BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028J15

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004244862.1|  PREDICTED: CSC1-like protein ERD4                  373   3e-121   Solanum lycopersicum
ref|XP_009611468.1|  PREDICTED: CSC1-like protein ERD4 isoform X2       369   3e-120   Nicotiana tomentosiformis
ref|XP_006364887.1|  PREDICTED: uncharacterized membrane protein ...    370   5e-120   Solanum tuberosum [potatoes]
ref|XP_009611467.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       369   8e-120   Nicotiana tomentosiformis
ref|XP_010245168.1|  PREDICTED: CSC1-like protein ERD4                  369   1e-119   Nelumbo nucifera [Indian lotus]
ref|XP_007024953.1|  Early-responsive to dehydration stress prote...    368   2e-119   
ref|XP_009781612.1|  PREDICTED: CSC1-like protein ERD4                  363   2e-117   Nicotiana sylvestris
emb|CBI30957.3|  unnamed protein product                                361   3e-117   Vitis vinifera
ref|XP_010687100.1|  PREDICTED: CSC1-like protein ERD4                  361   7e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002280109.1|  PREDICTED: CSC1-like protein ERD4                  361   9e-117   Vitis vinifera
ref|XP_007211358.1|  hypothetical protein PRUPE_ppa002050mg             360   2e-116   Prunus persica
ref|XP_010540605.1|  PREDICTED: CSC1-like protein ERD4                  359   5e-116   Tarenaya hassleriana [spider flower]
ref|XP_010086875.1|  Uncharacterized membrane protein                   357   6e-116   
ref|XP_008225537.1|  PREDICTED: uncharacterized membrane protein ...    358   2e-115   Prunus mume [ume]
ref|XP_009362276.1|  PREDICTED: CSC1-like protein ERD4                  357   3e-115   Pyrus x bretschneideri [bai li]
ref|XP_010275905.1|  PREDICTED: CSC1-like protein ERD4                  357   3e-115   
ref|XP_008371799.1|  PREDICTED: uncharacterized membrane protein ...    356   7e-115   Malus domestica [apple tree]
ref|XP_011096640.1|  PREDICTED: CSC1-like protein ERD4                  355   2e-114   Sesamum indicum [beniseed]
gb|KDP38019.1|  hypothetical protein JCGZ_04662                         354   4e-114   Jatropha curcas
ref|XP_002531053.1|  conserved hypothetical protein                     351   9e-114   
gb|KCW75872.1|  hypothetical protein EUGRSUZ_D00261                     353   1e-113   Eucalyptus grandis [rose gum]
ref|XP_010052016.1|  PREDICTED: CSC1-like protein ERD4                  353   1e-113   Eucalyptus grandis [rose gum]
ref|XP_003593877.1|  Early-responsive to dehydration                    353   2e-113   Medicago truncatula
gb|KHN06954.1|  Putative membrane protein C24H6.13                      352   2e-113   Glycine soja [wild soybean]
ref|XP_003542948.1|  PREDICTED: uncharacterized membrane protein ...    352   2e-113   Glycine max [soybeans]
ref|XP_003546071.1|  PREDICTED: uncharacterized membrane protein ...    352   3e-113   Glycine max [soybeans]
gb|KJB66976.1|  hypothetical protein B456_010G168400                    352   4e-113   Gossypium raimondii
gb|KDO75375.1|  hypothetical protein CISIN_1g004795mg                   344   4e-112   Citrus sinensis [apfelsine]
ref|XP_008784823.1|  PREDICTED: CSC1-like protein ERD4                  349   5e-112   Phoenix dactylifera
ref|XP_009377481.1|  PREDICTED: CSC1-like protein ERD4                  348   8e-112   Pyrus x bretschneideri [bai li]
ref|XP_007147944.1|  hypothetical protein PHAVU_006G167700g             348   9e-112   Phaseolus vulgaris [French bean]
gb|KDO75374.1|  hypothetical protein CISIN_1g004795mg                   344   1e-111   Citrus sinensis [apfelsine]
ref|XP_010687078.1|  PREDICTED: CSC1-like protein ERD4 isoform X2       345   1e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010052015.1|  PREDICTED: CSC1-like protein ERD4                  347   2e-111   Eucalyptus grandis [rose gum]
ref|XP_006836313.1|  hypothetical protein AMTR_s00092p00051600          346   4e-111   Amborella trichopoda
ref|XP_008439583.1|  PREDICTED: uncharacterized membrane protein ...    347   4e-111   Cucumis melo [Oriental melon]
ref|XP_010687077.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       346   4e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006448976.1|  hypothetical protein CICLE_v100144071mg            343   8e-111   
ref|XP_004158645.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    345   2e-110   
ref|XP_004134564.1|  PREDICTED: uncharacterized membrane protein ...    344   3e-110   Cucumis sativus [cucumbers]
gb|EPS64315.1|  hypothetical protein M569_10465                         344   4e-110   Genlisea aurea
gb|KDO75368.1|  hypothetical protein CISIN_1g004795mg                   344   5e-110   Citrus sinensis [apfelsine]
gb|KJB57185.1|  hypothetical protein B456_009G152500                    343   6e-110   Gossypium raimondii
ref|XP_006468078.1|  PREDICTED: uncharacterized membrane protein ...    343   8e-110   Citrus sinensis [apfelsine]
gb|KDO75367.1|  hypothetical protein CISIN_1g004795mg                   343   9e-110   Citrus sinensis [apfelsine]
emb|CDY67965.1|  BnaCnng57110D                                          335   2e-109   Brassica napus [oilseed rape]
gb|EYU19153.1|  hypothetical protein MIMGU_mgv1a001965mg                342   4e-109   Erythranthe guttata [common monkey flower]
ref|XP_011012269.1|  PREDICTED: CSC1-like protein ERD4                  341   5e-109   Populus euphratica
ref|XP_002300337.1|  early-responsive to dehydration stress famil...    341   5e-109   Populus trichocarpa [western balsam poplar]
emb|CDP05663.1|  unnamed protein product                                341   5e-109   Coffea canephora [robusta coffee]
emb|CDY12050.1|  BnaC03g59660D                                          341   7e-109   Brassica napus [oilseed rape]
ref|NP_001288888.1|  CSC1-like protein ERD4                             339   9e-109   Brassica rapa
ref|XP_009398321.1|  PREDICTED: CSC1-like protein ERD4                  340   1e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408546.1|  PREDICTED: CSC1-like protein ERD4                  340   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX90246.1|  BnaA08g17380D                                          339   3e-108   
ref|XP_006415482.1|  hypothetical protein EUTSA_v10006933mg             335   4e-108   
gb|KHG13189.1|  putative membrane C2G11.09                              338   1e-107   Gossypium arboreum [tree cotton]
ref|XP_011014082.1|  PREDICTED: CSC1-like protein ERD4                  337   3e-107   Populus euphratica
sp|A9LIW2.2|CSC1L_BRAJU  RecName: Full=CSC1-like protein ERD4; Al...    336   5e-107   Brassica juncea [brown mustard]
ref|XP_004485983.1|  PREDICTED: uncharacterized membrane protein ...    336   5e-107   Cicer arietinum [garbanzo]
ref|XP_006415483.1|  hypothetical protein EUTSA_v10006933mg             335   1e-106   Eutrema salsugineum [saltwater cress]
gb|KFK44850.1|  hypothetical protein AALP_AA1G310500                    333   4e-106   Arabis alpina [alpine rockcress]
dbj|BAB63915.1|  ERD4 protein                                           331   5e-106   Arabidopsis thaliana [mouse-ear cress]
emb|CAN64310.1|  hypothetical protein VITISV_037471                     332   5e-106   Vitis vinifera
gb|ABV89627.1|  early-responsive to dehydration 4                       333   7e-106   Brassica rapa
ref|XP_009115162.1|  PREDICTED: CSC1-like protein ERD4                  332   2e-105   Brassica rapa
emb|CDY02286.1|  BnaA09g26160D                                          331   4e-105   
ref|NP_564354.1|  Early-responsive to dehydration stress protein ...    330   6e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907974.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    330   7e-105   
ref|XP_002890865.1|  early-responsive to dehydration 4                  330   1e-104   
ref|XP_010478422.1|  PREDICTED: CSC1-like protein ERD4                  329   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010499567.1|  PREDICTED: CSC1-like protein ERD4                  329   3e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010460826.1|  PREDICTED: CSC1-like protein ERD4 isoform X1       328   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_008371649.1|  PREDICTED: uncharacterized membrane protein ...    328   6e-104   Malus domestica [apple tree]
gb|KHG16289.1|  putative membrane C2G11.09                              323   5e-103   Gossypium arboreum [tree cotton]
ref|XP_009377479.1|  PREDICTED: CSC1-like protein ERD4                  325   1e-102   Pyrus x bretschneideri [bai li]
ref|XP_006306879.1|  hypothetical protein CARUB_v10008433mg             323   5e-102   Capsella rubella
ref|XP_004293515.1|  PREDICTED: CSC1-like protein ERD4                  323   5e-102   Fragaria vesca subsp. vesca
ref|XP_002461460.1|  hypothetical protein SORBIDRAFT_02g003010          320   5e-101   Sorghum bicolor [broomcorn]
ref|XP_006657447.1|  PREDICTED: uncharacterized membrane protein ...    320   7e-101   Oryza brachyantha
ref|NP_001058898.1|  Os07g0150100                                       319   2e-100   
gb|EAZ02783.1|  hypothetical protein OsI_24908                          318   6e-100   Oryza sativa Indica Group [Indian rice]
dbj|BAJ94358.1|  predicted protein                                      308   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001108122.1|  early responsive to dehydration protein            312   6e-98    
gb|EMT14399.1|  Putative membrane protein                               312   7e-98    
ref|XP_003557644.1|  PREDICTED: CSC1-like protein ERD4                  311   1e-97    Brachypodium distachyon [annual false brome]
gb|EAZ38704.1|  hypothetical protein OsJ_23104                          317   2e-96    Oryza sativa Japonica Group [Japonica rice]
gb|KCW75871.1|  hypothetical protein EUGRSUZ_D00260                     307   5e-96    Eucalyptus grandis [rose gum]
gb|EMS45497.1|  Uncharacterized membrane protein C24H6.13               307   7e-96    Triticum urartu
dbj|BAJ93282.1|  predicted protein                                      306   9e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955452.1|  PREDICTED: uncharacterized membrane protein ...    307   1e-95    Setaria italica
gb|AAL47004.1|AF448811_1  unknown                                       289   8e-95    Davidia involucrata
gb|EMS64036.1|  Uncharacterized membrane protein C2G11.09               299   1e-94    Triticum urartu
gb|EMT14905.1|  Putative membrane protein                               298   9e-93    
ref|XP_002990725.1|  hypothetical protein SELMODRAFT_41467              298   1e-92    
gb|AAX92695.1|  early-responsive to dehydration stress protein          285   2e-92    Picea abies
ref|XP_002986705.1|  hypothetical protein SELMODRAFT_41460              297   3e-92    
gb|AGV54580.1|  early-responsive to dehydration 4                       288   1e-89    Phaseolus vulgaris [French bean]
ref|XP_001770612.1|  predicted protein                                  269   3e-81    
gb|AGV54368.1|  early-responsive to dehydration                         262   8e-81    Phaseolus vulgaris [French bean]
ref|XP_001766729.1|  predicted protein                                  266   5e-80    
gb|KHN47349.1|  Putative membrane protein C24H6.13                      262   5e-79    Glycine soja [wild soybean]
ref|XP_001754029.1|  predicted protein                                  259   1e-77    
ref|XP_001762227.1|  predicted protein                                  257   8e-77    
ref|XP_001761096.1|  predicted protein                                  256   2e-76    
ref|XP_001776984.1|  predicted protein                                  254   8e-76    
gb|EYU19152.1|  hypothetical protein MIMGU_mgv1a001965mg                252   8e-76    Erythranthe guttata [common monkey flower]
ref|XP_001766634.1|  predicted protein                                  253   5e-75    
gb|KDO75369.1|  hypothetical protein CISIN_1g004795mg                   244   7e-73    Citrus sinensis [apfelsine]
gb|KJB57182.1|  hypothetical protein B456_009G152500                    238   2e-70    Gossypium raimondii
gb|KJB57184.1|  hypothetical protein B456_009G152500                    238   2e-70    Gossypium raimondii
dbj|BAD94517.1|  ERD4 protein                                           224   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007024954.1|  Early-responsive to dehydration stress prote...    229   3e-67    
gb|AFK47057.1|  unknown                                                 166   7e-48    Medicago truncatula
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             157   6e-41    
gb|AAC79116.1|  hypothetical protein                                    157   1e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             157   3e-40    
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    157   3e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             156   4e-40    Nelumbo nucifera [Indian lotus]
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    155   1e-39    
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             155   1e-39    
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             155   1e-39    
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    155   2e-39    
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             154   3e-39    
gb|KDP46674.1|  hypothetical protein JCGZ_12198                         154   3e-39    Jatropha curcas
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    153   4e-39    Nelumbo nucifera [Indian lotus]
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             153   7e-39    Selaginella moellendorffii
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             152   9e-39    Selaginella moellendorffii
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    151   1e-38    Vitis vinifera
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                    151   1e-38    Arabis alpina [alpine rockcress]
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                    151   1e-38    Arabis alpina [alpine rockcress]
ref|XP_001782141.1|  predicted protein                                  152   1e-38    
ref|XP_001754358.1|  predicted protein                                  151   2e-38    
ref|XP_002519965.1|  Extensin-3 precursor, putative                     152   2e-38    
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    151   2e-38    Fragaria vesca subsp. vesca
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    152   2e-38    Tarenaya hassleriana [spider flower]
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    151   3e-38    Tarenaya hassleriana [spider flower]
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    151   3e-38    Tarenaya hassleriana [spider flower]
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    151   3e-38    Vitis vinifera
emb|CDY17981.1|  BnaC03g30530D                                          150   6e-38    Brassica napus [oilseed rape]
emb|CDX90914.1|  BnaA03g25940D                                          150   6e-38    
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             150   6e-38    Brassica rapa
gb|KHG26829.1|  putative membrane C2G11.09                              150   7e-38    Gossypium arboreum [tree cotton]
gb|KJB51550.1|  hypothetical protein B456_008G222200                    149   1e-37    Gossypium raimondii
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             149   1e-37    Pyrus x bretschneideri [bai li]
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               150   1e-37    Triticum urartu
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    149   1e-37    Pyrus x bretschneideri [bai li]
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            149   1e-37    
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            149   1e-37    Malus domestica [apple tree]
gb|EMT11783.1|  Putative membrane protein                               149   2e-37    
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    149   2e-37    Phoenix dactylifera
gb|KJB51549.1|  hypothetical protein B456_008G222200                    149   2e-37    Gossypium raimondii
emb|CDP11732.1|  unnamed protein product                                149   2e-37    Coffea canephora [robusta coffee]
dbj|BAJ96091.1|  predicted protein                                      149   2e-37    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006854105.1|  hypothetical protein AMTR_s00048p00143150          148   4e-37    Amborella trichopoda
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    147   4e-37    
gb|KHG10946.1|  putative membrane C2G11.09                              147   5e-37    Gossypium arboreum [tree cotton]
emb|CDP03600.1|  unnamed protein product                                147   5e-37    Coffea canephora [robusta coffee]
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    147   7e-37    Nelumbo nucifera [Indian lotus]
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    147   7e-37    Fragaria vesca subsp. vesca
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             147   7e-37    Nelumbo nucifera [Indian lotus]
ref|XP_002529341.1|  conserved hypothetical protein                     147   9e-37    
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             146   1e-36    Nelumbo nucifera [Indian lotus]
ref|XP_006850790.1|  hypothetical protein AMTR_s00025p00102970          146   1e-36    Amborella trichopoda
emb|CDP04437.1|  unnamed protein product                                146   2e-36    Coffea canephora [robusta coffee]
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             145   2e-36    
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             145   3e-36    Vitis vinifera
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    145   3e-36    Camelina sativa [gold-of-pleasure]
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             145   3e-36    Tarenaya hassleriana [spider flower]
gb|KJB10672.1|  hypothetical protein B456_001G215500                    144   3e-36    Gossypium raimondii
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    145   3e-36    
ref|XP_008455928.1|  PREDICTED: uncharacterized membrane protein ...    144   4e-36    Cucumis melo [Oriental melon]
gb|KDP20707.1|  hypothetical protein JCGZ_21178                         144   4e-36    Jatropha curcas
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             145   4e-36    Nicotiana sylvestris
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             145   4e-36    Capsella rubella
gb|KJB42871.1|  hypothetical protein B456_007G171500                    145   4e-36    Gossypium raimondii
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             145   4e-36    Nicotiana tomentosiformis
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    145   4e-36    
ref|XP_008455926.1|  PREDICTED: uncharacterized membrane protein ...    144   5e-36    
gb|KJB42870.1|  hypothetical protein B456_007G171500                    145   5e-36    Gossypium raimondii
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             145   5e-36    
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             145   6e-36    Eucalyptus grandis [rose gum]
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             144   6e-36    Vitis vinifera
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    144   7e-36    
emb|CBI32349.3|  unnamed protein product                                144   7e-36    Vitis vinifera
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             144   8e-36    Prunus persica
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              144   8e-36    
gb|KJB10673.1|  hypothetical protein B456_001G215500                    144   8e-36    Gossypium raimondii
gb|KJB10674.1|  hypothetical protein B456_001G215500                    144   9e-36    Gossypium raimondii
ref|XP_003612662.1|  Membrane protein, putative                         144   9e-36    Medicago truncatula
gb|KHG22816.1|  putative membrane C2G11.09                              143   1e-35    Gossypium arboreum [tree cotton]
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               144   1e-35    Triticum urartu
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    144   1e-35    Cucumis melo [Oriental melon]
gb|AFI41197.1|  dehydration stress protein                              144   1e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004158583.1|  PREDICTED: uncharacterized protein RSN1-like       144   1e-35    
gb|EMT13890.1|  Putative membrane protein                               144   1e-35    
ref|XP_004151944.1|  PREDICTED: uncharacterized protein RSN1-like       144   1e-35    Cucumis sativus [cucumbers]
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    143   2e-35    Fragaria vesca subsp. vesca
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             143   2e-35    Eucalyptus grandis [rose gum]
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             143   2e-35    
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    143   2e-35    Prunus mume [ume]
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    143   2e-35    Fragaria vesca subsp. vesca
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    143   3e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010089460.1|  Uncharacterized membrane protein                   143   3e-35    
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             143   3e-35    Capsella rubella
emb|CDP11354.1|  unnamed protein product                                143   3e-35    Coffea canephora [robusta coffee]
ref|XP_008363487.1|  PREDICTED: uncharacterized protein RSN1-like       141   3e-35    
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    142   3e-35    
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    142   3e-35    Pyrus x bretschneideri [bai li]
gb|AAL07154.1|  unknown protein                                         142   4e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             142   4e-35    Prunus persica
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             142   5e-35    Solanum lycopersicum
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             142   6e-35    Brachypodium distachyon [annual false brome]
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             142   6e-35    Arabidopsis lyrata subsp. lyrata
ref|NP_001055457.1|  Os05g0393800                                       142   7e-35    
ref|XP_010090368.1|  Uncharacterized membrane protein                   142   7e-35    
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    142   8e-35    
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    141   8e-35    Prunus mume [ume]
ref|NP_001056508.1|  Os05g0594700                                       141   9e-35    
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             141   9e-35    Prunus persica
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             142   9e-35    Solanum lycopersicum
ref|XP_004146108.1|  PREDICTED: uncharacterized membrane protein ...    141   1e-34    Cucumis sativus [cucumbers]
ref|XP_010235059.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    140   1e-34    
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       141   1e-34    Solanum tuberosum [potatoes]
emb|CAA18115.1|  putative protein                                       140   1e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301612.2|  early-responsive to dehydration family protein     141   1e-34    
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             141   1e-34    Populus euphratica
ref|XP_002321139.1|  early-responsive to dehydration family protein     141   1e-34    Populus trichocarpa [western balsam poplar]
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    141   1e-34    Brachypodium distachyon [annual false brome]
emb|CDX79125.1|  BnaA01g11920D                                          140   1e-34    
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    140   2e-34    Brachypodium distachyon [annual false brome]
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      141   2e-34    Camelina sativa [gold-of-pleasure]
gb|EEE64912.1|  hypothetical protein OsJ_19772                          141   2e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003616997.1|  Transmembrane protein                              140   2e-34    Medicago truncatula
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             140   2e-34    Populus euphratica
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    140   2e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             141   2e-34    Fragaria vesca subsp. vesca
dbj|BAD93792.1|  hypothetical protein                                   140   2e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518432.1|  conserved hypothetical protein                     140   2e-34    
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            140   3e-34    Cucumis melo [Oriental melon]
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    140   3e-34    
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    140   3e-34    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    140   3e-34    
emb|CDX82907.1|  BnaC01g13570D                                          140   3e-34    
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    140   3e-34    
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    140   3e-34    Camelina sativa [gold-of-pleasure]
ref|XP_006469645.1|  PREDICTED: uncharacterized membrane protein ...    138   3e-34    
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                140   3e-34    Erythranthe guttata [common monkey flower]
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             140   4e-34    
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             140   4e-34    Capsella rubella
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             140   4e-34    Phaseolus vulgaris [French bean]
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             139   4e-34    Nicotiana tomentosiformis
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             139   4e-34    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP11733.1|  unnamed protein product                                140   4e-34    Coffea canephora [robusta coffee]
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    139   4e-34    
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    139   5e-34    Camelina sativa [gold-of-pleasure]
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    139   5e-34    Camelina sativa [gold-of-pleasure]
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             139   5e-34    Camelina sativa [gold-of-pleasure]
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    139   5e-34    Camelina sativa [gold-of-pleasure]
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             139   5e-34    Populus euphratica
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    139   5e-34    Camelina sativa [gold-of-pleasure]
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            139   5e-34    
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             139   5e-34    Camelina sativa [gold-of-pleasure]
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             139   5e-34    Nicotiana sylvestris
ref|XP_004164564.1|  PREDICTED: uncharacterized membrane protein ...    139   5e-34    
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             139   5e-34    Camelina sativa [gold-of-pleasure]
ref|XP_004136187.1|  PREDICTED: uncharacterized membrane protein ...    139   5e-34    Cucumis sativus [cucumbers]
dbj|BAK05559.1|  predicted protein                                      139   6e-34    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP30779.1|  hypothetical protein JCGZ_13722                         139   7e-34    Jatropha curcas
emb|CDY22920.1|  BnaA01g18580D                                          139   8e-34    Brassica napus [oilseed rape]
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             139   8e-34    Pyrus x bretschneideri [bai li]
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    139   8e-34    Fragaria vesca subsp. vesca
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   139   8e-34    Citrus sinensis [apfelsine]
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    139   9e-34    Oryza brachyantha
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    139   9e-34    Glycine max [soybeans]
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    139   9e-34    Cicer arietinum [garbanzo]
ref|XP_009601393.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    137   9e-34    Nicotiana tomentosiformis
gb|KHN38468.1|  Putative membrane protein C2G11.09                      139   9e-34    Glycine soja [wild soybean]
gb|KCW77011.1|  hypothetical protein EUGRSUZ_D01358                     137   9e-34    Eucalyptus grandis [rose gum]
ref|XP_006843810.1|  hypothetical protein AMTR_s00007p00254340          139   9e-34    
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             139   1e-33    
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             139   1e-33    
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    138   1e-33    
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   1e-33    
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    138   1e-33    
emb|CDX98089.1|  BnaA06g08400D                                          138   1e-33    
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    138   1e-33    
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             138   1e-33    
ref|NP_001065504.1|  Os10g0579100                                       139   1e-33    
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             139   1e-33    
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             138   1e-33    
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    138   1e-33    
gb|EAY79648.1|  hypothetical protein OsI_34792                          138   1e-33    
emb|CDY49293.1|  BnaC01g22480D                                          138   1e-33    
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    138   1e-33    
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             138   1e-33    
emb|CDY29933.1|  BnaC05g29030D                                          138   1e-33    
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    137   1e-33    
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    137   1e-33    
emb|CDY35541.1|  BnaA05g16450D                                          138   1e-33    
emb|CDY30043.1|  BnaC05g09770D                                          138   1e-33    
gb|AFW81357.1|  HYP1 isoform 1                                          138   1e-33    
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    138   1e-33    
ref|NP_001147493.1|  LOC100281102                                       138   2e-33    
ref|XP_008360740.1|  PREDICTED: uncharacterized protein RSN1-like       133   2e-33    
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    138   2e-33    
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             138   2e-33    
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    137   2e-33    
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    137   2e-33    
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          137   2e-33    
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       137   2e-33    
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    137   2e-33    
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             137   2e-33    
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    137   2e-33    
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    137   2e-33    
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    137   2e-33    
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    137   2e-33    
ref|XP_006368323.1|  early-responsive to dehydration family protein     137   2e-33    
gb|KJB42062.1|  hypothetical protein B456_007G134700                    137   3e-33    
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    137   3e-33    
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       137   3e-33    
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    137   3e-33    
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    137   3e-33    
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    139   3e-33    
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          137   3e-33    
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             137   3e-33    
gb|KJB42060.1|  hypothetical protein B456_007G134700                    137   3e-33    
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             137   4e-33    
ref|XP_010099166.1|  Uncharacterized membrane protein                   137   4e-33    
emb|CDY32438.1|  BnaC03g42220D                                          137   4e-33    
gb|KJB42059.1|  hypothetical protein B456_007G134700                    137   4e-33    
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             137   4e-33    
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          137   4e-33    
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             137   4e-33    
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             137   4e-33    
gb|EPS60017.1|  hypothetical protein M569_14787                         137   4e-33    
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    137   5e-33    
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             136   5e-33    
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    136   5e-33    
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            136   5e-33    
dbj|BAF98597.1|  CM0545.360.nc                                          136   6e-33    
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    136   6e-33    
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             136   6e-33    
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    136   6e-33    
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    136   7e-33    
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    136   8e-33    
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    136   8e-33    
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             136   8e-33    
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    136   8e-33    
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             136   8e-33    
gb|KHN19872.1|  Putative membrane protein C2G11.09                      135   9e-33    
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             135   9e-33    
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             136   9e-33    
emb|CDY09064.1|  BnaC08g10180D                                          135   9e-33    
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    135   1e-32    
ref|XP_004145433.1|  PREDICTED: uncharacterized membrane protein ...    135   1e-32    
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    135   1e-32    
ref|XP_004166876.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    135   1e-32    
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    135   1e-32    
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    135   1e-32    
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             135   1e-32    
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             135   1e-32    
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             135   1e-32    
emb|CDY21297.1|  BnaC03g29810D                                          135   1e-32    
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             135   1e-32    
emb|CDX76386.1|  BnaA08g10140D                                          135   1e-32    
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    135   1e-32    
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    135   1e-32    
ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    135   1e-32    
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    135   2e-32    
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    135   2e-32    
gb|EPS61105.1|  hypothetical protein M569_13694                         133   2e-32    
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    135   2e-32    
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          135   2e-32    
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    134   2e-32    
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    135   2e-32    
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    135   2e-32    
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          135   2e-32    
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    134   2e-32    
emb|CDY27443.1|  BnaC03g64830D                                          134   2e-32    
dbj|BAD94445.1|  hypothetical protein                                   134   3e-32    
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             134   3e-32    
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             134   3e-32    
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             134   3e-32    
gb|KHG30770.1|  putative membrane C2G11.09                              134   3e-32    
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             134   3e-32    
ref|XP_011046982.1|  PREDICTED: calcium permeable stress-gated ca...    134   3e-32    
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                134   3e-32    
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    134   3e-32    
dbj|BAK03311.1|  predicted protein                                      134   3e-32    
emb|CDX90856.1|  BnaA03g25360D                                          134   3e-32    
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    134   3e-32    
ref|XP_006447608.1|  hypothetical protein CICLE_v10014696mg             132   3e-32    
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             134   3e-32    
gb|KJB69238.1|  hypothetical protein B456_011G012200                    133   3e-32    
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             134   3e-32    
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    134   3e-32    
gb|KHG01808.1|  putative membrane C2G11.09                              134   4e-32    
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             134   4e-32    
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             134   4e-32    
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             134   4e-32    
emb|CDY48898.1|  BnaA03g36370D                                          134   4e-32    
gb|KDO39720.1|  hypothetical protein CISIN_1g048588mg                   132   4e-32    
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    134   5e-32    
gb|KJB57786.1|  hypothetical protein B456_009G181100                    134   5e-32    
emb|CDY32032.1|  BnaA03g60360D                                          134   6e-32    
gb|KJB69239.1|  hypothetical protein B456_011G012200                    133   6e-32    
gb|KJB69236.1|  hypothetical protein B456_011G012200                    133   7e-32    
gb|EMS56194.1|  Uncharacterized membrane protein C2G11.09               132   7e-32    
ref|NP_001043256.1|  Os01g0534900                                       133   7e-32    
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    133   7e-32    
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             133   7e-32    
ref|NP_172660.5|  putative ERD4 protein                                 133   7e-32    
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    133   7e-32    
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    133   8e-32    
ref|XP_006383870.1|  early-responsive to dehydration family protein     133   8e-32    
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            133   8e-32    
gb|KJB69243.1|  hypothetical protein B456_011G012200                    133   8e-32    
gb|KHN28986.1|  Putative membrane protein C2G11.09                      133   9e-32    
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             133   1e-31    
gb|EAY97938.1|  hypothetical protein OsI_19855                          133   1e-31    
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      133   1e-31    
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    133   1e-31    
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    132   1e-31    
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    132   1e-31    
emb|CDM81261.1|  unnamed protein product                                132   1e-31    
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             132   2e-31    
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    132   2e-31    
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             132   2e-31    
gb|EMT22148.1|  Putative membrane protein                               132   2e-31    
gb|EMT27455.1|  Putative membrane protein                               132   2e-31    
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             132   2e-31    
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    132   2e-31    
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             132   2e-31    
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    132   3e-31    
gb|KJB22580.1|  hypothetical protein B456_004G055300                    129   3e-31    
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    131   4e-31    
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    131   4e-31    
ref|XP_001770572.1|  predicted protein                                  130   5e-31    
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    130   6e-31    
gb|KJB22581.1|  hypothetical protein B456_004G055300                    129   6e-31    
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    130   6e-31    
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    130   6e-31    
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             130   6e-31    
emb|CDY19541.1|  BnaC09g13620D                                          130   6e-31    
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             130   6e-31    
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             130   6e-31    
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             130   6e-31    
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       130   7e-31    
ref|XP_003610472.1|  Membrane protein, putative                         130   8e-31    
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             130   1e-30    
emb|CDY12941.1|  BnaA09g13330D                                          130   1e-30    
gb|EJK68950.1|  hypothetical protein THAOC_09832                        130   1e-30    
ref|XP_002886475.1|  F24O1.4                                            129   2e-30    
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                129   2e-30    
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    129   3e-30    
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    128   3e-30    
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             128   4e-30    
gb|KHG17938.1|  putative membrane C2G11.09                              128   4e-30    
gb|KHN40403.1|  Putative membrane protein C2G11.09                      129   4e-30    
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       129   4e-30    
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    128   4e-30    
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    128   5e-30    
gb|EPS60193.1|  hypothetical protein M569_14609                         128   5e-30    
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    129   5e-30    
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                128   5e-30    
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    128   5e-30    
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g             127   5e-30    
gb|KDP21496.1|  hypothetical protein JCGZ_21967                         128   5e-30    
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    128   6e-30    
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    127   6e-30    
ref|XP_006348154.1|  PREDICTED: uncharacterized protein RSN1-like...    127   7e-30    
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    127   8e-30    
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    127   8e-30    
gb|EPS71707.1|  hypothetical protein M569_03051                         127   8e-30    
ref|XP_010231849.1|  PREDICTED: calcium permeable stress-gated ca...    127   9e-30    
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    127   1e-29    
gb|AAK68752.1|  Unknown protein                                         125   1e-29    
ref|XP_002291604.1|  predicted protein                                  127   1e-29    
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             126   2e-29    
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             126   2e-29    
ref|XP_006414510.1|  hypothetical protein EUTSA_v10024504mg             125   3e-29    
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    125   3e-29    
gb|EPB84814.1|  hypothetical protein HMPREF1544_08457                   126   3e-29    
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    125   4e-29    
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             125   4e-29    
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    125   4e-29    
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             125   5e-29    
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    125   7e-29    
ref|XP_001764420.1|  predicted protein                                  124   8e-29    
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                124   8e-29    
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               124   8e-29    
ref|XP_010110412.1|  Uncharacterized protein RSN1                       121   9e-29    
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    124   1e-28    
gb|EMT23208.1|  Putative membrane protein                               124   1e-28    
emb|CAB10322.1|  hypothetical protein                                   123   2e-28    
dbj|GAN00609.1|  DUF221-domain-containing protein                       124   2e-28    
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             124   2e-28    
gb|KDP27183.1|  hypothetical protein JCGZ_19882                         123   2e-28    
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                123   2e-28    



