKNSGTVNVRTRDNKVHGEMS  688

Query  107  VDELLAHFKDLMASYK  60
            V+ L+ H  +L+   K
Sbjct  689  VEALIEHLNNLVREKK  704



>ref|XP_005774035.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD21606.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
Length=688

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 151/222 (68%), Gaps = 25/222 (11%)
 Frame = -1

Query  650  FTDALNEF----GKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLS  483
              +AL+E+    G+ W +N GDGAFYGPKIDI V DA+KR FQCAT+QLDF  PQRF+L 
Sbjct  467  IAEALDEYQAKSGRGWSLNPGDGAFYGPKIDIHVYDALKRPFQCATVQLDFVQPQRFDLK  526

Query  482  Y--------------SAEDESKR-------ERPVMIHRAILGSVERMFAILLEHFKGKWP  366
            Y                E+ES         ERPVMIHRA+LGSVERM AIL EHF GKWP
Sbjct  527  YMTSGAAAAAAEAPKDGEEESAAGALPPGYERPVMIHRAVLGSVERMIAILTEHFAGKWP  586

Query  365  FWLSPRQAMVCPVSDKSQAHGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYIL  186
            F+LSPRQA+V PVS     +  E+R+++H AGF+ DVD S+RT+ K VREAQ++QYN+IL
Sbjct  587  FFLSPRQAVVVPVSAAFNEYAEEVRNQLHAAGFYCDVDASNRTLNKMVREAQLSQYNFIL  646

Query  185  VVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  60
            VVG++EA    V+VR RD   H   TV+ LLA FK L+A +K
Sbjct  647  VVGKEEAAEAAVNVRTRDNEVHGKKTVEALLADFKQLLADHK  688



>ref|XP_004933459.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Bombyx mori]
Length=720

 Score =   235 bits (599),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 145/192 (76%), Gaps = 2/192 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            D+LN+FGKPW++N GDGAFYGPKIDI++ DA++R  QCAT+QLDFQLP+RFNL+Y +E  
Sbjct  517  DSLNKFGKPWQLNPGDGAFYGPKIDITIQDALRRSHQCATIQLDFQLPERFNLTYVSETG  576

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
             K+ RPV+IHRA+LGSVERM AIL E + GKWP WLSPRQ  V PV      + +++ D+
Sbjct  577  DKK-RPVIIHRAVLGSVERMVAILSESYAGKWPLWLSPRQLRVVPVGPAFDDYAVQVNDK  635

Query  284  IHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            +  AGF  +VDT +  T+ KKVR AQ+AQ+NYILVVGE+E  +G V+VR RD   H  M+
Sbjct  636  LFAAGFMSEVDTDAGDTLNKKVRNAQLAQFNYILVVGEREKNSGTVNVRTRDNKVHGEMS  695

Query  107  VDELLAHFKDLM  72
            V+ L+ H  +L+
Sbjct  696  VEALIEHLNNLV  707



>ref|XP_005758375.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD05946.1| threonine-tRNA ligase, partial [Emiliania huxleyi CCMP1516]
Length=703

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 151/222 (68%), Gaps = 25/222 (11%)
 Frame = -1

Query  650  FTDALNEF----GKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLS  483
              +AL+E+    G+ W +N GDGAFYGPKIDI V DA+KR FQCAT+QLDF  PQRF+L 
Sbjct  482  IAEALDEYQAKSGRGWSLNPGDGAFYGPKIDIHVYDALKRPFQCATVQLDFVQPQRFDLK  541

Query  482  Y--------------SAEDESKR-------ERPVMIHRAILGSVERMFAILLEHFKGKWP  366
            Y                E+ES         ERPVMIHRA+LGSVERM AIL EHF GKWP
Sbjct  542  YMTSGAAAAAAEAPKDGEEESAAGALPPGYERPVMIHRAVLGSVERMIAILTEHFAGKWP  601

Query  365  FWLSPRQAMVCPVSDKSQAHGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYIL  186
            F+LSPRQA+V PVS     +  E+R+++H AGF+ DVD S+RT+ K VREAQ++QYN+IL
Sbjct  602  FFLSPRQAVVVPVSAAFNEYAEEVRNQLHAAGFYCDVDASNRTLNKMVREAQLSQYNFIL  661

Query  185  VVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMASYK  60
            VVG++EA    V+VR RD   H   TV+ LLA FK L+A +K
Sbjct  662  VVGKEEAAEAAVNVRTRDNEVHGKKTVEALLADFKQLLADHK  703



>emb|CDY21726.1| BnaA09g44770D [Brassica napus]
Length=436

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 150/219 (68%), Gaps = 32/219 (15%)
 Frame = -1

Query  650  FTDALNEFGKPWEI-NEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
              +AL EFGKP+ + N G+GA  GPKIDI++ DAMKRKFQCA++QLDFQLP  F L YS 
Sbjct  214  LVEALQEFGKPFTVVNRGEGALCGPKIDITLSDAMKRKFQCASIQLDFQLPDHFKLRYSP  273

Query  473  EDESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPR  348
             DE K+E                  RPVMIHR +LGS ERM AILL+H+KGKWPFW+SPR
Sbjct  274  SDEEKKENVMIHSKVLGSEDKEKGVRPVMIHRTVLGSFERMLAILLDHYKGKWPFWISPR  333

Query  347  QAMVCPVSDKS--QAHGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGE  174
            Q +VC  S+    +++  E+R +IHEAG+HV+VDT+DR I +KV EA++AQYNYILVVG+
Sbjct  334  QVIVCSSSNNENHRSYAEEVRRQIHEAGYHVEVDTTDRNISEKVGEAEIAQYNYILVVGD  393

Query  173  KEATTGEVSVRVRD--------IPDHKVMTVDELLAHFK  81
            +E  T +V+  +RD        +P   +M+VD LL  FK
Sbjct  394  EEVATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  429



>ref|XP_002595927.1| hypothetical protein BRAFLDRAFT_268618 [Branchiostoma floridae]
 gb|EEN51939.1| hypothetical protein BRAFLDRAFT_268618 [Branchiostoma floridae]
Length=681

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 143/194 (74%), Gaps = 3/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
               AL++FG PW++N GDGAFYGPKIDI V DA++R  QCAT+QLDF  P+RFNL+Y + 
Sbjct  474  LASALDKFGMPWKLNPGDGAFYGPKIDIQVFDALRRAHQCATIQLDFNNPERFNLTYVSG  533

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  +++RPVMIHRAILGSVER  AIL E+F GKWPFWLSPRQAM+ PVS     +  ++R
Sbjct  534  DGDEKKRPVMIHRAILGSVERFIAILCENFGGKWPFWLSPRQAMIVPVSPDQNEYAQKVR  593

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            + IHEAGF    D D  D T+ KK+R AQ+AQYN+I+VVG+KE  +G V+VR RD   H 
Sbjct  594  NSIHEAGFMCEADCDPGD-TMNKKIRNAQLAQYNFIMVVGKKEVESGTVNVRTRDNKVHG  652

Query  116  VMTVDELLAHFKDL  75
              +V++++  FK L
Sbjct  653  ERSVEDVILRFKKL  666



>pdb|4HWT|A Chain A, Crystal Structure Of Human Threonyl-trna Synthetase 
Bound To A Novel Inhibitor
 pdb|4HWT|B Chain B, Crystal Structure Of Human Threonyl-trna Synthetase 
Bound To A Novel Inhibitor
Length=413

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  203  NSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  262

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  263  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  322

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  323  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  382

Query  107  VDELLAHFKDL  75
            + E +   + L
Sbjct  383  ISETIERLQQL  393



>pdb|4P3N|A Chain A, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|B Chain B, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|C Chain C, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
 pdb|4P3N|D Chain D, Structural Basis For Full-spectrum Inhibition Of Threonyl-trna 
Synthetase By Borrelidin 1
Length=415

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  213  NSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  272

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  273  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  332

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  333  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  392

Query  107  VDELLAHFKDL  75
            + E +   + L
Sbjct  393  ISETIERLQQL  403



>gb|EDL82978.1| threonyl-tRNA synthetase, isoform CRA_b [Rattus norvegicus]
Length=433

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  231  NSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  290

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R  
Sbjct  291  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQE  350

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  351  FHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERT  410

Query  107  VDELLAHFKDL  75
            V E +   + L
Sbjct  411  VGETVERLQQL  421



>emb|CDX81854.1| BnaC08g37470D [Brassica napus]
Length=433

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 143/216 (66%), Gaps = 29/216 (13%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              +AL EFGKP+ +N G GA  GPKIDI++ DAMKRKFQCA++QLDFQLP  F L YS  
Sbjct  214  LVEALQEFGKPFTVNRGVGALCGPKIDITLSDAMKRKFQCASIQLDFQLPDHFKLRYSPS  273

Query  470  DESKRE------------------RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQ  345
            DE K+E                  RP MIHR +LGS ERM AILL+H+KGKWPFW+SPRQ
Sbjct  274  DEEKKENVMIHSKVLGSEDKDKGVRPFMIHRTVLGSFERMLAILLDHYKGKWPFWISPRQ  333

Query  344  AMVCPVSDKSQAHGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEA  165
             +VC  S+        +R +IHEAG+HVDVDT+DR I +KV EA++ QYNYILVVG++E 
Sbjct  334  VIVCSSSNNENDLTWRVRRQIHEAGYHVDVDTTDRNISEKVGEAEIVQYNYILVVGDEEV  393

Query  164  TTGEVSVRVRD--------IPDHKVMTVDELLAHFK  81
             T +V+  +RD        +P   +M+VD LL  FK
Sbjct  394  ATRQVTALLRDSSCSDRSKVP---MMSVDALLDVFK  426