>ref|XP_004244862.1| PREDICTED: CSC1-like protein ERD4 [Solanum lycopersicum]
Length=723

 Score =   373 bits (957),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 207/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESH  RAASGKYFYFTVLNVFIGVT+G TLF + KSIE +PNSI  +LA S
Sbjct  438  LSKAEGIPSESHVTRAASGKYFYFTVLNVFIGVTLGGTLFTSFKSIEHDPNSIFRVLAKS  497

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAPGDLGYAT
Sbjct  498  LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPGDLGYAT  557

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFP DML++ I LCYSVIAPIIIPFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH++
Sbjct  558  RFPNDMLIMTIVLCYSVIAPIIIPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIY  617

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++A LILYQ+TM+GYFGVKKF   P++ PLPI+S +FAF+C KKF R
Sbjct  618  TRMIATLILYQVTMLGYFGVKKFKPTPVLFPLPIISLIFAFICQKKFRR  666



>ref|XP_009611468.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Nicotiana tomentosiformis]
Length=691

 Score =   369 bits (948),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESH  RAASGKYFYF+VLNVFIGVT+G TLF + KSIE++PNSI  +LA S
Sbjct  406  LSKAEGIPSESHVTRAASGKYFYFSVLNVFIGVTLGGTLFSSFKSIENDPNSIFRVLAES  465

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CK +AEIKEAWAPGDLGYAT
Sbjct  466  LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKIEAEIKEAWAPGDLGYAT  525

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFP DML++ I LCYSVIAPII+PFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH+H
Sbjct  526  RFPSDMLIMTIVLCYSVIAPIILPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIH  585

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++A LILYQ+TM GYFGVKKF   P++ PLPI S +FAF+C KKF R
Sbjct  586  TRMLATLILYQVTMCGYFGVKKFAPTPVLFPLPIFSLIFAFICQKKFRR  634



>ref|XP_006364887.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Solanum 
tuberosum]
Length=723

 Score =   370 bits (949),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHA RAASGKYFYFTVLNVFIG+T+G TLF + KSIE +PNSI  +LA S
Sbjct  438  LSKAEGIPSESHATRAASGKYFYFTVLNVFIGITLGGTLFTSFKSIEHDPNSIFGVLAKS  497

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAP DLGYAT
Sbjct  498  LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPDDLGYAT  557

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFP DML++ I LCYSVIAPIIIPFG  YFGLGWLLLRNQALKVYVPSFESYG+MWPH++
Sbjct  558  RFPNDMLIMTIVLCYSVIAPIIIPFGVAYFGLGWLLLRNQALKVYVPSFESYGRMWPHIY  617