>ref|NP_723726.1| Threonyl-tRNA synthetase, isoform C [Drosophila melanogaster]
 ref|NP_524839.3| Threonyl-tRNA synthetase, isoform B [Drosophila melanogaster]
 gb|AAF53167.1| Threonyl-tRNA synthetase, isoform B [Drosophila melanogaster]
 gb|AAN10805.1| Threonyl-tRNA synthetase, isoform C [Drosophila melanogaster]
Length=690

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  488  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  547

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  548  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVR  606

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  607  DQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  665

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  666  EVSVAELITKLQKI  679



>gb|KGK38420.1| hypothetical protein JL09_g2427 [Pichia kudriavzevii]
Length=725

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            ++  +ALN++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  517  AKLEEALNKWGGDWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  576

Query  476  AEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGME  297
             ++E+   RPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K   +  E
Sbjct  577  GKEETNAVRPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYFEYAEE  636

Query  296  LRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD--  123
            ++ ++H AGF  DVD +  T+QKKVR  QV +YN+I +VGE+E+T   V++R RDI D  
Sbjct  637  VQQKLHNAGFFADVDVTGNTLQKKVRNGQVQKYNFIFIVGEQESTEKSVNIRNRDIQDLQ  696

Query  122  --HKVMTVDELLAHFKDLMAS  66
              ++ +++D ++A    L  S
Sbjct  697  GKNEAVSLDTVIAQLLKLKES  717



>ref|XP_004531261.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Ceratitis capitata]
 ref|XP_004531262.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X3 
[Ceratitis capitata]
Length=689

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L+EFG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y A+
Sbjct  487  LAESLDEFGQPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPVRFNLNYIAD  546

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +   +   +R
Sbjct  547  DGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQFDEYAQTVR  605

Query  290  DRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D +H AGF  +VDT    T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H  
Sbjct  606  DELHAAGFMAEVDTDHGDTLNKKIRNAQLAQFNFILVVGEKERSSNTVNVRTRDNKVHGE  665

Query  113  MTVDEL  96
            ++VD+L
Sbjct  666  VSVDDL  671



>gb|EPY73150.1| threonine--tRNA ligase, cytoplasmic [Camelus ferus]
Length=628

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 141/198 (71%), Gaps = 1/198 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  423  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  482

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  483  HDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  542

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
              + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  543  WQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  602

Query  116  VMTVDELLAHFKDLMASY  63
              TV E +   + L  SY
Sbjct  603  ERTVSETIERLQQLKQSY  620



>ref|XP_005650255.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE25711.1| threonyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=1049

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 139/186 (75%), Gaps = 1/186 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             T AL+  GK WE+NE DGAFYGPKIDI+V DA++RKFQCAT+QLDFQLP RF+L Y   
Sbjct  512  LTQALDATGKAWELNEADGAFYGPKIDITVFDALRRKFQCATIQLDFQLPVRFDLQYKGA  571

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
             E+  ERPV++HRAILGSVERM AIL E+F GKWP WLSPRQ +V P+S+ S  +   +R
Sbjct  572  SEA-FERPVIVHRAILGSVERMLAILTENFAGKWPLWLSPRQVIVVPISEASVGYARRVR  630

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
             ++  A  HV+VD SDR +QKKVREAQ+AQ+NYILVVGEKE   G V+VR RD   H + 
Sbjct  631  AQLRAAKLHVEVDDSDRKMQKKVREAQLAQFNYILVVGEKEEAEGTVNVRTRDNIVHGMH  690

Query  110  TVDELL  93
             +D  L
Sbjct  691  ALDAEL  696



>gb|AAN71609.1| RH56418p [Drosophila melanogaster]
 gb|ACL87841.1| Aats-thr-PB, partial [synthetic construct]
Length=711

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  509  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  568

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  569  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVR  627

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  628  DQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  686

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  687  EVSVAELITKLQKI  700



>emb|CDF89359.1| ZYBA0S04-02388g1_1 [Zygosaccharomyces bailii CLIB 213]
 emb|CDH08320.1| Threonine--tRNA ligase, cytoplasmic [Zygosaccharomyces bailii 
ISA1307]
Length=736

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 139/196 (71%), Gaps = 7/196 (4%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA---E  471
            AL ++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L Y +   E
Sbjct  530  ALQKWGGKWELNPGDGAFYGPKIDIMISDALRRWHQCATVQLDFQLPDRFGLEYKSKENE  589

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            +    ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q +  E+R
Sbjct  590  ESESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQILVVPVGVKYQPYAQEVR  649

Query  290  DRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK--  117
            D++H AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ D +  
Sbjct  650  DKLHAAGFYADVDLSGNTLQKKVRNGQMLKYNFIFIVGEQEMNENSVNIRNRDVMDQQGK  709

Query  116  --VMTVDELLAHFKDL  75
               +T+D +L   K L
Sbjct  710  NATVTLDTVLEQLKKL  725



>emb|CDW52205.1| threonyl tRNA synthetase, cytoplasmic [Trichuris trichiura]
Length=707

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 140/194 (72%), Gaps = 2/194 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ F  PW +N GDGAFYGPKIDI V DAM+R  QCAT+QLDFQLP RF+L Y+ E+  
Sbjct  507  ALDNFNLPWTLNAGDGAFYGPKIDIIVLDAMRRGHQCATVQLDFQLPIRFDLHYTDENGV  566

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            K +RPV++HRAILGS+ERM A+L E+F GKWPFWLSPRQA+V PV     ++   ++D+I
Sbjct  567  K-QRPVIVHRAILGSIERMIAVLTENFGGKWPFWLSPRQAIVVPVHPVLDSYAEAVKDKI  625

Query  281  HEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            +EAGF  DVD  S  T  KKVR AQVAQYNYILVVGEKE   G V+VR RD   H   TV
Sbjct  626  YEAGFECDVDLDSSDTFNKKVRNAQVAQYNYILVVGEKEKENGTVNVRTRDNKVHGEFTV  685

Query  104  DELLAHFKDLMASY  63
             +L+  F+ L   Y
Sbjct  686  SDLIQRFRRLKDEY  699



>ref|XP_449908.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG62888.1| unnamed protein product [Candida glabrata]
Length=726

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 143/202 (71%), Gaps = 7/202 (3%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  +ALN++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLPQRF L + A
Sbjct  516  KLENALNKWGGAWELNPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPQRFELEFKA  575

Query  473  EDESKRE---RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            +D  + E   RPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  576  KDTEESENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQILVVPVGVKYQEYA  635

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++RD++H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE E     V++R RD+ +
Sbjct  636  QQVRDKMHNAGFYADVDLTGNTLQKKVRTGQLMKYNFIFIVGETEMNENSVNIRNRDVME  695

Query  122  HK----VMTVDELLAHFKDLMA  69
             +     + VD +L   + L A
Sbjct  696  QQGKNATVNVDIVLEQLQKLKA  717



>ref|XP_003674309.1| hypothetical protein NCAS_0A13710 [Naumovozyma castellii CBS 
4309]
 emb|CCC67929.1| hypothetical protein NCAS_0A13710 [Naumovozyma castellii CBS 
4309]
Length=753

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 143/201 (71%), Gaps = 7/201 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            ++   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  542  TKLASALKKWGGNWEINPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPSRFELEFK  601

Query  476  AED---ESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            ++D   E   ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q +
Sbjct  602  SKDGQNEENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQEY  661

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+RD++H AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RDI 
Sbjct  662  AQEVRDQLHNAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDIM  721

Query  125  DHK----VMTVDELLAHFKDL  75
            + +     +TV+ ++   K+L
Sbjct  722  EQQGKNATVTVEAVVEQLKNL  742



>ref|XP_011212426.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
dorsalis]
 ref|XP_011212434.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Bactrocera 
dorsalis]
Length=689

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLPQRFNL+Y A+
Sbjct  487  LAESLDEFGLPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPQRFNLNYIAD  546

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +   +   +R
Sbjct  547  DGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQYDEYAQSVR  605

Query  290  DRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H  
Sbjct  606  DQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKERSSDTVNVRTRDNKVHGE  665

Query  113  MTVDELLA  90
            +++ +L+ 
Sbjct  666  VSITDLIT  673



>ref|XP_010208524.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Colius striatus]
Length=254

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 137/198 (69%), Gaps = 1/198 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LN FG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y  
Sbjct  49   QLQNSLNNFGEQWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVG  108

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            +D   ++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV    + +  ++
Sbjct  109  KDGDDKKRPVIIHRAVLGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPTCEEYARQV  168

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
              +  EAGF  DVD     T+ KK+R AQ+AQYN+ILVVGEKE     V+VR RD   H 
Sbjct  169  CCQFFEAGFMSDVDLDPSCTLNKKIRNAQLAQYNFILVVGEKEKANSAVNVRTRDNKVHG  228

Query  116  VMTVDELLAHFKDLMASY  63
             ++V   +   K+  +S+
Sbjct  229  EISVSAAIEKLKEFKSSH  246



>ref|XP_004349538.1| threonyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE91684.1| threonyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
Length=726

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 146/201 (73%), Gaps = 2/201 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+  +  ++LN+FG PW++N GDGAFYGPKIDI++ DA++R  QCAT+QLDFQLP RF L
Sbjct  507  KAEKQLEESLNKFGAPWKLNPGDGAFYGPKIDITIMDALRRSHQCATIQLDFQLPIRFGL  566

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
             Y A D ++ + PV+IHRAILGSVERM AIL E+F GKWPFWLSPRQA+V  VS     +
Sbjct  567  KYQAPDGTE-QTPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQALVIAVSKDCNDY  625

Query  305  GMELRDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
              E++ ++H+AGFHVD D   D T+ KKVR AQ+AQYN+ILVVG +E  +   +VR RD 
Sbjct  626  AHEVQKQLHDAGFHVDYDLWPDETLNKKVRNAQLAQYNFILVVGARERESRSANVRTRDN  685

Query  128  PDHKVMTVDELLAHFKDLMAS  66
              H   T+ +L+A F +L  S
Sbjct  686  KVHGERTIPQLIAEFTELAKS  706



>ref|XP_001969762.1| GG23767 [Drosophila erecta]
 gb|EDV58821.1| GG23767 [Drosophila erecta]
Length=746

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  544  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  603

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  604  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVR  662

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  663  DQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  721

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  722  EVSVAELITKLQKI  735



>ref|XP_008213480.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Nasonia 
vitripennis]
Length=720

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             +++L+ FGKPW +N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y  E
Sbjct  517  LSESLDAFGKPWTLNPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLNYVNE  576

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               ++ RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PV      +  + R
Sbjct  577  T-GEKTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVGPSLDEYATQTR  635

Query  290  DRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D+IH AGF  +VDT    T+ KK+R AQ+ Q+N+ILVVGEKE   G V+VR RD   H  
Sbjct  636  DKIHAAGFMTEVDTDHGDTLNKKIRNAQLDQFNFILVVGEKEKAAGTVNVRTRDNKVHGE  695

Query  113  MTVDELLAHFK  81
            + VD+L+  F+
Sbjct  696  IGVDDLIQKFQ  706



>gb|EMP39003.1| Putative threonyl-tRNA synthetase 2, cytoplasmic [Chelonia mydas]
Length=435

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 138/201 (69%), Gaps = 1/201 (0%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LN+FG+PW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y  
Sbjct  230  QLQNSLNDFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVG  289

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            +D   ++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV    + +  ++
Sbjct  290  KDSDDKKRPVIIHRAVLGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPTCEKYAQQV  349

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
                 EAGF  DVD     T+ KK+R AQ+AQYN+ILVVGEKE     V+VR RD   H 
Sbjct  350  CREFFEAGFMADVDLDHSCTLNKKIRNAQLAQYNFILVVGEKEKVNNAVNVRTRDNKVHG  409

Query  116  VMTVDELLAHFKDLMASYK*Y  54
             + V   +   K L  S+  Y
Sbjct  410  EILVTSAIEKLKKLKKSHALY  430



>ref|XP_003729486.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like, partial 
[Strongylocentrotus purpuratus]
Length=591

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 140/194 (72%), Gaps = 2/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            + LN+FG  W IN  DGAFYGPKIDI++ DA++R  QCAT+QLDFQLP RFNL YSA D 
Sbjct  390  NTLNKFGAEWRINPADGAFYGPKIDITILDALRRSHQCATIQLDFQLPIRFNLKYSAADG  449

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
            +++ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ +V P+      + + ++D+
Sbjct  450  TEK-RPVIIHRAILGSVERMMAILTENFGGKWPFWLSPRQCIVIPIGPAFNDYAITVKDK  508

Query  284  IHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            +H AGF  + DT +  T+ KK+R  Q+AQ+N+ILVVGEKE T G  +VR RD   H   +
Sbjct  509  LHNAGFSCEADTDAGDTMNKKIRNGQLAQFNFILVVGEKEKTNGTANVRTRDNQVHGEKS  568

Query  107  VDELLAHFKDLMAS  66
            +DE++  F  L  S
Sbjct  569  IDEIITRFSALKDS  582



>ref|XP_001989177.1| GH11579 [Drosophila grimshawi]
 gb|EDW04044.1| GH11579 [Drosophila grimshawi]
Length=493

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 144/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+QLDFQLP RFNL+Y A+
Sbjct  291  LAESLDEFGMPWKENHGDGAFYGPKIDITIMDALKRPFQCATIQLDFQLPIRFNLNYIAD  350

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +   +R
Sbjct  351  DGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYDEYAKSVR  409

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D+++ AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  410  DQLYAAGFMSESDCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  468

Query  116  VMTVDELLAHFKDL  75
             ++V EL++  + +
Sbjct  469  EVSVAELISKLQKI  482



>ref|NP_723725.1| Threonyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 ref|NP_001285868.1| Threonyl-tRNA synthetase, isoform D [Drosophila melanogaster]
 gb|AAF53166.2| Threonyl-tRNA synthetase, isoform A [Drosophila melanogaster]
 gb|ACJ13176.1| FI05224p [Drosophila melanogaster]
 gb|AHN54382.1| Threonyl-tRNA synthetase, isoform D [Drosophila melanogaster]
Length=747

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  545  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  604

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  605  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVR  663

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  664  DQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  722

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  723  EVSVAELITKLQKI  736



>ref|XP_001603180.2| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Nasonia 
vitripennis]
Length=705

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             +++L+ FGKPW +N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y  E
Sbjct  502  LSESLDAFGKPWTLNPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLNYVNE  561

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               ++ RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PV      +  + R
Sbjct  562  T-GEKTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVGPSLDEYATQTR  620

Query  290  DRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D+IH AGF  +VDT    T+ KK+R AQ+ Q+N+ILVVGEKE   G V+VR RD   H  
Sbjct  621  DKIHAAGFMTEVDTDHGDTLNKKIRNAQLDQFNFILVVGEKEKAAGTVNVRTRDNKVHGE  680

Query  113  MTVDELLAHFK  81
            + VD+L+  F+
Sbjct  681  IGVDDLIQKFQ  691



>gb|AAM50188.1| GH20022p [Drosophila melanogaster]
Length=747

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  545  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  604

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  605  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVR  663

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  664  DQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  722

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  723  EVSVAELITKLQKI  736



>ref|XP_002079196.1| GD23818 [Drosophila simulans]
 gb|EDX04781.1| GD23818 [Drosophila simulans]
Length=747

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  545  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  604

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  605  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQAVR  663

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  664  DQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  722

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  723  EVSVAELITKLQKI  736



>ref|XP_002042027.1| GM26732 [Drosophila sechellia]
 gb|EDW45894.1| GM26732 [Drosophila sechellia]
Length=747

 Score =   233 bits (594),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  545  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  604

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  605  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQAVR  663

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H+AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  664  DQLHDAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  722

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  723  EVSVAELITKLQKI  736



>ref|XP_003955557.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
 emb|CCF56422.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
Length=729

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 144/204 (71%), Gaps = 12/204 (6%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +   ALN++G  WE+N GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + A
Sbjct  517  KLESALNKWGGNWELNPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFKA  576

Query  473  EDESKR-----ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQA  309
            +D  +      ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q 
Sbjct  577  KDNKEEANENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQD  636

Query  308  HGMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDI  129
            +  E+RD++H+AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE+E T   V++R RD+
Sbjct  637  YAQEVRDQLHDAGFYADVDLSGNTLQKKVRNGQLLKYNFIFIVGEQEMTEKSVNIRNRDV  696

Query  128  PDHK-------VMTVDELLAHFKD  78
             + +       + TV E L + K+
Sbjct  697  MEQQGKNATISLATVIEQLNNLKE  720



>ref|XP_002002014.1| GI17149 [Drosophila mojavensis]
 gb|EDW11456.1| GI17149 [Drosophila mojavensis]
Length=691

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 144/194 (74%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+QLDFQLP RFNL+Y A+
Sbjct  489  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRPFQCATIQLDFQLPIRFNLNYIAD  548

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  KR RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +   +R
Sbjct  549  DGEKR-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYDEYAKTVR  607

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D ++ AGF   VD D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  608  DELYAAGFMSEVDCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSKTVNVRTRDNKVHG  666

Query  116  VMTVDELLAHFKDL  75
             ++V EL++  + +
Sbjct  667  EVSVAELISKLQKI  680



>ref|XP_003397155.1| PREDICTED: threonyl-tRNA synthetase, cytoplasmic-like [Bombus 
terrestris]
Length=725

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 143/191 (75%), Gaps = 2/191 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L+ FG+PW+IN  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY  E
Sbjct  522  LAESLDAFGEPWKINPEDGAFYGPKIDITIMDALKRHHQCATIQLDFQLPIRFNLSYINE  581

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               +R RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PVS +   +  +++
Sbjct  582  S-GERTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVSSQFDEYAEQVK  640

Query  290  DRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D++  +G  V++DT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V+VR RD   H  
Sbjct  641  DKLWNSGIMVEIDTDSSDTLNKKIRNAQLAQFNFILVVGEKELNAGTVNVRTRDNVVHGE  700

Query  113  MTVDELLAHFK  81
            + VD+L+A FK
Sbjct  701  ILVDDLIAKFK  711



>gb|EDZ71519.1| YIL078Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=689

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  479  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  538

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  539  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  598

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  599  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  658

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  659  QQGKNATVSVEEVLKQLRNL  678



>ref|XP_004531260.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Ceratitis capitata]
Length=785

 Score =   233 bits (595),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L+EFG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y A+
Sbjct  583  LAESLDEFGQPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPVRFNLNYIAD  642

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +   +   +R
Sbjct  643  DGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQFDEYAQTVR  701

Query  290  DRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D +H AGF  +VDT    T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H  
Sbjct  702  DELHAAGFMAEVDTDHGDTLNKKIRNAQLAQFNFILVVGEKERSSNTVNVRTRDNKVHGE  761

Query  113  MTVDEL  96
            ++VD+L
Sbjct  762  VSVDDL  767



>gb|AJR37072.1| Ths1p [Saccharomyces cerevisiae YJM195]
 gb|AJR44653.1| Ths1p [Saccharomyces cerevisiae YJM1248]
 gb|AJR50884.1| Ths1p [Saccharomyces cerevisiae YJM1439]
Length=734

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|AJR47138.1| Ths1p [Saccharomyces cerevisiae YJM1342]
Length=734