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++A LILYQ+TM+GYFGVKKF   P++ PLPI+S +FAF+C KKF R
Sbjct  618  TRMIATLILYQVTMLGYFGVKKFKPTPVLFPLPIISLIFAFICQKKFRR  666



>ref|XP_009611467.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Nicotiana tomentosiformis]
Length=723

 Score =   369 bits (947),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESH  RAASGKYFYF+VLNVFIGVT+G TLF + KSIE++PNSI  +LA S
Sbjct  438  LSKAEGIPSESHVTRAASGKYFYFSVLNVFIGVTLGGTLFSSFKSIENDPNSIFRVLAES  497

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CK +AEIKEAWAPGDLGYAT
Sbjct  498  LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKIEAEIKEAWAPGDLGYAT  557

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFP DML++ I LCYSVIAPII+PFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH+H
Sbjct  558  RFPSDMLIMTIVLCYSVIAPIILPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIH  617

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++A LILYQ+TM GYFGVKKF   P++ PLPI S +FAF+C KKF R
Sbjct  618  TRMLATLILYQVTMCGYFGVKKFAPTPVLFPLPIFSLIFAFICQKKFRR  666



>ref|XP_010245168.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
Length=724

 Score =   369 bits (946),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 212/229 (93%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVT+G TLF T K IE +PN+I+SLL T 
Sbjct  438  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTVGGTLFQTFKDIEKHPNNIVSLLGTG  497

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSR+VPL+++HLK++++CKT+AE+KEAWAPGDLGYAT
Sbjct  498  LPGNATFFLTFVALKFFVGYGLELSRLVPLVMYHLKRRFLCKTEAELKEAWAPGDLGYAT  557

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++II LCYSVIAPIIIPFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  558  RVPSDMLIIIIVLCYSVIAPIIIPFGVLYFGLGWLILRNQALKVYVPSYESYGRMWPHVH  617

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            +R++AALI+YQ+TM+GYF VKKF Y P++IPLP+LS +F FVCSKKFY+
Sbjct  618  SRILAALIIYQITMLGYFAVKKFFYTPILIPLPVLSLMFGFVCSKKFYK  666



>ref|XP_007024953.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
 gb|EOY27575.1| Early-responsive to dehydration stress protein (ERD4) isoform 
1 [Theobroma cacao]
Length=724

 Score =   368 bits (944),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SH VRAASGKYFYFTV NVFIGVT+G+TLF T KSIE +PNSI  LLA S
Sbjct  440  LSKTEGIPSGSHVVRAASGKYFYFTVFNVFIGVTVGATLFSTFKSIEKDPNSIFDLLAKS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGYAT
Sbjct  500  LPGSATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYAT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFPGDML+L I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVP++ESYGKMWPHMH
Sbjct  560  RFPGDMLILTIVLCYSVIAPVIIPFGVLYFALGWLILRNQALKVYVPAYESYGKMWPHMH  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TRV+ AL+LYQ TM+GYFGV KF Y P++IPLPILS +FA+VC +KFY+
Sbjct  620  TRVIGALLLYQATMLGYFGVMKFYYTPILIPLPILSLIFAYVCRQKFYK  668



>ref|XP_009781612.1| PREDICTED: CSC1-like protein ERD4 [Nicotiana sylvestris]
Length=723

 Score =   363 bits (931),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESH  RAASGKYFYF+VLNVFIGVT+  TL    KSIE +PNSI  +LA S
Sbjct  438  LSKAEGIPSESHVTRAASGKYFYFSVLNVFIGVTLAGTLLGAFKSIEKDPNSIFRVLAES  497

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAPGDLGYAT
Sbjct  498  LPQNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPGDLGYAT  557

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFP DML++ I LCYSVIAPII+PFG VYFGLGWLLLRNQALKVYVPSFESYG+MWPH+H
Sbjct  558  RFPSDMLIMTIVLCYSVIAPIILPFGVVYFGLGWLLLRNQALKVYVPSFESYGRMWPHIH  617

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++A LILYQ+TM GYFG+K F   P++ PLPI S +FAF+C KKF R
Sbjct  618  TRMLATLILYQVTMCGYFGIKTFAPTPVLFPLPIFSLIFAFICQKKFRR  666



>emb|CBI30957.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   361 bits (927),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS+SHAVRAASGKYFYFT+LNVFIGVT+G TLFDT K+IED P  ++S+LA SL
Sbjct  397  SKAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGGTLFDTFKTIEDQPKELVSILAKSL  456

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            PS+ATFFLTFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+KEAWAPGDLGY +R
Sbjct  457  PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR  516

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGD+L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQALKVYVPS+ES G+MWPH+H 
Sbjct  517  VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV  576

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R++ AL+LYQ+TM+GYFGVK+F Y P VI L ILS +F FVC KKFYR
Sbjct  577  RLIGALLLYQVTMLGYFGVKEFRYTPFVIVLLILSLIFIFVCQKKFYR  624



>ref|XP_010687100.1| PREDICTED: CSC1-like protein ERD4 [Beta vulgaris subsp. vulgaris]
Length=709

 Score =   361 bits (926),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESHAVRAASGKYFYFTVLN F+GVT+G TLF   K +E +PN I+++L   
Sbjct  436  LSKEEGIPSESHAVRAASGKYFYFTVLNAFLGVTLGGTLFGNFKEMEKDPNKIVNILGKD  495

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSR+VPLI+FH+KKKY+CKT+A++KEAWAPGD GYAT
Sbjct  496  LPDNATFFLTFVALKFFVGYGLELSRLVPLIMFHVKKKYLCKTEAQVKEAWAPGDFGYAT  555

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P D+L+L I +CYS+IAP+I+PFGA+YFGLGWL++RNQALKVYVPSFESYG+MWPH+H
Sbjct  556  RVPSDLLILTITICYSIIAPLILPFGAIYFGLGWLVMRNQALKVYVPSFESYGRMWPHLH  615

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR VAAL+LYQ+TMIGYFGVK+F Y  L+IPLPI+S +FA+VCSKKFYR
Sbjct  616  TRFVAALVLYQVTMIGYFGVKQFIYGVLLIPLPIISLIFAWVCSKKFYR  664



>ref|XP_002280109.1| PREDICTED: CSC1-like protein ERD4 [Vitis vinifera]
Length=724

 Score =   361 bits (927),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 205/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS+SHAVRAASGKYFYFT+LNVFIGVT+G TLFDT K+IED P  ++S+LA SL
Sbjct  442  SKAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGGTLFDTFKTIEDQPKELVSILAKSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            PS+ATFFLTFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+KEAWAPGDLGY +R
Sbjct  502  PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGD+L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQALKVYVPS+ES G+MWPH+H 
Sbjct  562  VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R++ AL+LYQ+TM+GYFGVK+F Y P VI L ILS +F FVC KKFYR
Sbjct  622  RLIGALLLYQVTMLGYFGVKEFRYTPFVIVLLILSLIFIFVCQKKFYR  669



>ref|XP_007211358.1| hypothetical protein PRUPE_ppa002050mg [Prunus persica]
 gb|EMJ12557.1| hypothetical protein PRUPE_ppa002050mg [Prunus persica]
Length=724

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+GVTIG TLF T K+IE++PNSII+LLATS
Sbjct  440  LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGVTIGGTLFSTFKTIENDPNSIITLLATS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +AT+FLTFVALKFFVGYGLELSRIVPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500  LPGNATYFLTFVALKFFVGYGLELSRIVPLIIFHIKRKYLCKTEAELKAAWLPSDLGYGT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML++ I LCYSVIAP+I+PFG +YFG+GWL+LRNQALKVYVP++ESYG+MWPHMH
Sbjct  560  RVPGDMLIITIVLCYSVIAPLIVPFGVLYFGIGWLVLRNQALKVYVPAYESYGRMWPHMH  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             RV+AALILYQ+TM GYFGVKKF +AP +I LPILS LF F+C KKFYR
Sbjct  620  VRVLAALILYQVTMFGYFGVKKFVFAPFLIVLPILSLLFGFICRKKFYR  668



>ref|XP_010540605.1| PREDICTED: CSC1-like protein ERD4 [Tarenaya hassleriana]
Length=718

 Score =   359 bits (921),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 183/228 (80%), Positives = 206/228 (90%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHA RAASGKYFYF+VLNVFIGVTI  TLFDTLK +E NPNSIIS+LATS
Sbjct  433  LSKAEGIPSESHAQRAASGKYFYFSVLNVFIGVTISGTLFDTLKKVEKNPNSIISILATS  492

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLT+VALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+K+AW PGDL YAT
Sbjct  493  LPRSATFFLTYVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEVKDAWFPGDLSYAT  552

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDMLVL I  CYSVIAP+IIPFG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  553  RVPGDMLVLTITFCYSVIAPLIIPFGVTYFGLGWLILRNQALKVYVPSYESYGQMWPHIH  612

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL+L+Q+TM GY G K F YA LVIPL +++ +FA+VCSKKFY
Sbjct  613  TRILAALLLFQVTMFGYLGAKIFVYAVLVIPLIVITLIFAYVCSKKFY  660



>ref|XP_010086875.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB24359.1| Uncharacterized membrane protein [Morus notabilis]
Length=658

 Score =   357 bits (917),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHAVRAASGKYFYF+VLNVFIGVT+  TLF T KSI+  P S + +LA S
Sbjct  374  LSKAEGIPSESHAVRAASGKYFYFSVLNVFIGVTVAGTLFSTFKSIQKEPKSAVDILANS  433

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            +P +A FFLTFVALKFFVGYGLELSRIVPLIIFH+K+KY+CKT+ E+K+AW PG LGY T
Sbjct  434  IPENAAFFLTFVALKFFVGYGLELSRIVPLIIFHIKRKYLCKTEEEVKDAWTPGALGYGT  493

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML++ I LCYSVIAP++IPFG  YFGLGWL+LRNQAL VYVPS+ESYG++WPH+H
Sbjct  494  RIPGDMLIITIVLCYSVIAPLVIPFGVAYFGLGWLILRNQALNVYVPSYESYGRLWPHIH  553

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R++AALILYQ+TM GY GVKKF Y+P++I LPILS +FAF+C+KKFYR
Sbjct  554  VRIIAALILYQVTMFGYLGVKKFYYSPILISLPILSLIFAFICNKKFYR  602



>ref|XP_008225537.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=724

 Score =   358 bits (918),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+GVTIG TL+ T K+IE +PNSI++LLATS
Sbjct  440  LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGVTIGGTLYSTFKTIEKDPNSIVTLLATS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LPS+AT+FLTFVALKFFVGYGLELSRIVPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500  LPSNATYFLTFVALKFFVGYGLELSRIVPLIIFHIKRKYLCKTEAELKAAWLPSDLGYGT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML++ I LCYSVIAP+I+PFG +YFG+GWL+LRNQALKVYVP++ESYG+MWPHMH
Sbjct  560  RVPGDMLIITIVLCYSVIAPLIVPFGVLYFGIGWLVLRNQALKVYVPAYESYGRMWPHMH  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             RV+A+LILYQ+TM GYFGVKKF +AP +I LPILS LF F+C KKFYR
Sbjct  620  VRVLASLILYQVTMFGYFGVKKFVFAPFLIVLPILSLLFGFICRKKFYR  668



>ref|XP_009362276.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=724

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+GVT+G TLF T K+IE +PNS++ +LA+S
Sbjct  440  LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGVTVGGTLFSTFKTIEKDPNSLVDILASS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP++AT+FLTFVALKFFVGYGLELSR+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500  LPANATYFLTFVALKFFVGYGLELSRLVPLIIFHIKRKYLCKTEAEVKAAWLPSDLGYGT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P D+L++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVY+P++ESYG+MWPHM 
Sbjct  560  RVPSDLLIITIVLCYSVIAPLILPFGVLYFGLGWLILRNQALKVYIPAYESYGRMWPHMQ  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R++A+LILYQ+TM GYFGVK+F YAP +IPLPI+S LF+F+CSKKFYR
Sbjct  620  IRIIASLILYQVTMFGYFGVKRFYYAPFLIPLPIMSLLFSFICSKKFYR  668



>ref|XP_010275905.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
 ref|XP_010275906.1| PREDICTED: CSC1-like protein ERD4 [Nelumbo nucifera]
Length=722

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHAVRAASGKYF FTVLNVFIGVT+G TLF   +++E +PNSI ++L   
Sbjct  436  LSKAEGIPSESHAVRAASGKYFCFTVLNVFIGVTVGGTLFSASETLEKDPNSIANMLGVG  495

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSR+VPLII++LK+K++CKT+AE KEAWAPGDLGYAT
Sbjct  496  LPRNATFFLTFVALKFFVGYGLELSRLVPLIIYYLKRKFLCKTEAEFKEAWAPGDLGYAT  555

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I +CYSVI PIIIPFG  YF LGWL++RNQALKVYVPS+ESYG+MWPHMH
Sbjct  556  RVPNDMLIITIVICYSVITPIIIPFGMAYFSLGWLIVRNQALKVYVPSYESYGRMWPHMH  615

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            +R++AALI+YQ+TM+GYFGVK FP+ PL+IPLP+LS +FAFVCSKKFY+
Sbjct  616  SRILAALIVYQITMLGYFGVKIFPFTPLLIPLPVLSLVFAFVCSKKFYK  664



>ref|XP_008371799.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=724

 Score =   356 bits (914),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS+SHA+RAASGKYFYFT+ NVF+G+T+G TLF T K+IE +PNS++ +LA+S
Sbjct  440  LSKAEGIPSQSHAIRAASGKYFYFTIFNVFLGITVGGTLFSTFKTIEKDPNSLVDILASS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LPS+AT+FLTFVALKFFVGYGLELSR+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500  LPSNATYFLTFVALKFFVGYGLELSRLVPLIIFHIKRKYLCKTEAEVKAAWLPSDLGYGT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P D+LV+ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVY+P++ESYG+MWPHM 
Sbjct  560  RVPNDLLVITIVLCYSVIAPLILPFGVLYFGLGWLILRNQALKVYIPAYESYGRMWPHMQ  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R++A+LILYQ+TM GYFGVK+F YAP +IPLPI+S +F+F+CSKKFYR
Sbjct  620  IRIIASLILYQVTMFGYFGVKRFYYAPFLIPLPIMSLIFSFICSKKFYR  668



>ref|XP_011096640.1| PREDICTED: CSC1-like protein ERD4 [Sesamum indicum]
Length=718

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGI SESHA RAASGKYFYF+VLNVFIGVTIG+TLF TLK IE +PNS++ LLA S
Sbjct  440  LSKAEGIASESHAQRAASGKYFYFSVLNVFIGVTIGNTLFTTLKRIEKDPNSLVPLLAES  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAWAPGDLGYAT
Sbjct  500  LPGSATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEVKEAWAPGDLGYAT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I +CYSVIAP+IIPFG +Y+GLGWL+LRNQ LKVYVPS+ESYG++WPH++
Sbjct  560  RIPADMLILTIVICYSVIAPLIIPFGIIYYGLGWLVLRNQVLKVYVPSYESYGRIWPHIY  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R++A+LILYQ TM+GYF  K+F Y P++IPL +LSF+F  VC KKFYR
Sbjct  620  VRIMASLILYQATMLGYFSAKEFIYTPVLIPLIVLSFIFVLVCRKKFYR  668



>gb|KDP38019.1| hypothetical protein JCGZ_04662 [Jatropha curcas]
Length=724

 Score =   354 bits (909),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHA+RAASGKYFYFTV NVFIGVT+G TLF T K I+ +P S++++LA S
Sbjct  439  LSKAEGIPSESHAIRAASGKYFYFTVFNVFIGVTLGGTLFSTFKQIQKDPGSLVTVLADS  498

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E+KEAWAPGDLGYAT
Sbjct  499  LPGNATFFLTYVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDELKEAWAPGDLGYAT  558

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I  CYSVIAP+IIPFG VYFGLGWL+LRNQALKV+VPSFESYG+MWPH+H
Sbjct  559  RIPSDMLIITIVYCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVFVPSFESYGRMWPHIH  618

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             RV+A+L+L+Q+T  GY GVKKF YAP +IPLPI+S +F FVC KKFYR
Sbjct  619  MRVLASLLLFQVTTFGYMGVKKFYYAPFLIPLPIISLIFFFVCKKKFYR  667



>ref|XP_002531053.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31314.1| conserved hypothetical protein [Ricinus communis]
Length=641

 Score =   351 bits (901),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 170/229 (74%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SHAVRA SGKYFYFTVLNVF+GVT+  TLF   K I+ +PNS ++LLA  
Sbjct  357  LSKLEGIPSVSHAVRATSGKYFYFTVLNVFLGVTLSGTLFSAFKKIQKDPNSTVTLLADG  416

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CKT+ E+KEAW PGD GYAT
Sbjct  417  LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTEDELKEAWKPGDFGYAT  476

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML++ I LCYS+IAP+IIPFG VYFGLGWL+LRNQALKV+VPSFESYG+MWPH+H
Sbjct  477  RVPGDMLIITIVLCYSIIAPLIIPFGVVYFGLGWLVLRNQALKVFVPSFESYGRMWPHIH  536

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++A+L+L+Q+TM GYFGVKKF +AP ++PLPI++ +F FVC KKFYR
Sbjct  537  TRILASLLLFQVTMFGYFGVKKFVFAPFLLPLPIITLIFVFVCRKKFYR  585



>gb|KCW75872.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
 gb|KCW75873.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
Length=718

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 203/225 (90%), Gaps = 0/225 (0%)
 Frame = -3

Query  676  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  497
            EGIPS+SH  RAASGKYFYFTVLNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  445  EGIPSQSHIERAASGKYFYFTVLNVFIGVTVGGTLFATFKEIEKDPNSLLTVLAASLPGN  504