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|EDV09560.1| threonyl-tRNA synthetase [Saccharomyces cerevisiae RM11-1a]
 emb|CAY80430.1| Ths1p [Saccharomyces cerevisiae EC1118]
 gb|EGA74554.1| Ths1p [Saccharomyces cerevisiae AWRI796]
 gb|EGA86420.1| Ths1p [Saccharomyces cerevisiae VL3]
 gb|EWG85322.1| Ths1p [Saccharomyces cerevisiae R008]
 gb|EWG90489.1| Ths1p [Saccharomyces cerevisiae P301]
 gb|AHY75925.1| Ths1p [Saccharomyces cerevisiae YJM993]
 gb|AJP39393.1| Ths1p [Saccharomyces cerevisiae YJM1078]
 gb|AJR36686.1| Ths1p [Saccharomyces cerevisiae YJM189]
 gb|AJR36881.1| Ths1p [Saccharomyces cerevisiae YJM193]
 gb|AJR37220.1| Ths1p [Saccharomyces cerevisiae YJM244]
 gb|AJR37412.1| Ths1p [Saccharomyces cerevisiae YJM248]
 gb|AJR37606.1| Ths1p [Saccharomyces cerevisiae YJM270]
 gb|AJR37802.1| Ths1p [Saccharomyces cerevisiae YJM271]
 gb|AJR38368.1| Ths1p [Saccharomyces cerevisiae YJM428]
 gb|AJR38560.1| Ths1p [Saccharomyces cerevisiae YJM450]
 gb|AJR38751.1| Ths1p [Saccharomyces cerevisiae YJM451]
 gb|AJR39875.1| Ths1p [Saccharomyces cerevisiae YJM555]
 gb|AJR40067.1| Ths1p [Saccharomyces cerevisiae YJM627]
 gb|AJR40255.1| Ths1p [Saccharomyces cerevisiae YJM681]
 gb|AJR41015.1| Ths1p [Saccharomyces cerevisiae YJM693]
 gb|AJR41187.1| Ths1p [Saccharomyces cerevisiae YJM969]
 gb|AJR41381.1| Ths1p [Saccharomyces cerevisiae YJM972]
 gb|AJR41574.1| Ths1p [Saccharomyces cerevisiae YJM975]
 gb|AJR41768.1| Ths1p [Saccharomyces cerevisiae YJM978]
 gb|AJR41961.1| Ths1p [Saccharomyces cerevisiae YJM981]
 gb|AJR42155.1| Ths1p [Saccharomyces cerevisiae YJM984]
 gb|AJR42345.1| Ths1p [Saccharomyces cerevisiae YJM987]
 gb|AJR42539.1| Ths1p [Saccharomyces cerevisiae YJM990]
 gb|AJR42733.1| Ths1p [Saccharomyces cerevisiae YJM996]
 gb|AJR43114.1| Ths1p [Saccharomyces cerevisiae YJM1129]
 gb|AJR43308.1| Ths1p [Saccharomyces cerevisiae YJM1133]
 gb|AJR43694.1| Ths1p [Saccharomyces cerevisiae YJM1199]
 gb|AJR44267.1| Ths1p [Saccharomyces cerevisiae YJM1242]
 gb|AJR44460.1| Ths1p [Saccharomyces cerevisiae YJM1244]
 gb|AJR44845.1| Ths1p [Saccharomyces cerevisiae YJM1250]
 gb|AJR45226.1| Ths1p [Saccharomyces cerevisiae YJM1252]
 gb|AJR45988.1| Ths1p [Saccharomyces cerevisiae YJM1311]
 gb|AJR46179.1| Ths1p [Saccharomyces cerevisiae YJM1326]
 gb|AJR46368.1| Ths1p [Saccharomyces cerevisiae YJM1332]
 gb|AJR46560.1| Ths1p [Saccharomyces cerevisiae YJM1336]
 gb|AJR46753.1| Ths1p [Saccharomyces cerevisiae YJM1338]
 gb|AJR46947.1| Ths1p [Saccharomyces cerevisiae YJM1341]
 gb|AJR47520.1| Ths1p [Saccharomyces cerevisiae YJM1356]
 gb|AJR47711.1| Ths1p [Saccharomyces cerevisiae YJM1381]
 gb|AJR47899.1| Ths1p [Saccharomyces cerevisiae YJM1383]
 gb|AJR48070.1| Ths1p [Saccharomyces cerevisiae YJM1385]
 gb|AJR48261.1| Ths1p [Saccharomyces cerevisiae YJM1386]
 gb|AJR48454.1| Ths1p [Saccharomyces cerevisiae YJM1387]
 gb|AJR48839.1| Ths1p [Saccharomyces cerevisiae YJM1389]
 gb|AJR49032.1| Ths1p [Saccharomyces cerevisiae YJM1399]
 gb|AJR49737.1| Ths1p [Saccharomyces cerevisiae YJM1415]
 gb|AJR49930.1| Ths1p [Saccharomyces cerevisiae YJM1417]
 gb|AJR50119.1| Ths1p [Saccharomyces cerevisiae YJM1418]
 gb|AJR50306.1| Ths1p [Saccharomyces cerevisiae YJM1419]
 gb|AJR50499.1| Ths1p [Saccharomyces cerevisiae YJM1433]
 gb|AJR51073.1| Ths1p [Saccharomyces cerevisiae YJM1443]
 gb|AJR51447.1| Ths1p [Saccharomyces cerevisiae YJM1447]
 gb|AJR51826.1| Ths1p [Saccharomyces cerevisiae YJM1460]
 gb|AJR52013.1| Ths1p [Saccharomyces cerevisiae YJM1463]
 gb|AJR52206.1| Ths1p [Saccharomyces cerevisiae YJM1477]
 gb|AJR52394.1| Ths1p [Saccharomyces cerevisiae YJM1478]
 gb|AJR52703.1| Ths1p [Saccharomyces cerevisiae YJM1526]
 gb|AJR53473.1| Ths1p [Saccharomyces cerevisiae YJM1574]
 gb|AJR53666.1| Ths1p [Saccharomyces cerevisiae YJM1592]
Length=734

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>emb|CAA26666.1| unnamed protein product [Saccharomyces cerevisiae]
Length=734

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>ref|XP_003489967.1| PREDICTED: threonyl-tRNA synthetase, cytoplasmic-like [Bombus 
impatiens]
Length=690

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 143/191 (75%), Gaps = 2/191 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L+ FG+PW++N  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY  E
Sbjct  487  LAESLDAFGEPWKLNPEDGAFYGPKIDITIMDALKRHHQCATIQLDFQLPIRFNLSYINE  546

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               +R RPV+IHRAILGSVERM AIL E + GKWPFWLSPRQ MV PVS +   +  +++
Sbjct  547  S-GERTRPVIIHRAILGSVERMIAILTESYAGKWPFWLSPRQVMVIPVSSQFDEYAEQVK  605

Query  290  DRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D++  +G  V++DT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V+VR RD   H  
Sbjct  606  DKLWNSGIMVEIDTDSSDTLNKKIRNAQLAQFNFILVVGEKELNAGTVNVRTRDNVVHGE  665

Query  113  MTVDELLAHFK  81
            + VD+L+A FK
Sbjct  666  ILVDDLIAKFK  676



>gb|AJR45798.1| Ths1p [Saccharomyces cerevisiae YJM1307]
Length=734

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>ref|NP_116578.3| threonine--tRNA ligase THS1 [Saccharomyces cerevisiae S288c]
 sp|P04801.2|SYTC_YEAST RecName: Full=Threonine--tRNA ligase, cytoplasmic; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Saccharomyces cerevisiae 
S288c]
 emb|CAA86092.1| threonyl-tRNA synthetase [Saccharomyces cerevisiae]
 tpg|DAA08472.1| TPA: threonine--tRNA ligase THS1 [Saccharomyces cerevisiae S288c]
 gb|AJR48647.1| Ths1p [Saccharomyces cerevisiae YJM1388]
 gb|AJR51635.1| Ths1p [Saccharomyces cerevisiae YJM1450]
Length=734

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>ref|XP_003503703.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Cricetulus griseus]
 ref|XP_007618308.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Cricetulus griseus]
 gb|EGW00926.1| Threonyl-tRNA synthetase, cytoplasmic [Cricetulus griseus]
 gb|ERE81441.1| threonyl-tRNA synthetase, cytoplasmic isoform 1 [Cricetulus griseus]
Length=722

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 141/197 (72%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNLSY +
Sbjct  517  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLSYVS  576

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  577  HDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  636

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H 
Sbjct  637  RQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHG  696

Query  116  VMTVDELLAHFKDLMAS  66
              TV+E +   + L  S
Sbjct  697  ERTVEETVERLQQLKQS  713



>gb|EIW09934.1| Ths1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|AJR44073.1| Ths1p [Saccharomyces cerevisiae YJM1208]
Length=734

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|AAH04621.1| Tars protein, partial [Mus musculus]
Length=457

 Score =   226 bits (577),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  255  NSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  314

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  315  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  374

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  375  FHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERT  434

Query  107  VDELLAHFKDL  75
            V+E +   + L
Sbjct  435  VEETVRRLQQL  445



>ref|XP_011342020.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Cerapachys 
biroi]
Length=711

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            D+LN FG+PW +N  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY  E  
Sbjct  510  DSLNAFGEPWTLNPQDGAFYGPKIDITIMDALKRPHQCATIQLDFQLPIRFNLSYINE-A  568

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
             ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQAM+ PV+ +   +  E+  +
Sbjct  569  GEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQAMIVPVASQFNDYAYEVEQK  628

Query  284  IHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            +  AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V++R RD   H  M 
Sbjct  629  LWNAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKEQIAGTVNIRTRDNVVHGEMA  688

Query  107  VDELLAHFKDLMAS  66
            V+EL+A  K L  S
Sbjct  689  VEELIAKLKVLKES  702



>gb|EDN61420.1| threonyl-tRNA synthetase [Saccharomyces cerevisiae YJM789]
 gb|AJR39138.1| Ths1p [Saccharomyces cerevisiae YJM456]
 gb|AJR43502.1| Ths1p [Saccharomyces cerevisiae YJM1190]
 gb|AJR43881.1| Ths1p [Saccharomyces cerevisiae YJM1202]
 gb|AJR45033.1| Ths1p [Saccharomyces cerevisiae YJM1615]
 gb|AJR45418.1| Ths1p [Saccharomyces cerevisiae YJM1273]
 gb|AJR45610.1| Ths1p [Saccharomyces cerevisiae YJM1304]
 gb|AJR47326.1| Ths1p [Saccharomyces cerevisiae YJM1355]
 gb|AJR49168.1| Ths1p [Saccharomyces cerevisiae YJM1400]
 gb|AJR49354.1| Ths1p [Saccharomyces cerevisiae YJM1401]
 gb|AJR49544.1| Ths1p [Saccharomyces cerevisiae YJM1402]
 gb|AJR50692.1| Ths1p [Saccharomyces cerevisiae YJM1434]
 gb|AJR51264.1| Ths1p [Saccharomyces cerevisiae YJM1444]
 gb|AJR52586.1| Ths1p [Saccharomyces cerevisiae YJM1479]
 gb|AJR52897.1| Ths1p [Saccharomyces cerevisiae YJM1527]
 gb|AJR53284.1| Ths1p [Saccharomyces cerevisiae YJM1573]
Length=734

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|AJR39322.1| Ths1p [Saccharomyces cerevisiae YJM470]
Length=734

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|EWG95461.1| Ths1p [Saccharomyces cerevisiae R103]
 gb|EWH17895.1| Ths1p [Saccharomyces cerevisiae P283]
Length=734

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|AJR38945.1| Ths1p [Saccharomyces cerevisiae YJM453]
Length=734

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|EEU08659.1| Ths1p [Saccharomyces cerevisiae JAY291]
 dbj|GAA24039.1| K7_Ths1p [Saccharomyces cerevisiae Kyokai no. 7]
Length=734

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|EHN06623.1| Ths1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=734

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>ref|XP_002088448.1| Aats-thr [Drosophila yakuba]
 gb|EDW88160.1| Aats-thr [Drosophila yakuba]
Length=747

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 142/194 (73%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  545  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  604

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  605  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVR  663

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  664  DQLHAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  722

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  723  EVSVAELITKLQKI  736



>ref|XP_319682.4| AGAP008929-PA [Anopheles gambiae str. PEST]
 gb|EAA14818.5| AGAP008929-PA [Anopheles gambiae str. PEST]
Length=761

 Score =   233 bits (593),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              D+L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y  +
Sbjct  559  LADSLDKFGEPWKENPGDGAFYGPKIDITIMDALKRNHQCATIQLDFQLPIRFNLNY-ID  617

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R
Sbjct  618  DSGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYDDYADQVR  677

Query  290  DRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
             R+HEAGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H 
Sbjct  678  QRLHEAGFMVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERSSETVNVRTRDNKVHG  736

Query  116  VMTVDELLAHFKDLMASY  63
             +TV++L+     L   Y
Sbjct  737  EVTVNDLVTKLSKLRDEY  754



>ref|XP_011212417.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Bactrocera 
dorsalis]
Length=784

 Score =   233 bits (594),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L+EFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLPQRFNL+Y A+
Sbjct  582  LAESLDEFGLPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPQRFNLNYIAD  641

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV  +   +   +R
Sbjct  642  DGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPQYDEYAQSVR  700

Query  290  DRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
            D++H AGF  + DT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H  
Sbjct  701  DQLHSAGFMAEADTDAGDTLNKKIRNAQLAQFNFILVVGEKERSSDTVNVRTRDNKVHGE  760

Query  113  MTVDELLA  90
            +++ +L+ 
Sbjct  761  VSITDLIT  768



>gb|EGA78432.1| Ths1p [Saccharomyces cerevisiae Vin13]
Length=734

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>gb|AJR53093.1| Ths1p [Saccharomyces cerevisiae YJM1549]
Length=734

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALKKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVIPVGVKYQGYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   ++L
Sbjct  704  QQGKNATVSVEEVLKQLRNL  723



>ref|XP_001965104.1| GF21565 [Drosophila ananassae]
 gb|EDV33238.1| GF21565 [Drosophila ananassae]
Length=749

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 142/194 (73%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY A+
Sbjct  547  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIAD  606

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +   +R
Sbjct  607  DGEKK-RPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVR  665

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D++H AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  666  DQLHAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  724

Query  116  VMTVDELLAHFKDL  75
             ++V EL+   + +
Sbjct  725  EVSVAELITKLQKI  738



>ref|XP_001642915.1| hypothetical protein Kpol_411p2 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15057.1| hypothetical protein Kpol_411p2 [Vanderwaltozyma polyspora DSM 
70294]
Length=729

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            ++   AL ++G  WE+N GDGAFYGPKIDI + DA+KR  QCAT+QLDFQLP RF L + 
Sbjct  518  AKLQSALEKWGGDWELNPGDGAFYGPKIDIMISDALKRWHQCATIQLDFQLPNRFELEFK  577

Query  476  AEDESKRE---RPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            A+D  + E   RPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q +
Sbjct  578  AKDNQENENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVLVVPVGVKYQEY  637

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E+RD++H AGF+ DVD S  T+QKKVR  Q+ +YN+I +VGE E T   V++R RDI 
Sbjct  638  AQEVRDKLHAAGFYADVDLSGNTLQKKVRTGQLLKYNFIFIVGEDELTNKTVNIRNRDIV  697

Query  125  DHK  117
            + +
Sbjct  698  EQQ  700



>gb|KHJ41146.1| hypothetical protein D918_08732 [Trichuris suis]
Length=706

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 139/194 (72%), Gaps = 2/194 (1%)
 Frame = -1

Query  641  ALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDES  462
            AL+ F  PW +N GDGAFYGPKIDI V DAM+R  QCAT+QLDFQLP RF+L Y+ E+  
Sbjct  506  ALDNFNLPWTLNAGDGAFYGPKIDIIVLDAMRRGHQCATVQLDFQLPIRFDLHYTDENGV  565

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRI  282
            K +RPV++HRAILGS+ERM A+L E+F GKWPFWLSPRQA+V PV     ++   ++D I
Sbjct  566  K-QRPVIVHRAILGSIERMIAVLTENFGGKWPFWLSPRQAVVVPVHPVLDSYAEAVKDEI  624

Query  281  HEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTV  105
            +EAGF  DVD  S  T  KKVR AQVAQYNYILVVGEKE   G V+VR RD   H   TV
Sbjct  625  YEAGFECDVDLDSSDTFNKKVRNAQVAQYNYILVVGEKEKENGTVNVRTRDNKVHGEFTV  684

Query  104  DELLAHFKDLMASY  63
             +L+  F+ L   Y
Sbjct  685  SDLIQRFRRLKDEY  698



>ref|XP_009238891.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Pongo 
abelii]
Length=563

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  361  NSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  420

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  421  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  480

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  481  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  540

Query  107  VDELLAHFKDLMAS  66
            + E +   + L  S
Sbjct  541  ISETIERLQQLKES  554



>gb|EHN01906.1| Ths1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=734

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+   AL ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  524  SKLESALRKWGGNWEINAGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  583

Query  476  AEDESKR--ERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
            ++D+     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ +V PV  K Q + 
Sbjct  584  SKDQDSESYERPVMIHRAILGSVERMAAILTEHFAGKWPFWLSPRQVLVVPVGVKYQDYA  643

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++R+++H+AGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RD+ +
Sbjct  644  EDVRNKLHDAGFYADVDLTGNTLQKKVRNGQMLKYNFIFIVGEQEMNEKSVNIRNRDVME  703

Query  122  HK----VMTVDELLAHFKDL  75
             +     ++V+E+L   K+L
Sbjct  704  QQGKNATVSVEEVLKQLKNL  723



>ref|XP_004088253.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=559

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  357  NSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  416

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  417  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  476

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  477  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  536

Query  107  VDELLAHFKDLMAS  66
            + E +   + L  S
Sbjct  537  ISETIERLQQLKQS  550



>ref|XP_006194878.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus ferus]
 ref|XP_010953863.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus bactrianus]
 ref|XP_010975928.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Camelus dromedarius]
Length=709

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 141/198 (71%), Gaps = 1/198 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  504  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  563

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  564  HDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  623

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
              + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  624  WQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  683

Query  116  VMTVDELLAHFKDLMASY  63
              TV E +   + L  SY
Sbjct  684  ERTVSETIERLQQLKQSY  701



>ref|XP_011342019.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Cerapachys 
biroi]
 gb|EZA52272.1| Threonyl-tRNA synthetase, cytoplasmic [Cerapachys biroi]
Length=716

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            D+LN FG+PW +N  DGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNLSY  E  
Sbjct  515  DSLNAFGEPWTLNPQDGAFYGPKIDITIMDALKRPHQCATIQLDFQLPIRFNLSYINE-A  573

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
             ++ RPV+IHRAILGSVERM AIL E + GKWP+WLSPRQAM+ PV+ +   +  E+  +
Sbjct  574  GEKTRPVIIHRAILGSVERMIAILTESYGGKWPYWLSPRQAMIVPVASQFNDYAYEVEQK  633