Query  496  aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  317
            ATFFLT+VAL+FFVGYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGDL YATR PG
Sbjct  505  ATFFLTYVALQFFVGYGLELSRIVPLIIFHLKRKYLCKTEAEVKEAWFPGDLKYATRVPG  564

Query  316  DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  137
            DML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H R++
Sbjct  565  DMLIVTITLCYSVIAPLIIPFGVVYFGLGWLILRNQALKVYVPSYESYGRMWPHIHLRIL  624

Query  136  AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            A+L+LYQLTM+ YFG KKF YAPL++PL I S +FA+VC+KKFYR
Sbjct  625  ASLVLYQLTMLAYFGTKKFYYAPLLLPLVISSLIFAYVCNKKFYR  669



>ref|XP_010052016.1| PREDICTED: CSC1-like protein ERD4 [Eucalyptus grandis]
Length=725

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 202/225 (90%), Gaps = 0/225 (0%)
 Frame = -3

Query  676  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  497
            EGIPS+SH  RAASGKYFYFTVLNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  445  EGIPSQSHIERAASGKYFYFTVLNVFIGVTVGGTLFATFKEIEKDPNSLLTVLAASLPGN  504

Query  496  aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  317
            ATFFLT+VAL+FFVGYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGDL YATR PG
Sbjct  505  ATFFLTYVALQFFVGYGLELSRIVPLIIFHLKRKYLCKTEAEVKEAWFPGDLKYATRVPG  564

Query  316  DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  137
            DML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVYVPS+ESYG+MWPHMH R++
Sbjct  565  DMLIVTITLCYSVIAPLIIPFGVVYFGLGWLILRNQALKVYVPSYESYGRMWPHMHLRIL  624

Query  136  AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            AAL+LYQLTM+ YFG KKF +AP ++PL I S +FA+VC+KKFYR
Sbjct  625  AALVLYQLTMLAYFGAKKFVFAPFLVPLIISSLIFAYVCNKKFYR  669



>ref|XP_003593877.1| Early-responsive to dehydration [Medicago truncatula]
 gb|AES64128.1| early-responsive to dehydration stress protein (ERD4) [Medicago 
truncatula]
Length=722

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIP+ESHA RAASGKYFYFTVLNVFIGVT+  TLFDT K I++ P  I+ +LA S
Sbjct  438  LSKLEGIPTESHAARAASGKYFYFTVLNVFIGVTLSGTLFDTFKRIQNKPKDIVPVLAES  497

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP  ATFFLTFVALKFFVGYGLELSR+VPLII++LKKK++CKT+AE+KEAWAPGDLGYAT
Sbjct  498  LPGRATFFLTFVALKFFVGYGLELSRLVPLIIYNLKKKFLCKTEAELKEAWAPGDLGYAT  557

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYS IAP+IIPFGA+YFGLGWL+LRNQALKVYVP +ESYG+MWPH++
Sbjct  558  RIPADMLIVTIVLCYSCIAPLIIPFGALYFGLGWLVLRNQALKVYVPRYESYGRMWPHIN  617

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
             R++A+++LYQ+TM GYFGV++F YAPL+IPLPIL+ LF F+CSKKFY
Sbjct  618  NRILASMVLYQVTMFGYFGVQQFVYAPLLIPLPILTVLFGFICSKKFY  665



>gb|KHN06954.1| Putative membrane protein C24H6.13 [Glycine soja]
Length=723

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 203/229 (89%), Gaps = 2/229 (1%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  512
            SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  439  SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  498

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  499  SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  558

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQALKVYVP+FESYG+MWPH+
Sbjct  559  TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQALKVYVPTFESYGRMWPHI  618

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            H R++A+LILYQ+TM GYFG +KF Y PLV+PLPILS +F FVC+KKFY
Sbjct  619  HNRILASLILYQITMFGYFGTQKFYYTPLVLPLPILSLIFGFVCAKKFY  667



>ref|XP_003542948.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=724

 Score =   352 bits (904),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 203/229 (89%), Gaps = 2/229 (1%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  512
            SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  440  SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  499

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  500  SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  559

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQALKVYVP+FESYG+MWPH+
Sbjct  560  TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQALKVYVPTFESYGRMWPHI  619

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            H R++A+LILYQ+TM GYFG +KF Y PLV+PLPILS +F FVC+KKFY
Sbjct  620  HNRILASLILYQITMFGYFGTQKFYYTPLVLPLPILSLIFGFVCAKKFY  668



>ref|XP_003546071.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Glycine 
max]
Length=723

 Score =   352 bits (904),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 203/229 (89%), Gaps = 2/229 (1%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  512
            SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  439  SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  498

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  499  SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  558

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQALKVYVP+FESYG+MWPH+
Sbjct  559  TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQALKVYVPTFESYGRMWPHI  618

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            H R++A+LILYQ+TM GYFG +KF Y PLV+PLPILS +F FVC+KKFY
Sbjct  619  HNRILASLILYQITMFGYFGTQKFYYTPLVLPLPILSLVFGFVCAKKFY  667



>gb|KJB66976.1| hypothetical protein B456_010G168400 [Gossypium raimondii]
Length=725

 Score =   352 bits (903),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SH +RAASGKYFYF+VLNVFIGVTIG TLFDTLKS+E+ PNS++ LLA S
Sbjct  441  LSKIEGIPSGSHVIRAASGKYFYFSVLNVFIGVTIGGTLFDTLKSVEEEPNSLVPLLAKS  500

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFF+TFVALKFFVGYGLELSRIVPLII+HL++KY+CK++AEI+EAW PGD+ YAT
Sbjct  501  LPGNATFFITFVALKFFVGYGLELSRIVPLIIYHLRRKYLCKSEAEIREAWFPGDISYAT  560

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVPS+ESYG+MWPHMH
Sbjct  561  RVPSDMLIITIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPSYESYGRMWPHMH  620

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++ AL+LYQ+TM+GYFGV +F Y P++IP PILS LF +VC +KFY 
Sbjct  621  TRIMGALLLYQVTMLGYFGVIQFYYTPILIPAPILSLLFYYVCRRKFYN  669



>gb|KDO75375.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=546

 Score =   344 bits (882),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  262  SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  321

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  322  PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  381

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  382  VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  441

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+
Sbjct  442  RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYK  489



>ref|XP_008784823.1| PREDICTED: CSC1-like protein ERD4 [Phoenix dactylifera]
Length=723

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 204/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHAVRAASGKYFYF + NVF+GVTIG  LF +LK+I D+P  I+S+L TS
Sbjct  439  LSKAEGIPSESHAVRAASGKYFYFIIFNVFLGVTIGGALFSSLKTIIDHPKQIVSMLGTS  498

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP+SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+K++CKT+AE+KEAWAPGD GYAT
Sbjct  499  LPASATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKFLCKTEAEVKEAWAPGDFGYAT  558

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ + LCYSVIAP+IIPFG VYF LGWL+ RNQALKVYVP +ES G+MWPHMH
Sbjct  559  RVPNDMLIVTVVLCYSVIAPLIIPFGVVYFALGWLIARNQALKVYVPKYESNGRMWPHMH  618

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +R++AALI+YQ+TM G+FG+KKF YAP ++PL ILSF+FAFVC K+FY
Sbjct  619  SRILAALIIYQVTMFGFFGLKKFIYAPFMLPLIILSFIFAFVCKKRFY  666



>ref|XP_009377481.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=724

 Score =   348 bits (894),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SHAVRA+SGKYFYFT+ NVFIGVT+G TLF T KSIE +PNS++ LLATS
Sbjct  440  LSKTEGIPSLSHAVRASSGKYFYFTIFNVFIGVTVGGTLFSTFKSIEKDPNSLVDLLATS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP++AT+FLTFVALKFFVGYGLEL R+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500  LPANATYFLTFVALKFFVGYGLELFRLVPLIIFHIKRKYLCKTEAELKAAWFPSDLGYGT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+ 
Sbjct  560  RVPGDMLIITIVLCYSVIAPLILPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHIQ  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R++A+LILYQ+TM GYFGVKKF YAP ++PLPI+S L+ F+CSKKFY 
Sbjct  620  VRLIASLILYQVTMFGYFGVKKFYYAPFLLPLPIVSLLYCFICSKKFYH  668



>ref|XP_007147944.1| hypothetical protein PHAVU_006G167700g [Phaseolus vulgaris]
 gb|ESW19938.1| hypothetical protein PHAVU_006G167700g [Phaseolus vulgaris]
Length=728

 Score =   348 bits (894),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 192/229 (84%), Gaps = 2/229 (1%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ESHAVRAASGKYFYF VLNVFIGVTIG TLF     I+ NP+        + 
Sbjct  444  SKFEGIPTESHAVRAASGKYFYFIVLNVFIGVTIGGTLFKAFNKIQKNPSLSEISSLLAE  503

Query  505  ps--saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
                +ATFFLT+VALKFFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  504  SLPGNATFFLTYVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            TR PGDML++ I  CYSVIAP+IIPFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+
Sbjct  564  TRVPGDMLIVTIVFCYSVIAPVIIPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHI  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            H RV+A+LILYQ+TM GYFG +KF Y PLV+PLP LS +F FVC+KKFY
Sbjct  624  HNRVLASLILYQITMFGYFGAQKFYYTPLVLPLPFLSLIFGFVCAKKFY  672



>gb|KDO75374.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=590

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  306  SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  365

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  366  PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  425

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  426  VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  485

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+
Sbjct  486  RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYK  533



>ref|XP_010687078.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=640

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESHAVR+ASGKYFYF V N FIGVT+G TLF  LK +E++PN I  LL   
Sbjct  367  LSKLEGIPSESHAVRSASGKYFYFIVFNAFIGVTLGGTLFGNLKDMEEHPNEIAELLGKG  426

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVAL+ FVGYGLELSR+VPLI+F+LKKKY+CKT+AE+KEAWAPGD  YAT
Sbjct  427  LPDNATFFLTFVALRCFVGYGLELSRLVPLIMFYLKKKYLCKTEAEVKEAWAPGDFRYAT  486

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P D+L+L I LCYSVIAP+I+PFG +YFGLGWL++RNQALKVYVPSFESYG+MWPH+H
Sbjct  487  RIPADLLILTITLCYSVIAPLILPFGIIYFGLGWLVMRNQALKVYVPSFESYGRMWPHLH  546

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR +AAL+LYQ+TM+GYFGVK+F Y   +IPLPI+S +FA+VC+KKFYR
Sbjct  547  TRFLAALVLYQVTMLGYFGVKEFIYTVTLIPLPIISLIFAWVCNKKFYR  595



>ref|XP_010052015.1| PREDICTED: CSC1-like protein ERD4 [Eucalyptus grandis]
 gb|KCW75874.1| hypothetical protein EUGRSUZ_D00261 [Eucalyptus grandis]
Length=718

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 201/225 (89%), Gaps = 0/225 (0%)
 Frame = -3

Query  676  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  497
            EGIPS+SH  RAASGKYFYFT LNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  445  EGIPSQSHIERAASGKYFYFTSLNVFIGVTVGGTLFATFKKIEKDPNSLLTILAASLPDN  504

Query  496  aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  317
            ATFFLTFVAL+ F+GYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGD GYATR PG
Sbjct  505  ATFFLTFVALRSFIGYGLELSRIVPLIIFHLKRKYLCKTEAEVKEAWYPGDQGYATRVPG  564

Query  316  DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  137
            D+L++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H R++
Sbjct  565  DLLIVTITLCYSVIAPLIIPFGVVYFGLGWLILRNQALKVYVPSYESYGRMWPHIHLRIL  624

Query  136  AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            A+L+LYQLTM+ YFG KKF YAPL++PL I S +FA+VC+KKFYR
Sbjct  625  ASLVLYQLTMLAYFGTKKFYYAPLLLPLVISSLIFAYVCNKKFYR  669



>ref|XP_006836313.1| hypothetical protein AMTR_s00092p00051600 [Amborella trichopoda]
 gb|ERM99166.1| hypothetical protein AMTR_s00092p00051600 [Amborella trichopoda]
Length=711

 Score =   346 bits (888),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHAVRAASGKYFYFT+  VFIG T+G +LFD LK++  +P+ I+++L  S
Sbjct  440  LSKAEGIPSESHAVRAASGKYFYFTIFTVFIGFTLGGSLFDNLKNVGKHPDQIVTMLGDS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            +P  A +F+TFVALKFFVGYGLELSR+VPLII+HLK+KY+CKT+ E+KEAWAPG +GYAT
Sbjct  500  VPKVAMYFITFVALKFFVGYGLELSRLVPLIIYHLKRKYLCKTEEELKEAWAPGSMGYAT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ + LCYSVI+P+IIPFG +YFG GWL+LRNQALKV+VPS+ESYG+MWPHMH
Sbjct  560  RVPNDMLIVTLSLCYSVISPLIIPFGVLYFGFGWLVLRNQALKVFVPSYESYGRMWPHMH  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR+VAAL ++QLTMIGYFG K F Y PL+IPLP LS +FAFVC K+FY+
Sbjct  620  TRIVAALFVFQLTMIGYFGTKAFVYTPLLIPLPFLSVIFAFVCQKRFYQ  668



>ref|XP_008439583.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Cucumis 
melo]
Length=725

 Score =   347 bits (889),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK+EGIPSE HA RAASGKYFYFTVLNVFIGVT+   LF T KSI+ +PNS++ LLA+SL
Sbjct  442  SKSEGIPSEGHAERAASGKYFYFTVLNVFIGVTLSGALFRTFKSIQKDPNSLVPLLASSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKK++CK +A++K AW PGDLGY TR
Sbjct  502  PGSATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKFLCKCEADVKNAWTPGDLGYGTR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGD+L+  I LCYS+I P+I+PFG +YFGLGWL+LRNQALKVYVPS+E+YG++WPH+  
Sbjct  562  IPGDLLIFTIVLCYSIITPLIVPFGVIYFGLGWLILRNQALKVYVPSYETYGRIWPHIFN  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R+VA+L+LYQLTM G+FGVKKF YAP++IPLPI+S +FAF+C KKFYR
Sbjct  622  RIVASLLLYQLTMFGFFGVKKFYYAPILIPLPIISLIFAFLCHKKFYR  669



>ref|XP_010687077.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=709

 Score =   346 bits (888),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESHAVR+ASGKYFYF V N FIGVT+G TLF  LK +E++PN I  LL   
Sbjct  436  LSKLEGIPSESHAVRSASGKYFYFIVFNAFIGVTLGGTLFGNLKDMEEHPNEIAELLGKG  495

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVAL+ FVGYGLELSR+VPLI+F+LKKKY+CKT+AE+KEAWAPGD  YAT
Sbjct  496  LPDNATFFLTFVALRCFVGYGLELSRLVPLIMFYLKKKYLCKTEAEVKEAWAPGDFRYAT  555

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P D+L+L I LCYSVIAP+I+PFG +YFGLGWL++RNQALKVYVPSFESYG+MWPH+H
Sbjct  556  RIPADLLILTITLCYSVIAPLILPFGIIYFGLGWLVMRNQALKVYVPSFESYGRMWPHLH  615

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR +AAL+LYQ+TM+GYFGVK+F Y   +IPLPI+S +FA+VC+KKFYR
Sbjct  616  TRFLAALVLYQVTMLGYFGVKEFIYTVTLIPLPIISLIFAWVCNKKFYR  664



>ref|XP_006448976.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
 gb|ESR62216.1| hypothetical protein CICLE_v100144071mg, partial [Citrus clementina]
Length=635

 Score =   343 bits (881),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 198/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  351  SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  410

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE KEAW PGDLGY TR
Sbjct  411  PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAEQKEAWFPGDLGYGTR  470

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  471  VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLVLRNQALKVYVPAYESYGRMWPHMFL  530

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+
Sbjct  531  RLVAALLLYQITMLGYFGSKKFVYVGFLIPLPILSLIFVYICQKRFYK  578



>ref|XP_004158645.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Cucumis sativus]
Length=725

 Score =   345 bits (884),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIPSE HA RAASGKYFYFTVLNVFIGVT+   LF T KSI+ +PNS++ LLA+SL
Sbjct  442  SKTEGIPSEGHAQRAASGKYFYFTVLNVFIGVTLSGALFRTFKSIQKDPNSLVPLLASSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKK++CK +A++K+AW PGDLGY TR
Sbjct  502  PGSATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKFLCKCEADVKDAWTPGDLGYGTR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGD+L+  I LCYS+I P+I+PFG +YFGLGWL+LRNQ LKVYVPS+E+YG++WPH+  
Sbjct  562  IPGDLLIFTIVLCYSIITPLIVPFGVIYFGLGWLILRNQVLKVYVPSYETYGRIWPHIFN  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R++A+L+LYQLTM G+FGVKKF YAP++IPLPI+S +FAF+C KKFYR
Sbjct  622  RIIASLLLYQLTMFGFFGVKKFYYAPILIPLPIISLIFAFLCHKKFYR  669



>ref|XP_004134564.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN49436.1| hypothetical protein Csa_6G525220 [Cucumis sativus]
Length=725

 Score =   344 bits (883),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 201/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIPSE HA RAASGKYFYFTVLNVFIGVT+   LF T KSI+ +PNS++ LLA+SL
Sbjct  442  SKTEGIPSEGHAQRAASGKYFYFTVLNVFIGVTLSGALFRTFKSIQKDPNSLVPLLASSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKK++CK +A++K+AW PGDLGY TR
Sbjct  502  PGSATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKFLCKCEADVKDAWTPGDLGYGTR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGD+L+  I LCYS+I P+I+PFG +YFGLGWL+LRNQ LKVYVPS+E+YG++WPH+  
Sbjct  562  IPGDLLIFTIVLCYSIITPLIVPFGVIYFGLGWLILRNQVLKVYVPSYETYGRIWPHIFN  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R++A+L+LYQLTM G+FGVKKF YAP++IPLPI+S +FAF+C KKFYR
Sbjct  622  RIIASLLLYQLTMFGFFGVKKFYYAPILIPLPIISLIFAFLCHKKFYR  669