Query  284  IHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            +  AG  V+VDT S  T+ KK+R AQ+AQ+N+ILVVGEKE   G V++R RD   H  M 
Sbjct  634  LWNAGVMVEVDTDSSDTLNKKIRNAQLAQFNFILVVGEKEQIAGTVNIRTRDNVVHGEMA  693

Query  107  VDELLAHFKDLMAS  66
            V+EL+A  K L  S
Sbjct  694  VEELIAKLKVLKES  707



>ref|XP_004349666.1| threonine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR22577.1| threonine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=705

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = -1

Query  638  LNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSY-SAEDES  462
            L++FG+PW++N GDGAFYGPKIDI + DA++RK QCAT+QLDFQLP RF L + S E E 
Sbjct  510  LDKFGRPWKLNPGDGAFYGPKIDIKIQDALRRKHQCATIQLDFQLPIRFELDFMSGEKEG  569

Query  461  KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCP-VSDKSQAHGME-LRD  288
            +  RPV+IHRAILGSVERM AILLEH  GKWPFWLSPRQ +V P VSD +Q   +E +R 
Sbjct  570  ELTRPVIIHRAILGSVERMMAILLEHTAGKWPFWLSPRQVVVIPVVSDAAQNEYVEKVRQ  629

Query  287  RIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
            R+H+AGF+VD D SD+ + KK+RE+Q+AQYNYILV G++E  T  V+VR RD   H  + 
Sbjct  630  RLHDAGFYVDSDLSDKKLDKKIRESQLAQYNYILVCGKEEIETETVNVRTRDNVRHGTIP  689

Query  107  VDELLAHFKDLMASYK  60
            +++L+      +A ++
Sbjct  690  LNDLIEKLNAHVAKHE  705



>ref|XP_002052626.1| GJ17652 [Drosophila virilis]
 gb|EDW64781.1| GJ17652 [Drosophila virilis]
Length=745

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++LNEFG PW+ N GDGAFYGPKIDI++ DA+KR FQCAT+QLDFQLP RFNL+Y A+
Sbjct  543  LAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRPFQCATIQLDFQLPIRFNLNYIAD  602

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  K+ RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +   +R
Sbjct  603  DGEKK-RPVIIHRAILGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYDEYAKSVR  661

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            D+++ AGF    D D  D T+ KK+R AQ+AQ+N+ILVVG+KE ++  V+VR RD   H 
Sbjct  662  DQLYAAGFMSEADCDAGD-TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHG  720

Query  116  VMTVDELLAHFKDLMASY  63
             ++V EL+   + +   Y
Sbjct  721  EVSVAELITKLQKIRDEY  738



>gb|ETN67379.1| threonyl-tRNA synthetase [Anopheles darlingi]
Length=706

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y  +
Sbjct  504  LAESLDKFGEPWKENPGDGAFYGPKIDITIMDALKRHHQCATIQLDFQLPIRFNLNY-VD  562

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R
Sbjct  563  DSGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYDEYADKVR  622

Query  290  DRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
             R+H+AGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H 
Sbjct  623  LRLHDAGFTVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERSSETVNVRTRDNKVHG  681

Query  116  VMTVDELLAHFKDLMASY  63
             +TVDEL+     L   Y
Sbjct  682  EVTVDELVTKLAKLRDEY  699



>ref|XP_005325709.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Ictidomys 
tridecemlineatus]
Length=722

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  517  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  576

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  577  HDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQQV  636

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  637  RQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  696

Query  116  VMTVDELLAHFKDLMAS  66
              TV E +   + L  S
Sbjct  697  ERTVSETIERLRQLKQS  713



>ref|XP_005556719.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X4 [Macaca 
fascicularis]
Length=602

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  400  NSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  459

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  460  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  519

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  520  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  579

Query  107  VDELLAHFKDLMAS  66
            + E +   + L  S
Sbjct  580  ISETMERLQQLKES  593



>ref|XP_004088252.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=619

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y +
Sbjct  414  QLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS  473

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  474  HDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  533

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H 
Sbjct  534  RQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHG  593

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  594  ERTISETIERLQQLKQS  610



>ref|XP_005320129.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic isoform 
X3 [Ictidomys tridecemlineatus]
Length=713

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++L EFGKPW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y +
Sbjct  508  QLQNSLTEFGKPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS  567

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            +D   ++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV    + + +++
Sbjct  568  KDGDDKKRPVIIHRAVLGSVERMIAILAENYGGKWPFWLSPRQVMVIPVGSTCEEYAVQV  627

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
             +   E GF  DVD  D  T+ KK+R AQ+AQYN+ILVVGEKE     V+VR RD   H 
Sbjct  628  SNEFFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHG  687

Query  116  VMTVDELLAHFKDLMAS  66
             ++V   +   K+L  S
Sbjct  688  EISVTSAINKLKNLKKS  704



>gb|ELK31735.1| Threonyl-tRNA synthetase, cytoplasmic [Myotis davidii]
Length=649

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 140/194 (72%), Gaps = 1/194 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  444  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  503

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ M+ PV      +  ++
Sbjct  504  HDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMIVPVGPTCDDYAQKV  563

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H 
Sbjct  564  RQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHG  623

Query  116  VMTVDELLAHFKDL  75
              TV E +A  + L
Sbjct  624  ERTVAETVARLQQL  637



>ref|XP_001950747.2| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Acyrthosiphon 
pisum]
Length=714

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  D+LN FG+PW +N GDGAFYGPKIDI++ DA+KR+ QCAT+QLDFQLP RFNL++ +
Sbjct  510  QLADSLNSFGEPWTLNPGDGAFYGPKIDITISDALKRQHQCATIQLDFQLPIRFNLNFIS  569

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            E   K+ RPV+IHRAI GSVERM AIL E F GKWPFWLSPRQA+V PV  +   +  ++
Sbjct  570  ESGEKK-RPVIIHRAIFGSVERMIAILTESFAGKWPFWLSPRQAIVIPVGPQFDEYSEKV  628

Query  293  RDRIHEAGFHVDVDTS-DRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            +  I+EAGF  DVD     T+ KK+R AQ+AQYN+ILVVG+KE T   V+VR RD   H 
Sbjct  629  KKEIYEAGFMCDVDVDHGDTLNKKIRNAQLAQYNFILVVGDKEKTANTVNVRTRDNNVHG  688

Query  116  VMTVDELLAHFKDLMAS  66
              +++E +   + L  S
Sbjct  689  EFSIEETIQRLQKLKIS  705



>ref|XP_003475575.2| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Cavia 
porcellus]
Length=742

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++L EFGKPW+IN GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y +
Sbjct  537  QLQNSLVEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS  596

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            +D   ++RPV+IHRAILGS+ERM AIL EH+ GKWPFWLSPRQ MV PV    + + +++
Sbjct  597  KDGDDKKRPVIIHRAILGSLERMIAILSEHYGGKWPFWLSPRQVMVIPVGPTCEKYALQV  656

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
                 E GF  D D  D  T+ KK+R AQ+AQYN+ILVVGEKE     V+VR RD   H 
Sbjct  657  SSEFFEEGFMADTDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHG  716

Query  116  VMTVDELLAHFKDLMAS  66
             ++V  ++   K+L  S
Sbjct  717  EISVTSVIDKLKNLKKS  733



>ref|XP_005003846.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Cavia 
porcellus]
Length=721

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 1/198 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPK+DI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  516  QLENSLNEFGQKWELNPGDGAFYGPKVDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  575

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPVMIHRAILGSVERM AIL E++ GKWPFWLSP Q MV PV      +  ++
Sbjct  576  HDGDDKKRPVMIHRAILGSVERMIAILTENYGGKWPFWLSPCQVMVVPVGPTCDEYAQKV  635

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VDVD     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  636  RQQFHDAKFMVDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  695

Query  116  VMTVDELLAHFKDLMASY  63
              T+ E +   + L  S+
Sbjct  696  ERTISETIERLQQLKQSH  713



>ref|XP_003470228.2| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Cavia 
porcellus]
Length=721

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 141/198 (71%), Gaps = 1/198 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPK+DI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  516  QLENSLNEFGQKWELNPGDGAFYGPKVDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  575

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPVMIHRAILGSVERM AIL E++ GKWPFWLSP Q MV PV      +  ++
Sbjct  576  HDGDDKKRPVMIHRAILGSVERMIAILTENYGGKWPFWLSPCQVMVVPVGPTCDEYAQKV  635

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VDVD     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  636  RQQFHDAKFMVDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  695

Query  116  VMTVDELLAHFKDLMASY  63
              T+ E +   + L  S+
Sbjct  696  ERTISETIERLQQLKQSH  713



>ref|XP_002714160.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Oryctolagus cuniculus]
Length=723

 Score =   231 bits (588),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 141/197 (72%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  518  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  577

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  578  HDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  637

Query  293  RDRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F  D+D  +  T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  638  RQQFHDAKFMADIDLDAGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  697

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  698  ERTISETIERLQQLKQS  714



>ref|XP_005325710.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Ictidomys 
tridecemlineatus]
Length=758

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ + D 
Sbjct  556  NSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDG  615

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  616  DDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQQVRQQ  675

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H   T
Sbjct  676  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERT  735

Query  107  VDELLAHFKDLMAS  66
            V E +   + L  S
Sbjct  736  VSETIERLRQLKQS  749



>ref|XP_967345.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Tribolium 
castaneum]
Length=707

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             ++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+QLDFQLP RFNLSY +E
Sbjct  505  LSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTIQLDFQLPIRFNLSYVSE  564

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQAMV PV      +  +++
Sbjct  565  SGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQAMVIPVGPTYDEYAQDVK  623

Query  290  DRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
             +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H  
Sbjct  624  KKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKERSSQTVNVRTRDNIVHGE  683