>gb|EPS64315.1| hypothetical protein M569_10465, partial [Genlisea aurea]
Length=717

 Score =   344 bits (882),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGI SESHA RAASGKYFYFT+LNVFIGVTIGSTLF  LK+IE +PNS I+LLATS
Sbjct  439  LSKAEGITSESHAQRAASGKYFYFTILNVFIGVTIGSTLFTALKTIEKSPNSAITLLATS  498

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AEIKEAWAPGDLGYAT
Sbjct  499  LPESATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAEIKEAWAPGDLGYAT  558

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ + LCYSVIAP+IIPFG  YFGLGWL    Q LKVYVPS+ESYG+ WPH+ 
Sbjct  559  RIPNDMLIVTVVLCYSVIAPLIIPFGVAYFGLGWLSFIPQVLKVYVPSYESYGRAWPHLF  618

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R+VA+LILYQ+TM GYF +KKF  A  +IPLPILS +F  VC+KKFYR
Sbjct  619  IRIVASLILYQVTMFGYFALKKFYSAVFLIPLPILSIIFISVCNKKFYR  667



>gb|KDO75368.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=726

 Score =   344 bits (882),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442  SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502  PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  562  VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+
Sbjct  622  RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYK  669



>gb|KJB57185.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=725

 Score =   343 bits (881),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 198/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SH +RAASGKYFYF V NVFIGVTIG TLF ++K+IE+ PNS+  +LA S
Sbjct  441  LSKTEGIPSGSHVIRAASGKYFYFIVFNVFIGVTIGGTLFASIKTIEEKPNSVFDMLAKS  500

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ YAT
Sbjct  501  LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYAT  560

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVP++ESYG+MWPHM 
Sbjct  561  RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPAYESYGRMWPHMQ  620

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
             R+++AL LYQ+TM+GYFGV +F Y P+++PLPILS +F FVC KKFY
Sbjct  621  IRIISALFLYQVTMLGYFGVMRFYYTPILVPLPILSLVFVFVCRKKFY  668



>ref|XP_006468078.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
Length=726

 Score =   343 bits (880),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442  SKIEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502  PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  562  VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+
Sbjct  622  RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYK  669



>gb|KDO75367.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=730

 Score =   343 bits (880),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442  SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502  PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQALKVYVP++ESYG+MWPHM  
Sbjct  562  VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQALKVYVPAYESYGRMWPHMFL  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R+VAAL+LYQ+TM+GYFG KKF Y   +IPLPILS +F ++C K+FY+
Sbjct  622  RLVAALLLYQITMLGYFGSKKFIYVGFLIPLPILSLIFVYICQKRFYK  669



>emb|CDY67965.1| BnaCnng57110D, partial [Brassica napus]
Length=487

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS SHAVRAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSI+++LATS
Sbjct  201  LSKSEGIPSRSHAVRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALEQKPNSIVTVLATS  260

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+ KT+AE+KEAW PGDL YAT
Sbjct  261  LPKNATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLYKTEAEVKEAWYPGDLSYAT  320

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  321  RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  380

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL L+Q+ M GY GVK F +A L++PL ++S +F +VC +KFY
Sbjct  381  TRILAALFLFQVVMFGYLGVKLFVWATLLVPLIVISLIFGYVCRRKFY  428



>gb|EYU19153.1| hypothetical protein MIMGU_mgv1a001965mg [Erythranthe guttata]
Length=733

 Score =   342 bits (876),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/230 (75%), Positives = 203/230 (88%), Gaps = 1/230 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESHA RAASGKYFYF+VLNVFIGVTIGSTLF T K IE++PNSI+ LLA S
Sbjct  446  LSKQEGIPSESHAQRAASGKYFYFSVLNVFIGVTIGSTLFTTFKEIEEHPNSIVDLLAKS  505

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYG+ELSRI+PL+++HL+KKY+CK++ E++EAWAPGDLGYAT
Sbjct  506  LPGSATFFLTFVALKFFVGYGIELSRIIPLLVYHLQKKYVCKSENELREAWAPGDLGYAT  565

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQ LKVYVP +ESYG+ WPHM+
Sbjct  566  RIPGDMLIVTIVLCYSVIAPLIIPFGIVYFGLGWLVLRNQVLKVYVPKYESYGRTWPHMY  625

Query  148  TRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKFYR  2
             R++A+L+LYQ+TM+GYF  KKF   APLVI LPI S +F  VC++KFYR
Sbjct  626  IRIMASLMLYQVTMLGYFSAKKFVKGAPLVILLPIFSIIFILVCNEKFYR  675



>ref|XP_011012269.1| PREDICTED: CSC1-like protein ERD4 [Populus euphratica]
Length=724

 Score =   341 bits (875),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS  HAVRA SGKYFYF +LNVFIGVT+G TLF T KSIE  PNSI+SLLA+SL
Sbjct  440  SKAEGIPSVGHAVRATSGKYFYFIILNVFIGVTLGGTLFSTFKSIEKEPNSIVSLLASSL  499

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAW PGDLGYATR
Sbjct  500  PGNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAELKEAWFPGDLGYATR  559

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGDMLV+ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVY PSFE+YG+MWPH+H 
Sbjct  560  IPGDMLVITIVLCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVYAPSFETYGRMWPHIHA  619

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYR  2
            RV+AALILYQ+TM GYFGVKKF ++   +IPLPILS LFA+VC KKFYR
Sbjct  620  RVIAALILYQVTMFGYFGVKKFSFSTFSLIPLPILSLLFAYVCHKKFYR  668



>ref|XP_002300337.1| early-responsive to dehydration stress family protein [Populus 
trichocarpa]
 gb|EEE85142.1| early-responsive to dehydration stress family protein [Populus 
trichocarpa]
Length=724

 Score =   341 bits (875),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 207/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS  HAVRA SGKYFYFT+LNVFIGVT+G TLF T KSIE+ PNSI+SLLA+SL
Sbjct  440  SKAEGIPSVGHAVRATSGKYFYFTILNVFIGVTLGGTLFTTFKSIEEKPNSIVSLLASSL  499

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAW PGDLGYATR
Sbjct  500  PGNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAELKEAWFPGDLGYATR  559

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGDMLVL I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVY PSFE+YG+MWPH+HT
Sbjct  560  IPGDMLVLTIVLCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVYAPSFETYGRMWPHIHT  619

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKFYR  2
            RV+AALIL+Q+TM GYF VKKF ++   +IPLPILS LFA+VC KKFYR
Sbjct  620  RVIAALILFQVTMFGYFVVKKFSFSTFLLIPLPILSLLFAYVCHKKFYR  668



>emb|CDP05663.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   341 bits (875),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESH  RAASGKYFYFTVLNVFIGVT+GS+LF T K IE +PNSI+ LLATS
Sbjct  440  LSKTEGIPSESHVTRAASGKYFYFTVLNVFIGVTVGSSLFGTFKQIEKDPNSIVPLLATS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELS+IVPLII+HLKKKY+CKT+AE+KEAWAPGDLGYAT
Sbjct  500  LPKSATFFLTFVALKFFVGYGLELSQIVPLIIYHLKKKYLCKTEAEVKEAWAPGDLGYAT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFP DML++ +  CYSVIAPIIIPFG VYFGLGWL+LRNQ LKVYVPSFESYG+MWPH+ 
Sbjct  560  RFPNDMLIVTLVFCYSVIAPIIIPFGVVYFGLGWLVLRNQVLKVYVPSFESYGRMWPHIF  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R+++AL+LYQ+TM+G+ GVKKFPY  L+IPLPI+S +F  VC KKFYR
Sbjct  620  IRIMSALLLYQVTMLGFLGVKKFPYTVLLIPLPIISIIFCVVCDKKFYR  668



>emb|CDY12050.1| BnaC03g59660D [Brassica napus]
Length=723

 Score =   341 bits (874),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 166/229 (72%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSII++LA+S
Sbjct  437  LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALEKKPNSIITVLASS  496

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497  LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557  RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++AAL L+QL M GY GVK F +A L++PL  +S +F +VC +KFY+
Sbjct  617  TRILAALFLFQLVMFGYLGVKLFVWATLLVPLIFISLIFGYVCRQKFYK  665



>ref|NP_001288888.1| CSC1-like protein ERD4 [Brassica rapa]
 gb|ABV89652.1| early-responsive to dehydration 4 [Brassica rapa]
Length=678

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSI+++LATS
Sbjct  392  LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALETKPNSIVTVLATS  451

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  452  LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  511

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  512  RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  571

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++AAL L+QL M GY G K F +A L++PL  +S +F +VC +KFY+
Sbjct  572  TRILAALFLFQLVMFGYLGAKLFVWATLLVPLIFISLIFGYVCRQKFYK  620



>ref|XP_009398321.1| PREDICTED: CSC1-like protein ERD4 [Musa acuminata subsp. malaccensis]
Length=724

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESHAVRAASGKYFYF V NVF+GVTIG  LFD+LK+I ++P  +I+LL +S
Sbjct  440  LSKEEGIPSESHAVRAASGKYFYFVVFNVFLGVTIGGALFDSLKTIINHPTQVITLLGSS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLKK+++CKT+AE+KEAWAPGD GYAT
Sbjct  500  LPKSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKKRFLCKTEAEVKEAWAPGDFGYAT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAPIIIPFG VYFGLGWL+ RNQALKVYVP++ES G+MWPH+H
Sbjct  560  RVPSDMLIITIVLCYSVIAPIIIPFGVVYFGLGWLVARNQALKVYVPNYESNGRMWPHLH  619

Query  148  TRVVAALILYQLTMIGYFGV-KKFPYAPLVIPLPILSFLFAFVCSKKFY  5
             R++A+LILYQ+TM GY G+ +KF YAP +IP+ ++SF+FA+VC K FY
Sbjct  620  ARIIASLILYQITMFGYIGILRKFYYAPFLIPVIVISFVFAYVCKKHFY  668



>ref|XP_009408546.1| PREDICTED: CSC1-like protein ERD4 [Musa acuminata subsp. malaccensis]
Length=725

 Score =   340 bits (871),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 200/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESHAVRAASGKYFYF V NVF+GVTIG TL+ +LK I   P+ II+LL +S
Sbjct  440  LSKEEGIPSESHAVRAASGKYFYFIVFNVFLGVTIGGTLYGSLKEIIKKPSQIITLLGSS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLT+VALKFFVGYGLELSR+VPLIIFHLKKKY+CKT+AE+KEAWAP D GYAT
Sbjct  500  LPKSATFFLTYVALKFFVGYGLELSRLVPLIIFHLKKKYLCKTEAEVKEAWAPSDFGYAT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            RFP DML++ I LCYSVIAPIIIPFG VYFGLGWL+ RNQALKVYVP +ES G+MWPHMH
Sbjct  560  RFPNDMLIVTIVLCYSVIAPIIIPFGVVYFGLGWLVARNQALKVYVPRYESNGRMWPHMH  619

Query  148  TRVVAALILYQLTMIGYFGV-KKFPYAPLVIPLPILSFLFAFVCSKKFY  5
             R+VAALI+YQ+TM+GY G+ +KF YAP +IP+  +SF+FA+VC ++FY
Sbjct  620  ARIVAALIVYQITMLGYIGILRKFYYAPFLIPVIAISFIFAYVCKQRFY  668



>emb|CDX90246.1| BnaA08g17380D [Brassica napus]
Length=723

 Score =   339 bits (869),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++E  PNSI+++LATS
Sbjct  437  LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALETKPNSIVTVLATS  496

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497  LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557  RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++AAL L+QL M GY G K F +A L++PL  +S +F +VC +KFY+
Sbjct  617  TRILAALFLFQLVMFGYLGAKLFVWATLLVPLIFISLIFGYVCRQKFYK  665



>ref|XP_006415482.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
 gb|ESQ33835.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
Length=584

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS SHA+RAASGKYFYF+VLNVF+GVT+  +LFD LK++E  PNSI+++LATS
Sbjct  298  LSKAEGIPSVSHAIRAASGKYFYFSVLNVFLGVTLAGSLFDNLKALEKKPNSIVTVLATS  357

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y T
Sbjct  358  LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYGT  417

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML+L I  CYSVIAP+I+ F  +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  418  RVPGDMLILTITFCYSVIAPVILVFAVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  477

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++AAL L+Q+ M G+ GVK+F +A LV+PL  +S +F +VC +KFY+
Sbjct  478  TRILAALFLFQVLMFGFLGVKEFIWAILVVPLIAISLVFGYVCRQKFYK  526



>gb|KHG13189.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=725

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIP  SH +RAASGKYFYF V NVFIGVTIG TL  ++K+IE+ PNS+  +LA S
Sbjct  441  LSKTEGIPGGSHVIRAASGKYFYFIVFNVFIGVTIGGTLIASIKTIEEKPNSVFDMLAKS  500

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ Y T
Sbjct  501  LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYVT  560

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVP++ESYG+MWPHM 
Sbjct  561  RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPAYESYGRMWPHMQ  620

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR+++AL LYQ+TM+GYFGV +F Y P+++PLPILS +F  VC KKFY
Sbjct  621  TRIISALFLYQVTMLGYFGVMRFYYTPILVPLPILSLVFVIVCRKKFY  668



>ref|XP_011014082.1| PREDICTED: CSC1-like protein ERD4 [Populus euphratica]
Length=724

 Score =   337 bits (863),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS  HAVRA SGKYFYF +LNVFIGVT+G TLF T KSIE  PNSI+SLLA+SL
Sbjct  440  SKAEGIPSVGHAVRATSGKYFYFIILNVFIGVTLGGTLFSTFKSIEKEPNSIVSLLASSL  499

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKY+CKT+AE+KEAW PGDLGYATR
Sbjct  500  PGNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYLCKTEAELKEAWFPGDLGYATR  559

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGDMLV+ I LCYSVIAP+IIPFG VYFGLGWL+LRNQALKVY PSFE+YG+MWPH+HT
Sbjct  560  IPGDMLVITIVLCYSVIAPLIIPFGVVYFGLGWLVLRNQALKVYAPSFETYGRMWPHIHT  619

Query  145  RVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKFYR  2
            R +AAL+LYQ+TM GYFGVKKF + + L+IPLPILS LFA VC KKFYR
Sbjct  620  RFIAALVLYQVTMFGYFGVKKFSFRSLLLIPLPILSLLFANVCRKKFYR  668



>sp|A9LIW2.2|CSC1L_BRAJU RecName: Full=CSC1-like protein ERD4; AltName: Full=Protein EARLY-RESPONSIVE 
TO DEHYDRATION STRESS 4 [Brassica juncea]
 gb|ABX56139.2| ERD4 protein [Brassica juncea]
Length=723

 Score =   336 bits (862),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SHA+RA SGKYFYF+VLNVFIGVT+  +LF+ LK++E+ PNS I+LLATS
Sbjct  437  LSKSEGIPSQSHAIRATSGKYFYFSVLNVFIGVTLAGSLFENLKALEEKPNSFITLLATS  496

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497  LPKSATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557  RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL L+QL M GY GVK F +A L++PL  +S +F +VC +KFY
Sbjct  617  TRILAALFLFQLVMFGYLGVKIFVWAILLVPLIFISLIFGYVCRQKFY  664



>ref|XP_004485983.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Cicer 
arietinum]
Length=722

 Score =   336 bits (861),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 179/228 (79%), Positives = 208/228 (91%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIP+ESH VRAASGKYFYFTVLNVFIGVT+G TLF T K+I++ P  I+SLLA S
Sbjct  438  LSKLEGIPTESHVVRAASGKYFYFTVLNVFIGVTLGGTLFSTFKTIQNEPKQIVSLLAES  497

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSR+VPLI++HLKKKY+CKT+AE+KEAWAPGDLGYAT
Sbjct  498  LPGNATFFLTYVALKFFVGYGLELSRLVPLIMYHLKKKYLCKTEAELKEAWAPGDLGYAT  557

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFGAVYFGLGWL+LRNQALKVYVPS+ESYG+MWPH++
Sbjct  558  RIPSDMLIVTIVLCYSVIAPLIIPFGAVYFGLGWLVLRNQALKVYVPSYESYGRMWPHIN  617

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
             R++A+LILYQ+TM GYFGV+KF YAPL+IPLPILS LF FV +KKFY
Sbjct  618  NRILASLILYQITMFGYFGVQKFYYAPLLIPLPILSLLFGFVSAKKFY  665



>ref|XP_006415483.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
 gb|ESQ33836.1| hypothetical protein EUTSA_v10006933mg [Eutrema salsugineum]
Length=723

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/229 (72%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS SHA+RAASGKYFYF+VLNVF+GVT+  +LFD LK++E  PNSI+++LATS
Sbjct  437  LSKAEGIPSVSHAIRAASGKYFYFSVLNVFLGVTLAGSLFDNLKALEKKPNSIVTVLATS  496

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y T
Sbjct  497  LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYGT  556

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML+L I  CYSVIAP+I+ F  +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557  RVPGDMLILTITFCYSVIAPVILVFAVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++AAL L+Q+ M G+ GVK+F +A LV+PL  +S +F +VC +KFY+
Sbjct  617  TRILAALFLFQVLMFGFLGVKEFIWAILVVPLIAISLVFGYVCRQKFYK  665



>gb|KFK44850.1| hypothetical protein AALP_AA1G310500 [Arabis alpina]
Length=723

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+G +LFDTLK I+ +P S +S+LATS
Sbjct  437  LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLGGSLFDTLKVIQKDPKSTVSILATS  496

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLT+VALKFF+GYGLELSR++PLIIFH+KKKY+CKT+ E+KEAW PGDL Y+T
Sbjct  497  LPKSATFFLTYVALKFFIGYGLELSRLIPLIIFHIKKKYLCKTEDEVKEAWYPGDLSYST  556

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML+L I  CYSVIAP+I+ F  +YF LGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557  RVPGDMLILTITFCYSVIAPLILIFAVIYFALGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++AAL L+Q+ M GY G+K+F +A L++P+ ++S LF +VC +KFY+
Sbjct  617  TRILAALFLFQVVMFGYLGIKEFIWAVLLVPIIVISLLFGYVCRQKFYK  665



>dbj|BAB63915.1| ERD4 protein [Arabidopsis thaliana]
Length=640

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  515
            LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + II+LLA
Sbjct  352  LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMIINLLA  411

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  412  TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSY  471

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            ATR PGDML+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  472  ATRVPGDMLILTITFCYSVIAPLILIFGITYFGLGWLVLRNQALKVYVPSYESYGRMWPH  531

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY
Sbjct  532  IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFY  581



>emb|CAN64310.1| hypothetical protein VITISV_037471 [Vitis vinifera]
Length=676

 Score =   332 bits (851),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 196/222 (88%), Gaps = 1/222 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS+SHAVRAASGKYFYFT+LNVFIGVT+G+TLFDT K+IED P  I+S+LA SL
Sbjct  442  SKAEGIPSQSHAVRAASGKYFYFTILNVFIGVTVGATLFDTFKTIEDQPKEIVSILAKSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            PS+ATFFLTFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+KEAWAPGDLGY +R
Sbjct  502  PSNATFFLTFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTETEVKEAWAPGDLGYVSR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGD+L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQALKVYVPS+ES G+MWPH+H 
Sbjct  562  VPGDLLIITIVLCYSVIAPIILPFGVLYFGLGWLILRNQALKVYVPSYESNGRMWPHIHV  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVC  20
            R++ AL+LYQ+TM+GYFGVK+ P   +    P  +FL  ++C
Sbjct  622  RLIGALLLYQVTMLGYFGVKRIPLYSICDRAP-YTFLDLYLC  662



>gb|ABV89627.1| early-responsive to dehydration 4 [Brassica rapa]
Length=723

 Score =   333 bits (853),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 195/229 (85%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SHA+RAASGKYFYF+VLNVFIGVT+  +LFD LK++  N   I   LATS
Sbjct  437  LSKSEGIPSQSHAIRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALRRNQTPIAYRLATS  496

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFFVGYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YAT
Sbjct  497  LPKNATFFLTYVALKFFVGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYAT  556

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  557  RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  616

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            TR++AAL L+QL M GY G K F +A L++PL  +S +F +VC +KFY+
Sbjct  617  TRILAALFLFQLVMFGYLGAKLFVWATLLVPLIFISLIFGYVCRQKFYK  665



>ref|XP_009115162.1| PREDICTED: CSC1-like protein ERD4 [Brassica rapa]
Length=722

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SHAVRAASGKYFYF+VLNVFIGVT+  +LFD LK+++  PNSI+++LATS
Sbjct  436  LSKYEGIPSRSHAVRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALQQKPNSIVTVLATS  495

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+ KT+AE+KEAW PGDL YAT
Sbjct  496  LPKNATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLYKTEAEVKEAWYPGDLRYAT  555

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  556  RVPSDMLILTITFCYSVIAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  615

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL L+Q+ M GY GVK F +A L++PL ++S +F +VC +KFY
Sbjct  616  TRILAALFLFQVVMFGYLGVKLFVWATLLVPLIVISLIFGYVCRRKFY  663



>emb|CDY02286.1| BnaA09g26160D [Brassica napus]
Length=722

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 199/228 (87%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS SHAVRAASGKYFYF+VLNVFIGVT+  +LFD LK+++  PNSI+++LATS
Sbjct  436  LSKSEGIPSRSHAVRAASGKYFYFSVLNVFIGVTLAGSLFDNLKALQQKPNSIVTVLATS  495

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+ KT+AE+KEAW PGDL YAT
Sbjct  496  LPKNATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLYKTEAEVKEAWYPGDLRYAT  555

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+L I  CYSV AP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H
Sbjct  556  RVPSDMLILTITFCYSVFAPLILVFGVIYFGLGWLILRNQALKVYVPSYESYGRMWPHIH  615

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL L+Q+ M GY GVK F +A L++PL ++S +F +VC +KFY
Sbjct  616  TRILAALFLFQVVMFGYLGVKLFVWATLLVPLIVISLIFGYVCRRKFY  663



>ref|NP_564354.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 sp|Q9C8G5.1|CSCLD_ARATH RecName: Full=CSC1-like protein ERD4; AltName: Full=Protein EARLY-RESPONSIVE 
TO DEHYDRATION STRESS 4 [Arabidopsis thaliana]
 gb|AAG51102.1|AC025295_10 unknown protein [Arabidopsis thaliana]
 gb|AAK59597.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34230.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31209.1| Early-responsive to dehydration stress protein (ERD4) [Arabidopsis 
thaliana]
 gb|AIU34626.1| hyperosmolality-gated Ca2+ permeable channel 3.1 [Arabidopsis 
thaliana]
Length=724

 Score =   330 bits (847),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  515
            LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + II+LLA
Sbjct  436  LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMIINLLA  495

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  496  TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSY  555

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            ATR PGDML+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  556  ATRVPGDMLILTITFCYSVIAPLILIFGITYFGLGWLVLRNQALKVYVPSYESYGRMWPH  615

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY
Sbjct  616  IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFY  665



>ref|XP_010907974.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein ERD4 [Elaeis 
guineensis]
Length=724

 Score =   330 bits (847),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 198/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  688  LSKAEG-IPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllat  512
            LSKAEG IPSESHAVRAASGKYFYF + NVF+GVTI  TLF +LK I  +P  I+ LL T
Sbjct  439  LSKAEGGIPSESHAVRAASGKYFYFIIFNVFLGVTITGTLFTSLKKIIGHPGEIVRLLGT  498

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            +LP +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+K++CKT+AE+KEAWAPGD GY 
Sbjct  499  NLPGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKFLCKTEAEVKEAWAPGDFGYN  558

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            TR P DML++ I LCYSVIAP+IIPFG VYF LGWL+ RNQALKVYVP++ES G+MWPHM
Sbjct  559  TRVPNDMLIITIVLCYSVIAPLIIPFGVVYFALGWLVARNQALKVYVPNYESNGRMWPHM  618

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            H+R++AALI+YQ+TM G+F +K+F YAP ++PL I SF+FAFVC ++FY
Sbjct  619  HSRILAALIIYQVTMFGFFALKEFYYAPFMLPLIISSFIFAFVCKQRFY  667



>ref|XP_002890865.1| early-responsive to dehydration 4 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67124.1| early-responsive to dehydration 4 [Arabidopsis lyrata subsp. 
lyrata]
Length=722

 Score =   330 bits (845),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/230 (73%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  515
            LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + II+LLA
Sbjct  434  LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMIINLLA  493

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  494  TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLTY  553

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            ATR PGD+LVL I  CYSVIAP+I+ FG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  554  ATRVPGDLLVLTITFCYSVIAPLILIFGIIYFGLGWLVLRNQALKVYVPSYESYGRMWPH  613

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY
Sbjct  614  IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFY  663



>ref|XP_010478422.1| PREDICTED: CSC1-like protein ERD4 [Camelina sativa]
Length=725

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  515
            LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437  LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKK+MCKT+AE+KEAW PGDL Y
Sbjct  497  TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKFMCKTEAEVKEAWYPGDLSY  556

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            ATR PGD+L+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557  ATRVPGDLLILTITFCYSVIAPLILVFGVTYFGLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY
Sbjct  617  IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFY  666



>ref|XP_010499567.1| PREDICTED: CSC1-like protein ERD4 [Camelina sativa]
Length=725

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 197/230 (86%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  515
            LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437  LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKK++CKT+AE+KEAW PGDL Y
Sbjct  497  TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKFLCKTEAEVKEAWYPGDLSY  556

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            ATR PGD+L+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557  ATRVPGDLLILTITFCYSVIAPLILVFGVTYFGLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +H R++AAL L+Q+ M GY G K F Y  LVIPL I+S +F +VC +KFY
Sbjct  617  IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIIISLIFGYVCRQKFY  666



>ref|XP_010460826.1| PREDICTED: CSC1-like protein ERD4 isoform X1 [Camelina sativa]
 ref|XP_010460827.1| PREDICTED: CSC1-like protein ERD4 isoform X2 [Camelina sativa]
Length=725

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 196/230 (85%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  515
            LSKAEGIPS+SHA+RAASGKYFYF+V NVFIGVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437  LSKAEGIPSQSHAIRAASGKYFYFSVFNVFIGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKK++CKT+AE+KEAW PGDL Y
Sbjct  497  TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKFLCKTEAEVKEAWYPGDLSY  556

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            ATR PGD+L+L I  CYSVIAP+I+ FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557  ATRVPGDLLILTITFCYSVIAPLILVFGVTYFGLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY
Sbjct  617  IHQRILAALFLFQVVMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFY  666



>ref|XP_008371649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Malus 
domestica]
Length=725

 Score =   328 bits (841),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SHAVRA+SGKYFYFTV NVFIGVT+G TLF T K+IE +PNSI+ LLATS
Sbjct  440  LSKTEGIPSLSHAVRASSGKYFYFTVFNVFIGVTVGGTLFSTFKTIEKDPNSIVDLLATS  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP++AT+FLTFVALKFFVGYGLEL R+VPLIIFH+K+KY+CKT+AE+K AW P DLGY T
Sbjct  500  LPANATYFLTFVALKFFVGYGLELFRLVPLIIFHIKRKYVCKTEAEVKAAWFPSDLGYGT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R PGDML++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+ 
Sbjct  560  RVPGDMLIITIVLCYSVIAPLILPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHIQ  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
             R++A+LILYQ+TM GYFGVKKF YAP ++PLPILS L+ F+CSKKFY 
Sbjct  620  VRLIASLILYQVTMFGYFGVKKFVYAPFLLPLPILSLLYIFICSKKFYH  668



>gb|KHG16289.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   323 bits (829),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 203/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            + + EGIPS SH +RAASGKYFYF+VLNVFIGVTIG TLFDTLKS+E+ PNS++ LLA S
Sbjct  365  VDQIEGIPSGSHVIRAASGKYFYFSVLNVFIGVTIGGTLFDTLKSVEEEPNSLVPLLAKS  424

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFF+TFVALKFFVGYGLELSR+ PLII+HL++KY+CK++AEI+EAW PGD+ YAT
Sbjct  425  LPGNATFFITFVALKFFVGYGLELSRLFPLIIYHLRRKYLCKSEAEIREAWFPGDISYAT  484

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQALKVYVPS+ESYG+MWPHMH
Sbjct  485  RVPSDMLIITIVLCYSVIAPVIIPFGVLYFALGWLVLRNQALKVYVPSYESYGRMWPHMH  544

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++ AL+LYQ+TM+GYFGV +F Y P++IPLPILS LF +VC +KFY
Sbjct  545  TRIMGALLLYQVTMLGYFGVIQFYYTPILIPLPILSLLFYYVCRRKFY  592



>ref|XP_009377479.1| PREDICTED: CSC1-like protein ERD4 [Pyrus x bretschneideri]
Length=729

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS+SHAVRA SGKYFYF + NVF+GVT+G TLF TLK+IE +PNS++ LLATSL
Sbjct  441  SKAEGIPSQSHAVRATSGKYFYFIIFNVFLGVTVGGTLFSTLKTIEKDPNSLVDLLATSL  500

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P+++T+FLTFVALKFFVGYGLELSR+VPLIIFH+K+KY CK++ E+K AW P  LGY TR
Sbjct  501  PANSTYFLTFVALKFFVGYGLELSRLVPLIIFHIKRKYFCKSEDEVKAAWLPRGLGYGTR  560

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ I LCYSVIAP+I+PFG +YFGLGWL+LRNQALKVY+PS+ESYG+MWPH+  
Sbjct  561  VPSDMLMITIVLCYSVIAPLILPFGVLYFGLGWLVLRNQALKVYIPSYESYGRMWPHIQV  620

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R++A+LILYQ+TM GYFGVKKF YAP ++PLP++S LF+F+CSKKFY 
Sbjct  621  RLIASLILYQVTMFGYFGVKKFYYAPFLLPLPVVSLLFSFICSKKFYH  668



>ref|XP_006306879.1| hypothetical protein CARUB_v10008433mg [Capsella rubella]
 gb|EOA39777.1| hypothetical protein CARUB_v10008433mg [Capsella rubella]
Length=725

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/230 (70%), Positives = 193/230 (84%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiislla  515
            LSK+EGIPS+SH +RAASGKYFYF+V NVF+GVT+  TLF+T+K I  NP  + +I+LLA
Sbjct  437  LSKSEGIPSQSHVIRAASGKYFYFSVFNVFLGVTLAGTLFNTVKDIAKNPKLDMVINLLA  496

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            TSLP SATFFLT+VALKFF+GYGLELSRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL Y
Sbjct  497  TSLPKSATFFLTYVALKFFIGYGLELSRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSY  556

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
             TR PGDML+L I  CYSVIAP+I+ FG  YF LGWL+LRNQALKVYVPS+ESYG+MWPH
Sbjct  557  QTRVPGDMLILTITFCYSVIAPLILVFGITYFSLGWLVLRNQALKVYVPSYESYGRMWPH  616

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +H R++AAL L+Q+ M GY G K F Y  LVIPL I S +F +VC +KFY
Sbjct  617  IHQRILAALFLFQVLMFGYLGAKTFFYTALVIPLIITSLIFGYVCRQKFY  666



>ref|XP_004293515.1| PREDICTED: CSC1-like protein ERD4 [Fragaria vesca subsp. vesca]
Length=726

 Score =   323 bits (828),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 200/228 (88%), Gaps = 0/228 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SKAEGIPS+SHA+RAA+GKYFYF V NVF+GVT+G  LF T K IED+PN ++ LLATSL
Sbjct  441  SKAEGIPSQSHAIRAAAGKYFYFIVFNVFLGVTVGGALFSTFKEIEDDPNKLVPLLATSL  500

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P SAT+F+TFVALKFFVGYGLELSRIVPLIIFHLK+KY+CKT+ E+K AW P DLGY TR
Sbjct  501  PGSATYFITFVALKFFVGYGLELSRIVPLIIFHLKRKYLCKTEGELKAAWQPSDLGYGTR  560

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGDML++ + LCYSVIAP+I+PFG +YFG+GWL+LRNQALKVY P++ES GK WPHM  
Sbjct  561  VPGDMLIITVALCYSVIAPLILPFGVLYFGIGWLVLRNQALKVYCPAYESNGKFWPHMQL  620

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            R++AALILYQ+TM+G+ GVKKF YAPL+IPLPILS +F ++CSKKFYR
Sbjct  621  RILAALILYQVTMVGFLGVKKFVYAPLLIPLPILSLIFGYICSKKFYR  668



>ref|XP_002461460.1| hypothetical protein SORBIDRAFT_02g003010 [Sorghum bicolor]
 gb|EER97981.1| hypothetical protein SORBIDRAFT_02g003010 [Sorghum bicolor]
Length=732

 Score =   320 bits (821),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 193/228 (85%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS+SHAVRAASGKYFYF V NVF+G T+GSTLF +L +I D+P  I+++LA S
Sbjct  446  LSKQEGIPSQSHAVRAASGKYFYFIVFNVFLGYTLGSTLFKSLTTIIDHPAGIVTMLANS  505

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ ++K AWAPGDLGY T
Sbjct  506  LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEEDVKAAWAPGDLGYNT  565

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+  + LCYSVIAP+IIPFG  YF LGWL+ +NQ L+VYVPS+ESYG+MWPHMH
Sbjct  566  RVPNDMLIATVVLCYSVIAPLIIPFGVAYFALGWLIAKNQILRVYVPSYESYGRMWPHMH  625

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++ AL++YQ TMIG+  +KKF Y P+++PL  +S +FA+VC  +FY
Sbjct  626  TRIITALMVYQTTMIGFIPLKKFYYVPVLVPLLPISIIFAYVCHMRFY  673



>ref|XP_006657447.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Oryza 
brachyantha]
Length=729

 Score =   320 bits (820),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EG+PS+SH VRAA+GKYFYF V NVF+GVTIGSTLF  L +I +NP  I+ +LA S
Sbjct  444  LSKSEGLPSQSHIVRAAAGKYFYFIVFNVFLGVTIGSTLFSALTTIINNPPGIVKMLANS  503

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ +++ AWAPGDLGY T
Sbjct  504  LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDDVRAAWAPGDLGYNT  563

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG  YF LGW++ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  564  RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIAKNQVLRVYVPSYESNGRMWPHMH  623

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ TM+G   +KKF Y+P+++PL  +SF+FA++C+ +FY
Sbjct  624  TRIIAALLIYQTTMVGVILLKKFFYSPVLVPLIPMSFIFAYICNMRFY  671



>ref|NP_001058898.1| Os07g0150100 [Oryza sativa Japonica Group]
 dbj|BAC82906.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF20812.1| Os07g0150100 [Oryza sativa Japonica Group]
 gb|AIU34637.1| hyperosmolality-gated Ca2+ permeable channel 3.1 [Oryza sativa]
Length=731

 Score =   319 bits (817),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS+ H VRAA+GKYFYF V NVF+GVTI STLF  L +I +NP  I+++LA+S
Sbjct  446  LSKLEGIPSQGHTVRAAAGKYFYFIVFNVFLGVTISSTLFSALTTIINNPPGIVNMLASS  505

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  506  LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  565

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG  YF LGW++++NQ L+VYVPS+ES G+MWPHMH
Sbjct  566  RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIVKNQVLRVYVPSYESNGRMWPHMH  625

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ+TM+G   +KKF Y+P+++PL  +SF+FA++C  +FY
Sbjct  626  TRIIAALLIYQITMVGVILLKKFLYSPVLVPLIPISFIFAYICHMRFY  673