Query  113  MTVDELLAHFKDLMASY  63
            ++V+ L+  FK L  +Y
Sbjct  684  ISVEGLIEKFKVLQENY  700



>gb|EFA05822.1| hypothetical protein TcasGA2_TC008604 [Tribolium castaneum]
Length=685

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             ++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+QLDFQLP RFNLSY +E
Sbjct  483  LSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTIQLDFQLPIRFNLSYVSE  542

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQAMV PV      +  +++
Sbjct  543  SGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQAMVIPVGPTYDEYAQDVK  601

Query  290  DRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
             +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H  
Sbjct  602  KKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKERSSQTVNVRTRDNIVHGE  661

Query  113  MTVDELLAHFKDLMASY  63
            ++V+ L+  FK L  +Y
Sbjct  662  ISVEGLIEKFKVLQENY  678



>ref|XP_005556718.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X3 [Macaca 
fascicularis]
Length=639

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  437  NSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  496

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  497  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  556

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  557  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  616

Query  107  VDELLAHFKDLMAS  66
            + E +   + L  S
Sbjct  617  ISETMERLQQLKES  630



>ref|XP_004059038.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 5 [Gorilla 
gorilla gorilla]
Length=602

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  400  NSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  459

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  460  DDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  519

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  520  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  579

Query  107  VDELLAHFKDL  75
            + E +   + L
Sbjct  580  ISETIERLQQL  590



>ref|XP_004372697.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Trichechus 
manatus latirostris]
Length=799

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++L EFGKPW++N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y +
Sbjct  594  QLQNSLMEFGKPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS  653

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            +D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV    + + +++
Sbjct  654  KDGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQV  713

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
                 E GF  DVD  D  T+ KK+R AQ+AQYN+ILVVGEKE T   V+VR RD   H 
Sbjct  714  SSEFFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKTNNAVNVRTRDNKIHG  773

Query  116  VMTVDELLAHFKDLMAS  66
             ++V   +   K+L  S
Sbjct  774  EISVTSAMDKLKNLKNS  790



>emb|CCD74804.1| unnamed protein product [Schistosoma mansoni]
Length=249

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 144/228 (63%), Gaps = 32/228 (14%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++L+E G  WE+N GDGAFYGPKIDI++ DA++R+ QCAT+QLDFQLP RFNLSY++
Sbjct  13   QLKESLDEVGLKWELNPGDGAFYGPKIDINIMDALRRRHQCATIQLDFQLPVRFNLSYAS  72

Query  473  EDES-------------------------------KRERPVMIHRAILGSVERMFAILLE  387
            E ++                                  RPV+IHRAILGSVER+ AIL E
Sbjct  73   ETDNPSGSDNNCNNISNTTNGISNHHEPINHQTDLNTHRPVIIHRAILGSVERIIAILTE  132

Query  386  HFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDRIHEAGFHVDVDTS-DRTIQKKVREAQ  210
             + GKWPFWLSPRQ +V PV      + +++++R+H+AGF V VDT   RT+ KK+R  Q
Sbjct  133  SYGGKWPFWLSPRQVLVVPVVSACDEYAIDVKNRLHDAGFMVSVDTDPGRTLNKKIRNGQ  192

Query  209  VAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMTVDELLAHFKDLMAS  66
            + Q N+ILVVGEKE   G V+VR RD   H    V+ ++  F+ L AS
Sbjct  193  LLQNNFILVVGEKEIANGTVNVRTRDNKVHGEHPVEHVIERFRQLAAS  240



>ref|XP_001418868.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97161.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=674

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 145/195 (74%), Gaps = 1/195 (1%)
 Frame = -1

Query  665  KS*SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNL  486
            K+ +    AL+  G+ W++NEGDGAFYGPKIDI+V DA+KR+FQCAT+QLDFQLP RF+L
Sbjct  479  KAEAALKSALDRSGREWKLNEGDGAFYGPKIDITVFDALKRRFQCATVQLDFQLPIRFDL  538

Query  485  SYSAEDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            SY  E+ S   RP++IHRAILGSVERMFAIL EHF GKWP+WLSP+Q M+ P+S+ S+ +
Sbjct  539  SYVDENNSSV-RPIIIHRAILGSVERMFAILTEHFAGKWPYWLSPKQVMIVPISEASRDY  597

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              E++ ++ +AG   +VD +DR +QKKVREAQ+ Q+NYILV GE E     V+VR RD  
Sbjct  598  CYEVKRQLRKAGHFAEVDVTDRKMQKKVREAQLDQFNYILVCGESEKANETVNVRTRDNK  657

Query  125  DHKVMTVDELLAHFK  81
             H ++  +  +  F+
Sbjct  658  VHVIIRGETAITRFR  672



>ref|XP_001658309.1| AAEL001206-PA [Aedes aegypti]
 gb|EAT47704.1| AAEL001206-PA [Aedes aegypti]
Length=716

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              ++L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y  +
Sbjct  514  LAESLDKFGQPWKENPGDGAFYGPKIDITIMDALKRNHQCATIQLDFQLPIRFNLNY-ID  572

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  +++RPV+IHRA+LGSVERM AIL E + GKWPFWLSPRQ MV PV  +   +  ++R
Sbjct  573  DSGEKKRPVIIHRAVLGSVERMIAILTESYAGKWPFWLSPRQVMVVPVGPQYDDYADKVR  632

Query  290  DRIHEAGF--HVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
             R+HEAGF    D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H 
Sbjct  633  QRLHEAGFMAEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERSSETVNVRTRDNKVHG  691

Query  116  VMTVDELLAHFKDL  75
             ++VD+L+A  + L
Sbjct  692  EVSVDDLVAKLRRL  705



>gb|EFB17446.1| hypothetical protein PANDA_008118 [Ailuropoda melanoleuca]
Length=678

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  473  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  532

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +  ++
Sbjct  533  HDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  592

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VD+D     T+ KK+R AQ+AQYN+ILV+GEKE  +G V++R RD   H 
Sbjct  593  RQQFHDAKFTVDIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHG  652

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  653  ERTISETIERLQQLKQS  669



>ref|XP_006875438.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X2 
[Chrysochloris asiatica]
Length=696

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  491  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  550

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E++ GKWP WLSPRQ MV PV      +  ++
Sbjct  551  HDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPVGPTCDEYAQKV  610

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE ++G V++R RD   H 
Sbjct  611  RQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSGTVNIRTRDNKVHG  670

Query  116  VMTVDELLAHFKDLMAS  66
              TV E +   + LM S
Sbjct  671  ERTVSETITRLQQLMQS  687



>ref|XP_008198247.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Tribolium 
castaneum]
Length=712

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
             ++ L++FG PW +N GDGAFYGPKIDI+V DA+KR  QC T+QLDFQLP RFNLSY +E
Sbjct  510  LSEGLDDFGAPWSVNPGDGAFYGPKIDITVHDALKRAHQCGTIQLDFQLPIRFNLSYVSE  569

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
               K+ RPV+IHRAILGSVERM AIL E   GKWPFW+SPRQAMV PV      +  +++
Sbjct  570  SGEKK-RPVIIHRAILGSVERMIAILTESCGGKWPFWISPRQAMVIPVGPTYDEYAQDVK  628

Query  290  DRIHEAGFHVDVDT-SDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKV  114
             +++EAGF  +VDT +  T+ KK+R AQ+AQ+N+ILVVGEKE ++  V+VR RD   H  
Sbjct  629  KKLYEAGFMAEVDTDAGDTMNKKIRNAQLAQFNFILVVGEKERSSQTVNVRTRDNIVHGE  688

Query  113  MTVDELLAHFKDLMASY  63
            ++V+ L+  FK L  +Y
Sbjct  689  ISVEGLIEKFKVLQENY  705



>gb|EDL03283.1| threonyl-tRNA synthetase, isoform CRA_a [Mus musculus]
Length=544

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  342  NSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  401

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  402  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  461

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  462  FHDAKFMADTDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNIRTRDNKVHGERT  521

Query  107  VDELLAHFKDL  75
            V+E +   + L
Sbjct  522  VEETVRRLQQL  532



>ref|NP_983365.1| ACL039Wp [Ashbya gossypii ATCC 10895]
 gb|AAS51189.1| ACL039Wp [Ashbya gossypii ATCC 10895]
 gb|AEY95480.1| FACL039Wp [Ashbya gossypii FDAG1]
Length=724

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 136/189 (72%), Gaps = 4/189 (2%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            +R   ALN++G  WEINEGDGAFYGPKIDI + DA+KR  QCAT+QLDFQLP RF L Y 
Sbjct  514  ARLESALNKWGGDWEINEGDGAFYGPKIDIMISDALKRWHQCATIQLDFQLPNRFELEYK  573

Query  476  AE--DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHG  303
             +  DE+  ERPVMIHRA+LGSVERM AIL EH+ GKWPFWLSPRQ +V PV  K Q + 
Sbjct  574  GKGNDENAYERPVMIHRALLGSVERMTAILTEHYAGKWPFWLSPRQVLVVPVGVKYQDYA  633

Query  302  MELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPD  123
             ++RD++  AGF+ D D    T+QKKVR  Q+ +YN+I VVGE+E     V++R RD+ D
Sbjct  634  QQIRDKLVGAGFYADADLGSNTLQKKVRTGQMLKYNFIFVVGEQEMNENSVNIRNRDVTD  693

Query  122  --HKVMTVD  102
               K  TVD
Sbjct  694  LQGKNETVD  702



>ref|XP_010168916.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Caprimulgus carolinensis]
 gb|KFZ47626.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Caprimulgus 
carolinensis]
Length=395

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 137/196 (70%), Gaps = 3/196 (2%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LN FG+ W +N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y  +D 
Sbjct  193  NSLNNFGEKWNLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVGKDG  252