>gb|EAZ02783.1| hypothetical protein OsI_24908 [Oryza sativa Indica Group]
Length=731

 Score =   318 bits (814),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 194/228 (85%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS+ H VRAA+GKYFYF V NVF+GVTI STLF  L +I +NP  I+++LA+S
Sbjct  446  LSKLEGIPSQGHTVRAAAGKYFYFIVFNVFLGVTISSTLFSALTTIINNPPGIVNMLASS  505

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  506  LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  565

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG  YF LGW++ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  566  RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIAKNQVLRVYVPSYESNGRMWPHMH  625

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ+TM+G   +KKF Y+P+++PL  +SF+FA++C  +FY
Sbjct  626  TRIIAALLIYQITMVGVILLKKFLYSPVLVPLIPISFIFAYICHMRFY  673



>dbj|BAJ94358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=501

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ + +NP  I + L   L
Sbjct  217  SKLEGIPSQSHLVRAASGKYFYFIVFNVFIGYAIGSSLFSALQDVINNPPGIFTTLGARL  276

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY TR
Sbjct  277  PGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNTR  336

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ + LCYSVIAP+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMHT
Sbjct  337  VPNDMLIVTVVLCYSVIAPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMHT  396

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            R++AAL++YQ TMIG    K+F Y+ ++ PL  +S +FA+ C  +FY
Sbjct  397  RIIAALMVYQATMIGIITAKRFYYSTILFPLLAISLIFAYTCHTRFY  443



>ref|NP_001108122.1| early responsive to dehydration protein [Zea mays]
 gb|ABY60425.1| early responsive to dehydration protein [Zea mays]
Length=732

 Score =   312 bits (800),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS+ HAVRAASGKYFYF V NVF+  T+GSTLF +L +I ++P  I+++LA S
Sbjct  446  LSKQEGIPSQGHAVRAASGKYFYFIVFNVFLCYTLGSTLFKSLTTIINHPAEIVNMLAKS  505

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKF VGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAP DLGY T
Sbjct  506  LPGSATFFLTFVALKFLVGYGLELSRLVPLIIFHLKRKYLCKTEEEVRAAWAPVDLGYNT  565

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML+  + LCYSVIAP+IIPFG  YF LGWL+ RNQ L+VYVPS+ESYG+MWPHMH
Sbjct  566  RVPNDMLIATVVLCYSVIAPLIIPFGVAYFALGWLIARNQILRVYVPSYESYGRMWPHMH  625

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ TMIG+  +KKF YA +++PL   S +FA+VC  +FY
Sbjct  626  TRIIAALMVYQTTMIGFISLKKFAYASVLVPLLPASIIFAYVCHMRFY  673



>gb|EMT14399.1| Putative membrane protein [Aegilops tauschii]
Length=725

 Score =   312 bits (800),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 188/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SH VRA+SGKYFYF V NVFIG  IGS+LF  L+ + +NP  I++ L + 
Sbjct  440  LSKSEGIPSQSHVVRASSGKYFYFIVFNVFIGYAIGSSLFSALQKVIENPTGIVTTLGSR  499

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  500  LPGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  559

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P D+L++ + +CYSVIAP+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  560  RVPNDLLIVTLVMCYSVIAPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMH  619

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ TM+G  G+KKF Y+ ++ PL  +S +FA+ C  +FY
Sbjct  620  TRIIAALMIYQATMLGIIGLKKFYYSAILTPLLAISLIFAYTCHTRFY  667



>ref|XP_003557644.1| PREDICTED: CSC1-like protein ERD4 [Brachypodium distachyon]
Length=729

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 188/227 (83%), Gaps = 0/227 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK+EGIPS+SH VRAASGKYFYF + NVFIG TI S+LF  LK+I +NP  IIS+LA SL
Sbjct  445  SKSEGIPSQSHVVRAASGKYFYFIIFNVFIGFTISSSLFSALKTIINNPPGIISMLANSL  504

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P SATFFLTFVALKFFVGYGLELSR+VPLIIFHLKKKY+CKT+ E++ AWAPGDLGY TR
Sbjct  505  PGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKKKYLCKTEDEVRAAWAPGDLGYNTR  564

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DMLV+ I LCYSVIAP+IIPFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMHT
Sbjct  565  VPNDMLVVTIVLCYSVIAPLIIPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMHT  624

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            RV+AAL++YQ TMIG   +K F Y+ ++ PL  +S +FA+ C  +FY
Sbjct  625  RVIAALMIYQATMIGVIILKLFYYSTILFPLLAISLIFAYTCHTRFY  671



>gb|EAZ38704.1| hypothetical protein OsJ_23104 [Oryza sativa Japonica Group]
Length=1280

 Score =   317 bits (813),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS+ H VRAA+GKYFYF V NVF+GVTI STLF  L +I +NP  I+++LA+S
Sbjct  446  LSKLEGIPSQGHTVRAAAGKYFYFIVFNVFLGVTISSTLFSALTTIINNPPGIVNMLASS  505

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY T
Sbjct  506  LPGSATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNT  565

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG  YF LGW++++NQ L+VYVPS+ES G+MWPHMH
Sbjct  566  RVPNDMLIVTIVLCYSVIAPLIIPFGVAYFALGWIIVKNQVLRVYVPSYESNGRMWPHMH  625

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ+TM+G   +KKF Y+P+++PL  +SF+FA++C  +FY
Sbjct  626  TRIIAALLIYQITMVGVILLKKFLYSPVLVPLIPISFIFAYICHMRFY  673



>gb|KCW75871.1| hypothetical protein EUGRSUZ_D00260 [Eucalyptus grandis]
Length=710

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 184/225 (82%), Gaps = 14/225 (6%)
 Frame = -3

Query  676  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatslpss  497
            EGIPS+SH  RAASGKYFYFTVLNVFIGVT+G TLF T K IE +PNS++++LA SLP +
Sbjct  444  EGIPSQSHIERAASGKYFYFTVLNVFIGVTVGGTLFATFKEIEKDPNSLLTILAASLPDN  503

Query  496  aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPG  317
            ATFFLT++A+KFFVGYGLELSRIVPLIIFHLK+KY+CKT+AE+KEAW PGDL YATR PG
Sbjct  504  ATFFLTYIAMKFFVGYGLELSRIVPLIIFHLKRKYICKTEAEVKEAWYPGDLEYATRVPG  563

Query  316  DMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVV  137
            DML++ I LCYSVIAP+II FG VYFGLGW++LRNQ              MWP MH R++
Sbjct  564  DMLIVTITLCYSVIAPLIILFGVVYFGLGWIILRNQ--------------MWPRMHLRIL  609

Query  136  AALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            AAL+LYQLTM  YFG KKF YA  ++PL I S +FA+VC+KKFYR
Sbjct  610  AALVLYQLTMFAYFGTKKFYYATFLVPLIISSLIFAYVCNKKFYR  654



>gb|EMS45497.1| Uncharacterized membrane protein C24H6.13 [Triticum urartu]
Length=729

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 187/228 (82%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SH VRAASGKYFYF + NVF+G TI S+LF  LK+I DNP  II +L  S
Sbjct  444  LSKSEGIPSQSHVVRAASGKYFYFIIFNVFLGFTISSSLFSALKTIVDNPPGIIVMLGNS  503

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFL+FVALKFFVGYGLELSR+VPLIIFHLKKKY+CKT+ E++ AW+PGDLGY T
Sbjct  504  LPGSATFFLSFVALKFFVGYGLELSRLVPLIIFHLKKKYLCKTEDELRAAWSPGDLGYNT  563

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+IIPFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPH+H
Sbjct  564  RVPSDMLIVTIVLCYSVIAPLIIPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHIH  623

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TRV+AAL++YQ TMIG   +K F Y+ ++ PL  +S +FA+ C  +FY
Sbjct  624  TRVIAALMIYQATMIGVIILKLFFYSAILSPLIPISLIFAYTCHTRFY  671



>dbj|BAJ93282.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=725

 Score =   306 bits (785),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ + +NP  I + L   L
Sbjct  441  SKLEGIPSQSHLVRAASGKYFYFIVFNVFIGYAIGSSLFSALQDVINNPPGIFTTLGARL  500

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLTFVALKFFVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AWAPGDLGY TR
Sbjct  501  PGNATFFLTFVALKFFVGYGLELSRLVPLIIFHLKRKYLCKTEDEVRAAWAPGDLGYNTR  560

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             P DML++ + LCYSVIAP+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMHT
Sbjct  561  VPNDMLIVTVVLCYSVIAPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMHT  620

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            R++AAL++YQ TMIG    K+F Y+ ++ PL  +S +FA+ C  +FY
Sbjct  621  RIIAALMVYQATMIGIITAKRFYYSTILFPLLAISLIFAYTCHTRFY  667



>ref|XP_004955452.1| PREDICTED: uncharacterized membrane protein C24H6.13-like [Setaria 
italica]
Length=738

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 185/230 (80%), Gaps = 2/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPS+SH VRA++GKYFYF V NVF+  T+G +L  +LK+I +N N  + +   +
Sbjct  451  LSKAEGIPSQSHVVRASAGKYFYFIVFNVFLIYTLGKSLITSLKTILNNANITVIINMLA  510

Query  508  lpss--aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
                  ATFFLTFVALKFFVGYGLELSR+VPL+IFHLK+KY+CKT+ ++K AW PGDLGY
Sbjct  511  TSLPGGATFFLTFVALKFFVGYGLELSRVVPLVIFHLKRKYLCKTEDDVKAAWYPGDLGY  570

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            +TR P DML+  + LCYSV+AP+IIPFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPH
Sbjct  571  STRVPNDMLIATVTLCYSVMAPLIIPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPH  630

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            MHTR++AAL+LYQ TMIG  G+KKF Y+P+++PL  +S +FA++C  +FY
Sbjct  631  MHTRIIAALLLYQATMIGVIGLKKFYYSPILVPLLPISIIFAYICHMRFY  680



>gb|AAL47004.1|AF448811_1 unknown [Davidia involucrata]
Length=226

 Score =   289 bits (739),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  490  FFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDM  311
            FFLT+VALKFFVGYGLELSRIVPLII+HLK+KY+CKT AE+KEAW+PGDLGYATRFPGDM
Sbjct  8    FFLTYVALKFFVGYGLELSRIVPLIIYHLKRKYLCKTQAELKEAWSPGDLGYATRFPGDM  67

Query  310  LVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAA  131
            L++ I LCYSVIAPII+PFG +YFGLGWL+LRNQ LKVYVPS+ESYG+MWPHMHTR++AA
Sbjct  68   LIITIVLCYSVIAPIIVPFGVLYFGLGWLVLRNQVLKVYVPSYESYGRMWPHMHTRILAA  127

Query  130  LILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            L+LYQ+TM GYFGVKKF Y P++IPLPILS +FAFVC KKFY 
Sbjct  128  LLLYQVTMFGYFGVKKFYYVPILIPLPILSLIFAFVCKKKFYH  170



>gb|EMS64036.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=548

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 180/228 (79%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ +  NP  I   LAT 
Sbjct  263  LSKSEGIPSQSHVVRAASGKYFYFIVFNVFIGYAIGSSLFSALEKVIKNPTGIFMTLATR  322

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFF TFVAL+ FVGYGLELSR+VPLIIFHLK+KY+CKT+ E++ AW PG+L Y T
Sbjct  323  LPGTATFFFTFVALRCFVGYGLELSRLVPLIIFHLKRKYICKTEDEVRAAWVPGNLRYNT  382

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVI P+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  383  RVPNDMLIVTIVLCYSVITPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMH  442

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ TMIG   +KKF Y+ ++ PL ++S +FA  C  +FY
Sbjct  443  TRIIAALMIYQATMIGIISLKKFYYSTILTPLLVISLIFARTCHARFY  490



>gb|EMT14905.1| Putative membrane protein [Aegilops tauschii]
Length=676

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 179/228 (79%), Gaps = 0/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK+EGIPS+SH VRAASGKYFYF V NVFIG  IGS+LF  L+ +  NP  I   LAT 
Sbjct  391  LSKSEGIPSQSHVVRAASGKYFYFIVFNVFIGYAIGSSLFSALEKVIKNPPGIFMTLATR  450

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFF TFVAL+ FVGYGLELSR+VPLIIFHLK+KY CKT+ E++ AW PG+L Y T
Sbjct  451  LPGNATFFFTFVALRCFVGYGLELSRLVPLIIFHLKRKYQCKTEEEVRAAWVPGNLRYNT  510

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVI P+I+PFG  YF LGWL+ +NQ L+VYVPS+ES G+MWPHMH
Sbjct  511  RVPNDMLIVTIVLCYSVITPLILPFGVAYFALGWLIAKNQVLRVYVPSYESNGRMWPHMH  570

Query  148  TRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            TR++AAL++YQ TMIG   +KKF Y+ ++ PL ++S +FA  C  +FY
Sbjct  571  TRIIAALMIYQATMIGIISLKKFYYSTILAPLLVISLIFAHTCHARFY  618



>ref|XP_002990725.1| hypothetical protein SELMODRAFT_41467, partial [Selaginella moellendorffii]
 gb|EFJ08174.1| hypothetical protein SELMODRAFT_41467, partial [Selaginella moellendorffii]
Length=706

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 187/227 (82%), Gaps = 0/227 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            S+ EGI S+SH  RAA+GKYFYF V NVF+G+TI S+LFDT+K I+  PNS +SLL  ++
Sbjct  442  SRMEGIVSQSHVERAAAGKYFYFNVFNVFLGITITSSLFDTVKKIQKEPNSTVSLLGAAI  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +A+FF+TF+AL+FFVGYGL+LSR+VPLIIF +KKKY+CKT  +I+ AWAP D  YATR
Sbjct  502  PPAASFFITFIALRFFVGYGLQLSRLVPLIIFRIKKKYLCKTKEDIRAAWAPKDFSYATR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGDML+L I LCY+VIAP+++PF  VYF   W++ R++ALKV VP++ESYG+MWPH+HT
Sbjct  562  VPGDMLILTIALCYAVIAPMVLPFALVYFAFAWIIARHEALKVVVPAYESYGRMWPHIHT  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            R++AAL++ QL M+GYF +KKF ++P+++PLPI + LFA + +K +Y
Sbjct  622  RIIAALLVSQLAMLGYFSIKKFVFSPILVPLPIATLLFALITNKIYY  668



>gb|AAX92695.1| early-responsive to dehydration stress protein [Picea abies]
Length=284

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSKAEGIPSESHAVRA+SGKYFYF   NVF+GVT G TLF++LK +E  PNSII+LL  S
Sbjct  89   LSKAEGIPSESHAVRASSGKYFYFIAFNVFLGVTSGGTLFESLKEVEKKPNSIITLLGNS  148

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFF++FVALKFFVGYGLEL+R+VPL+I+H+KK+++CKT+AE++EAWAPG  GYAT
Sbjct  149  LPPNATFFISFVALKFFVGYGLELTRLVPLVIYHIKKRFLCKTEAEVQEAWAPGGFGYAT  208

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMH  149
            R P DML++ I LCYSVIAP+I+PF  VYF +GW +LRNQAL VYVPS+ES G+MWPHMH
Sbjct  209  RVPNDMLIITIALCYSVIAPMILPFALVYFLVGWFVLRNQALNVYVPSYESNGRMWPHMH  268

Query  148  TRVVAALILYQLTMIG  101
            TR++AAL + Q+TMIG
Sbjct  269  TRILAALFISQVTMIG  284



>ref|XP_002986705.1| hypothetical protein SELMODRAFT_41460, partial [Selaginella moellendorffii]
 gb|EFJ12268.1| hypothetical protein SELMODRAFT_41460, partial [Selaginella moellendorffii]
Length=706

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 187/227 (82%), Gaps = 0/227 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            S+ EGI S+SH  RAA+GKYFYF V NVF+G+TI S+LFDT+K I+  PNS +SLL  ++
Sbjct  442  SRMEGIVSQSHVERAAAGKYFYFNVFNVFLGITITSSLFDTVKKIQKEPNSTVSLLGAAI  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +A+FF+TF+AL+FFVGYGL+LSR+VPLI+F +KKKY+CKT  +I+ AWAP D  YATR
Sbjct  502  PPAASFFITFIALRFFVGYGLQLSRLVPLIMFRIKKKYLCKTKEDIRAAWAPKDFSYATR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHT  146
             PGDML+L I LCY+VIAP+++PF  VYF   W++ R++ALKV VP++ESYG+MWPH+HT
Sbjct  562  VPGDMLILTIALCYAVIAPMVLPFALVYFAFAWIIARHEALKVVVPAYESYGRMWPHIHT  621

Query  145  RVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            R++AAL++ QL M+GYF +KKF ++P+++PLPI + LFA + +K +Y
Sbjct  622  RIIAALLVSQLAMLGYFSIKKFVFSPILVPLPIATLLFALITNKIYY  668



>gb|AGV54580.1| early-responsive to dehydration 4 [Phaseolus vulgaris]
Length=643

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 163/198 (82%), Gaps = 2/198 (1%)
 Frame = -3

Query  592  VTIGSTLFDTLKSIEDNPNsiisllatslps--saTFFLTFVALKFFVGYGLELSRIVPL  419
            VTIG TLF     I+ NP+        +     +ATFFLT+VALKFFVGYGLELSRIVPL
Sbjct  390  VTIGGTLFKAFNKIQKNPSLSEISSLLAESLPGNATFFLTYVALKFFVGYGLELSRIVPL  449

Query  418  IIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYF  239
            II+HLK+KY+CKT+AE+KEAW PGDLGY TR PGDML++ I  CYSVIAP+IIPFG +YF
Sbjct  450  IIYHLKRKYLCKTEAELKEAWRPGDLGYGTRVPGDMLIVTIVFCYSVIAPVIIPFGVLYF  509