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV   S+ +  ++   
Sbjct  253  DDKKRPVIIHRAILGSVERMIAILAENYGGKWPFWLSPRQVMVVPVGPTSEEYARQVCSE  312

Query  284  IHEAGFHVDVDTSDR--TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVM  111
              EAGF  DVD  DR  T+ KK+R AQ+AQYN+ILVVGEKE     V+VR RD   H  +
Sbjct  313  FFEAGFMSDVDL-DRSCTLNKKIRNAQLAQYNFILVVGEKEKANNAVNVRTRDNKVHGEI  371

Query  110  TVDELLAHFKDLMASY  63
            +V   +   K L  S+
Sbjct  372  SVCSAIEKLKKLKTSH  387



>ref|XP_004059037.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform 4 [Gorilla 
gorilla gorilla]
Length=619

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 137/191 (72%), Gaps = 1/191 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  417  NSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  476

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  477  DDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  536

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H   T
Sbjct  537  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT  596

Query  107  VDELLAHFKDL  75
            + E +   + L
Sbjct  597  ISETIERLQQL  607



>ref|XP_004698143.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Echinops telfairi]
Length=664

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ + D 
Sbjct  462  NSLNEFGERWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDG  521

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  522  DDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRLQ  581

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A    DVD     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H   T
Sbjct  582  FHDANIMADVDLDPGCTLNKKIRHAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERT  641

Query  107  VDELLAHFKDLMAS  66
            V E L   K L  S
Sbjct  642  VSETLERLKQLKQS  655



>ref|NP_001125825.1| threonine--tRNA ligase, cytoplasmic [Pongo abelii]
 emb|CAH91401.1| hypothetical protein [Pongo abelii]
Length=563

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y + D 
Sbjct  361  NSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDG  420

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  421  DDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  480

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F  D+D     T+ KK+R AQ+AQYN ILVVGEKE  +G V++R RD   H   T
Sbjct  481  FHDAKFMADIDLDPGCTLNKKIRNAQLAQYNLILVVGEKEKISGTVNIRTRDNKVHGERT  540

Query  107  VDELLAHFKDLMAS  66
            + E +   + L  S
Sbjct  541  ISETIERLQQLKES  554



>ref|XP_004678135.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Condylura cristata]
Length=723

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 141/197 (72%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  518  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  577

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  578  HDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  637

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  638  RQQFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  697

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  698  ERTLAEAIGRLQQLKRS  714



>ref|XP_003688670.1| hypothetical protein TPHA_0P00780 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE66236.1| hypothetical protein TPHA_0P00780 [Tetrapisispora phaffii CBS 
4417]
Length=726

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 139/201 (69%), Gaps = 7/201 (3%)
 Frame = -1

Query  656  SRFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYS  477
            S+    L ++G  WEIN GDGAFYGPKIDI + DA++R  QCAT+QLDFQLP RF L + 
Sbjct  515  SKLQSCLEKWGGDWEINPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLPNRFELEFK  574

Query  476  AEDES---KRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAH  306
            A+D S     ERPVMIHRAILGSVERM AIL EHF GKWPFWLSPRQ  V PV  K Q +
Sbjct  575  AKDGSDSENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVYVVPVGVKYQEY  634

Query  305  GMELRDRIHEAGFHVDVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIP  126
              ++RD+ HEAGF+ DVD +  T+QKKVR  Q+ +YN+I +VGE+E     V++R RDI 
Sbjct  635  AQQIRDKCHEAGFYTDVDLTGNTLQKKVRNGQLLKYNFIFIVGEQEMNERSVNIRNRDIM  694

Query  125  DHK----VMTVDELLAHFKDL  75
            + +     + +D ++   K L
Sbjct  695  EQQGKNATVNIDTVIEQLKKL  715



>ref|XP_004088251.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Nomascus leucogenys]
Length=664

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y +
Sbjct  459  QLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVS  518

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  519  HDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  578

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE  +G V++R RD   H 
Sbjct  579  RQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHG  638

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  639  ERTISETIERLQQLKQS  655



>ref|XP_006875437.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Chrysochloris asiatica]
Length=723

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  518  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  577

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E++ GKWP WLSPRQ MV PV      +  ++
Sbjct  578  HDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPLWLSPRQVMVVPVGPTCDEYAQKV  637

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F  DVD     T+ KK+R AQ+AQYN+ILVVGEKE ++G V++R RD   H 
Sbjct  638  RQQFHDAKFMTDVDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKSSGTVNIRTRDNKVHG  697

Query  116  VMTVDELLAHFKDLMAS  66
              TV E +   + LM S
Sbjct  698  ERTVSETITRLQQLMQS  714



>ref|XP_002919483.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Ailuropoda melanoleuca]
Length=723

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  518  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  577

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +  ++
Sbjct  578  HDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  637

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VD+D     T+ KK+R AQ+AQYN+ILV+GEKE  +G V++R RD   H 
Sbjct  638  RQQFHDAKFTVDIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHG  697

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  698  ERTISETIERLQQLKQS  714



>ref|XP_008690887.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Ursus maritimus]
Length=723

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  518  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  577

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV++HRAILGSVERM AIL E+F GKWPFWLSPRQ MV PV      +  ++
Sbjct  578  HDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVGPTCDEYAQKV  637

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F VD+D     T+ KK+R AQ+AQYN+ILV+GEKE  +G V++R RD   H 
Sbjct  638  RQQFHDAKFTVDIDLDPGCTLNKKIRNAQLAQYNFILVIGEKEKASGTVNIRTRDNKVHG  697

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  698  ERTISETIERLQQLKQS  714



>ref|XP_006148565.1| PREDICTED: threonine--tRNA ligase, cytoplasmic [Tupaia chinensis]
Length=722

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ +
Sbjct  517  QLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVS  576

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
             D   ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++
Sbjct  577  HDGDDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVIPVGPTCDEYAQKV  636

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
            R + H+A F  D+D     T+ KK+R AQ+AQYN+ILVVGEKE T+G V++R RD   H 
Sbjct  637  RQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHG  696

Query  116  VMTVDELLAHFKDLMAS  66
              T+ E +   + L  S
Sbjct  697  ERTISETIERLQQLKQS  713



>ref|XP_004325399.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Tursiops 
truncatus]
Length=619

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = -1

Query  644  DALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAEDE  465
            ++LNEFG+ WE+N GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL++ + D 
Sbjct  417  NSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDG  476

Query  464  SKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELRDR  285
              ++RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R +
Sbjct  477  DDKKRPVIIHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQ  536

Query  284  IHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHKVMT  108
             H+A F VD+D     T+ KK+R AQ+AQYN+ILVVGEKE T+  V++R RD   H   T
Sbjct  537  FHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKTSSTVNIRTRDNKVHGERT  596

Query  107  VDELLAHFKDLMAS  66
            + E +   + L  S
Sbjct  597  ISETIEWLQQLKQS  610



>gb|KFB38665.1| AGAP008929-PA-like protein [Anopheles sinensis]
Length=764

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 145/194 (75%), Gaps = 4/194 (2%)
 Frame = -1

Query  650  FTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSAE  471
              D+L++FG+PW+ N GDGAFYGPKIDI++ DA+KR  QCAT+QLDFQLP RFNL+Y  +
Sbjct  562  LADSLDKFGEPWKENPGDGAFYGPKIDITIMDALKRNHQCATIQLDFQLPIRFNLNY-ID  620

Query  470  DESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMELR  291
            D  +++RPV+IHRA+LGSVERM AIL E++ GKWPFWLSPRQ MV PV      +  ++R
Sbjct  621  DNGEKKRPVIIHRAVLGSVERMIAILTENYAGKWPFWLSPRQVMVVPVGPAYDEYADKVR  680

Query  290  DRIHEAGFHV--DVDTSDRTIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
             R+HEAGF V  D+D  D T+ KK+R AQ+AQ+N+ILVVGEKE  +  V+VR RD   H 
Sbjct  681  QRLHEAGFMVEADLDAGD-TMNKKIRNAQLAQFNFILVVGEKERNSETVNVRTRDNKVHG  739

Query  116  VMTVDELLAHFKDL  75
             ++VD+L+     L
Sbjct  740  EVSVDDLVTKLSKL  753



>ref|XP_004623299.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase 
2, cytoplasmic [Octodon degus]
Length=786

 Score =   231 bits (588),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = -1

Query  653  RFTDALNEFGKPWEINEGDGAFYGPKIDISVCDAMKRKFQCATLQLDFQLPQRFNLSYSA  474
            +  ++L EFGKPW+IN GDGAFYGPKIDI + DA+ R  QCAT+QLDFQLP RFNL+Y +
Sbjct  581  QLQNSLMEFGKPWKINPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVS  640

Query  473  EDESKRERPVMIHRAILGSVERMFAILLEHFKGKWPFWLSPRQAMVCPVSDKSQAHGMEL  294
            +D   R+RPV+IHRAILGSVERM AIL E++ GKWPFWLSPRQ MV PV    + + +++
Sbjct  641  KDGEDRKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALKV  700

Query  293  RDRIHEAGFHVDVDTSDR-TIQKKVREAQVAQYNYILVVGEKEATTGEVSVRVRDIPDHK  117
             +   E GF  D D  D  T+ KK+R AQ+AQYN+ILVVGEKE     V+VR RD   H 
Sbjct  701  SNEFFEEGFMADTDLDDSCTLNKKIRNAQLAQYNFILVVGEKEKMNNAVNVRTRDNKIHG  760

Query  116  VMTVDELLAHFKDLMAS  66
             ++V   +   K+L  S
Sbjct  761  EISVTSAIDKLKNLKKS  777



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140