Query  238  GLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVI  59
            GLGWL+LRNQALKVYVPS+ESYG+MWPH+H RV+A+LILYQ+TM GYFG +KF Y PLV+
Sbjct  510  GLGWLVLRNQALKVYVPSYESYGRMWPHIHNRVLASLILYQITMFGYFGAQKFYYTPLVL  569

Query  58   PLPILSFLFAFVCSKKFY  5
            PLP LS +F FVC+KKFY
Sbjct  570  PLPFLSLIFGFVCAKKFY  587



>ref|XP_001770612.1| predicted protein [Physcomitrella patens]
 gb|EDQ64595.1| predicted protein [Physcomitrella patens]
Length=734

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 171/235 (73%), Gaps = 7/235 (3%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIE---DNPNsiisll  518
            LS+ EG P++S  VR+AS KYFYF + NVF+GVTI   +F  L S +   D  N  +S +
Sbjct  441  LSRLEGFPAQSQIVRSASAKYFYFVIFNVFLGVTIFGAVFSNLSSFQVLLDQSNLSVSRV  500

Query  517  atslps----saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAP  350
               L S     A++F+T+VAL+FFVGYGLELSRI+P IIFHLK+K+ CKTD E++EAWAP
Sbjct  501  VQLLGSKLPPVASYFITYVALRFFVGYGLELSRIIPFIIFHLKRKFKCKTDREVREAWAP  560

Query  349  GDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYG  170
            G   Y      DML+L I LCY+VIAP+I+ F A YFGLGWL++RNQAL V+VP FES+G
Sbjct  561  GAFKYHKSVASDMLILTITLCYAVIAPLILIFAAAYFGLGWLVMRNQALNVHVPDFESHG  620

Query  169  KMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
              WPH+H RV+AAL + Q+T IGYFG+K+FP++P +I LPIL+ +F   C K +Y
Sbjct  621  SFWPHIHNRVLAALFVAQITAIGYFGIKEFPFSPFLIVLPILTVVFYMFCKKNYY  675



>gb|AGV54368.1| early-responsive to dehydration [Phaseolus vulgaris]
Length=515

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 137/152 (90%), Gaps = 0/152 (0%)
 Frame = -3

Query  460  FVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDMLVLIICLCYS  281
            FVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR PGDML++ I  CYS
Sbjct  308  FVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYGTRVPGDMLIVTIVFCYS  367

Query  280  VIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAALILYQLTMIG  101
            VIAP+IIPFG +YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H RV+A+LILYQ+TM G
Sbjct  368  VIAPVIIPFGVLYFGLGWLVLRNQALKVYVPSYESYGRMWPHIHNRVLASLILYQITMFG  427

Query  100  YFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            YFG +KF Y PLV+PLP LS +F FVC+KKFY
Sbjct  428  YFGAQKFYYTPLVLPLPFLSLIFGFVCAKKFY  459



>ref|XP_001766729.1| predicted protein [Physcomitrella patens]
 gb|EDQ68360.1| predicted protein [Physcomitrella patens]
Length=752

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 174/234 (74%), Gaps = 7/234 (3%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            S+ EGIPS+SH VRAASGKYFYF + NVF+GVT+  T+F +L   +   NS    +++ +
Sbjct  441  SRMEGIPSQSHVVRAASGKYFYFVIFNVFLGVTLFGTVFSSLAGFQTLLNSKNFSVSSVV  500

Query  505  ps-------saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPG  347
                      A +F+TFVAL+FFVGYGLELSR+VPL ++HLK+K++CKT+ E++EAW PG
Sbjct  501  TLFGSKLPPVAAYFITFVALQFFVGYGLELSRVVPLSVYHLKRKFLCKTEKELEEAWEPG  560

Query  346  DLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGK  167
               Y T  P D+L+L+I + Y+VIAP+I+ F  VYF +G+++LRNQALKVYVP FES G+
Sbjct  561  PFEYQTLVPNDILILMISMAYAVIAPMILLFAIVYFAIGYVVLRNQALKVYVPEFESGGR  620

Query  166  MWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            MWPH+HTR+V AL + Q+TM+GY G+KKFPYA LVI LP+ +  FA +C   +Y
Sbjct  621  MWPHIHTRIVVALFIGQITMMGYMGIKKFPYAVLVIILPLFTIFFASMCKMNYY  674



>gb|KHN47349.1| Putative membrane protein C24H6.13 [Glycine soja]
Length=683

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 165/229 (72%), Gaps = 43/229 (19%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP--Nsiisllat  512
            SK EGIP+ESHAVRAASGKYFYFTVLNVFIGVTIG TLF   K I ++P  + I SLLA 
Sbjct  440  SKFEGIPTESHAVRAASGKYFYFTVLNVFIGVTIGGTLFKAFKRIREHPTLDEISSLLAE  499

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            SLP +ATFFLT+VALKFF+GYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY 
Sbjct  500  SLPGNATFFLTYVALKFFIGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWRPGDLGYG  559

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            TR PGDML++ I  CYSVIAP+IIPFGA+YFGLGWL+LRNQ                   
Sbjct  560  TRVPGDMLIVTIVFCYSVIAPVIIPFGALYFGLGWLVLRNQ-------------------  600

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
                                  KF Y PLV+PLPILS +F FVC+KKFY
Sbjct  601  ----------------------KFYYTPLVLPLPILSLIFGFVCAKKFY  627



>ref|XP_001754029.1| predicted protein [Physcomitrella patens]
 gb|EDQ81351.1| predicted protein [Physcomitrella patens]
Length=751

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 172/235 (73%), Gaps = 7/235 (3%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LS+ EGIPS+SH VR ASGKYFYF V NVF+GVT+  T+F +L   +   NS    +++ 
Sbjct  440  LSRMEGIPSQSHVVRGASGKYFYFIVFNVFLGVTLFGTVFSSLAGFQTLFNSKNFSVSSV  499

Query  508  lps-------saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAP  350
            +          A +F+TFVAL+FFVGYGLELSR+VPL ++HLKK + CKT  E++EAW P
Sbjct  500  VSLFGSKLPPVAAYFITFVALQFFVGYGLELSRVVPLAVYHLKKTFFCKTQKELEEAWEP  559

Query  349  GDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYG  170
            G   Y    P D+L+L+I + Y+VIAP+I+ F  +YF +G+++LRNQALKVYVP+FES G
Sbjct  560  GPFEYHNLVPNDILILMISMAYAVIAPMILLFALLYFAIGYVVLRNQALKVYVPAFESGG  619

Query  169  KMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +MWPH+H+R+VAAL + Q+TM+GY G+KKFPYA LVI LP+ +  FA +C   +Y
Sbjct  620  RMWPHIHSRIVAALFIGQVTMMGYMGIKKFPYAVLVIILPLFTIFFASMCKMNYY  674



>ref|XP_001762227.1| predicted protein [Physcomitrella patens]
 gb|EDQ73019.1| predicted protein [Physcomitrella patens]
Length=733

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 171/235 (73%), Gaps = 7/235 (3%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-------EDNPNsi  530
            LS AEG PS+S  VR+AS KYFYF + NVF+GVTI   +F  L S+       + + N +
Sbjct  440  LSHAEGFPSQSQVVRSASSKYFYFIIFNVFLGVTIFGAVFSNLSSVKILVQQSQLSANKV  499

Query  529  isllatslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAP  350
            ++LL + LP  A++++T+VAL+FF+GYGLELSR++PL IFH K+K+ CKT+ E+KEAWAP
Sbjct  500  VTLLGSKLPPVASYYITYVALRFFIGYGLELSRLIPLCIFHFKRKFKCKTERELKEAWAP  559

Query  349  GDLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYG  170
            G   Y    P D+L+L I LCYSVIAP++IPF   Y+ LGW + RNQAL V+VP FES+G
Sbjct  560  GAFTYHKSIPNDLLILTISLCYSVIAPMVIPFAFTYYVLGWFVQRNQALNVHVPDFESHG  619

Query  169  KMWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
             MWPH+H R++AAL + Q+T +GYFGVK+F + P++I LP+ + +F   C K +Y
Sbjct  620  SMWPHIHNRILAALFVAQITALGYFGVKEFLFTPILIILPVATVIFYMFCKKNYY  674



>ref|XP_001761096.1| predicted protein [Physcomitrella patens]
 gb|EDQ74163.1| predicted protein [Physcomitrella patens]
Length=740

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 170/235 (72%), Gaps = 7/235 (3%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIE---DNPNsiislla  515
            SKAEGIPS+SH  RAASGKYFYF + NVF+GVTI   +F + K  +   D     +S + 
Sbjct  440  SKAEGIPSKSHISRAASGKYFYFMIFNVFLGVTIFGAVFSSFKGFKVLIDQQQLSVSKVV  499

Query  514  tslpss----aTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPG  347
                +     +T+F+T+VALKFFVGYGLE+SRI+PLII+H+K+K++CKT+ E+++AWAPG
Sbjct  500  ELFGTKLPPVSTYFITYVALKFFVGYGLEISRIIPLIIYHIKRKFLCKTERELEDAWAPG  559

Query  346  DLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGK  167
               Y T  P D+LV+ + L YSVIAP+I+ F  +YF +GWL++RN AL VYVP +ES G+
Sbjct  560  SFSYHTSVPSDLLVVTLTLSYSVIAPMILVFAFLYFAIGWLVMRNSALNVYVPEWESNGR  619

Query  166  MWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFYR  2
            MWPH+H R++ AL++ Q+T +G+F VKKFPY   +I LP+ +F F   C + FY+
Sbjct  620  MWPHIHNRILVALLVSQITALGFFAVKKFPYTVFLIFLPLATFAFYLYCKRNFYK  674



>ref|XP_001776984.1| predicted protein [Physcomitrella patens]
 gb|EDQ58233.1| predicted protein [Physcomitrella patens]
Length=744

 Score =   254 bits (650),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 168/234 (72%), Gaps = 7/234 (3%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP++SH  RAA+GKY+YF V NVF+G+TI   +F +    ++  N     ++  +
Sbjct  440  SKTEGIPTKSHIERAAAGKYYYFMVFNVFLGITIFGAVFSSSAGFKELINQSSISVSKVV  499

Query  505  ps-------saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPG  347
                      AT+++TFVALKFFVGYGLE+SRIVPLIIFH+K+KY+CKT+ E++EAWAPG
Sbjct  500  ELLGSKLPPVATYYITFVALKFFVGYGLEISRIVPLIIFHIKRKYLCKTERELEEAWAPG  559

Query  346  DLGYATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGK  167
               Y T  P D+L+LI+ LCYSVIAP+I+ F  +YF +GWL+ RN ALKV VP +ES G+
Sbjct  560  PFSYHTSVPADLLILIVTLCYSVIAPMILVFSFLYFFIGWLVTRNSALKVQVPEWESNGR  619

Query  166  MWPHMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            MWPH+H R + +L++ Q+T +GYF V++FPY   +I LPIL+F F   C + FY
Sbjct  620  MWPHIHNRFLGSLLVSQITALGYFAVQQFPYTVFLIFLPILTFGFYVYCKRNFY  673



>gb|EYU19152.1| hypothetical protein MIMGU_mgv1a001965mg [Erythranthe guttata]
Length=626

 Score =   252 bits (644),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPSESHA RAASGKYFYF+VLNVFIGVTIGSTLF T K IE++PNSI+ LLA S
Sbjct  446  LSKQEGIPSESHAQRAASGKYFYFSVLNVFIGVTIGSTLFTTFKEIEEHPNSIVDLLAKS  505

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP SATFFLTFVALKFFVGYG+ELSRI+PL+++HL+KKY+CK++ E++EAWAPGDLGYAT
Sbjct  506  LPGSATFFLTFVALKFFVGYGIELSRIIPLLVYHLQKKYVCKSENELREAWAPGDLGYAT  565

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQAL  203
            R PGDML++ I LCYSVIAP+IIPFG VYFGLGWL+LRNQ +
Sbjct  566  RIPGDMLIVTIVLCYSVIAPLIIPFGIVYFGLGWLVLRNQVI  607



>ref|XP_001766634.1| predicted protein [Physcomitrella patens]
 gb|EDQ68487.1| predicted protein [Physcomitrella patens]
Length=749

 Score =   253 bits (645),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 174/231 (75%), Gaps = 7/231 (3%)
 Frame = -3

Query  676  EGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL---KSIEDNPNsiisllatsl  506
            EGIPS+SH VRAASGKYFYF V NVF+GVT+  T+F ++   K + ++ N  +S + T  
Sbjct  444  EGIPSQSHLVRAASGKYFYFIVFNVFLGVTLFGTVFSSIAGFKELRNSKNFSVSSVVTLF  503

Query  505  ps----saTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLG  338
             S     A +F+T+VAL+ F+GYGLELSR+VPL I+HLK++++ KT  E+  AWAP    
Sbjct  504  GSRLPPVAAYFITYVALQNFIGYGLELSRVVPLAIYHLKRRFLIKTQKELDAAWAPPAFT  563

Query  337  YATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWP  158
            Y T  P D+L+L+I + Y+VIAP+I+ F  +YF +G+++LRNQALKVYVP+FES G+MWP
Sbjct  564  YHTLVPTDILILMISMAYAVIAPLILVFALLYFAIGYVVLRNQALKVYVPAFESGGRMWP  623

Query  157  HMHTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            H+HTR+V AL + Q+TMIGYFG+KKFPYA LVI LP+++ +FA +C   +Y
Sbjct  624  HIHTRIVVALFVGQITMIGYFGIKKFPYAVLVILLPLITIIFATMCRINYY  674



>gb|KDO75369.1| hypothetical protein CISIN_1g004795mg [Citrus sinensis]
Length=615

 Score =   244 bits (623),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  685  SKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllatsl  506
            SK EGIP+ SHAVRAASGKYFYFTVLNVFIGVT+G TLF T KSIE +PNSI+ +LA SL
Sbjct  442  SKTEGIPAVSHAVRAASGKYFYFTVLNVFIGVTVGGTLFKTFKSIEKDPNSIVDVLANSL  501

Query  505  pssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATR  326
            P +ATFFLT+VAL+FFVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGY TR
Sbjct  502  PGNATFFLTYVALQFFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYGTR  561

Query  325  FPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYV  191
             P DML++ I  CYS IAP+IIPFG VYF LGWL+LRNQ + +++
Sbjct  562  VPSDMLIVTIVFCYSCIAPLIIPFGVVYFALGWLILRNQVMSIFL  606



>gb|KJB57182.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=610

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SH +RAASGKYFYF V NVFIGVTIG TLF ++K+IE+ PNS+  +LA S
Sbjct  441  LSKTEGIPSGSHVIRAASGKYFYFIVFNVFIGVTIGGTLFASIKTIEEKPNSVFDMLAKS  500

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ YAT
Sbjct  501  LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYAT  560

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQ  209
            R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQ
Sbjct  561  RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQ  600



>gb|KJB57184.1| hypothetical protein B456_009G152500 [Gossypium raimondii]
Length=622

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SH +RAASGKYFYF V NVFIGVTIG TLF ++K+IE+ PNS+  +LA S
Sbjct  441  LSKTEGIPSGSHVIRAASGKYFYFIVFNVFIGVTIGGTLFASIKTIEEKPNSVFDMLAKS  500

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
            LP +ATFFLTFVALKFFVGYGLELSRIVPLII+HLK+KY+CK +AE++EAW PGD+ YAT
Sbjct  501  LPGNATFFLTFVALKFFVGYGLELSRIVPLIIYHLKRKYLCKNEAELREAWFPGDINYAT  560

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQ  209
            R P DML++ I LCYSVIAP+IIPFG +YF LGWL+LRNQ
Sbjct  561  RVPSDMLIVTIVLCYSVIAPVIIPFGVLYFALGWLVLRNQ  600



>dbj|BAD94517.1| ERD4 protein [Arabidopsis thaliana]
Length=203

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  436  SRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYATRFPGDMLVLIICLCYSVIAPIIIP  257
            SRI+PLIIFHLKKKY+CKT+AE+KEAW PGDL YATR PGDML+L I  CYSVIAP+I+ 
Sbjct  1    SRIIPLIIFHLKKKYLCKTEAEVKEAWYPGDLSYATRVPGDMLILTITFCYSVIAPLILI  60

Query  256  FGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVAALILYQLTMIGYFGVKKFP  77
            FG  YFGLGWL+LRNQALKVYVPS+ESYG+MWPH+H R++AAL L+Q+ M GY G K F 
Sbjct  61   FGITYFGLGWLVLRNQALKVYVPSYESYGRMWPHIHQRILAALFLFQVVMFGYLGAKTFF  120

Query  76   YAPLVIPLPILSFLFAFVCSKKFY  5
            Y  LVIPL I S +F +VC +KFY
Sbjct  121  YTALVIPLIITSLIFGYVCRQKFY  144



>ref|XP_007024954.1| Early-responsive to dehydration stress protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY27576.1| Early-responsive to dehydration stress protein isoform 2, partial 
[Theobroma cacao]
Length=618

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 125/160 (78%), Gaps = 18/160 (11%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            LSK EGIPS SH VRAASGKYFYFTV NVFIGVT+G+TLF T KSIE +PN         
Sbjct  440  LSKTEGIPSGSHVVRAASGKYFYFTVFNVFIGVTVGATLFSTFKSIEKDPN---------  490

Query  508  lpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYAT  329
                     +   L  FVGYGLELSRIVPLII+HLK+KY+CKT+AE+KEAW PGDLGYAT
Sbjct  491  ---------SIFDLLAFVGYGLELSRIVPLIIYHLKRKYLCKTEAELKEAWFPGDLGYAT  541

Query  328  RFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQ  209
            RFPGDML+L I LCYSVIAP+IIPFG +YF LGWL+LRNQ
Sbjct  542  RFPGDMLILTIVLCYSVIAPVIIPFGVLYFALGWLILRNQ  581



>gb|AFK47057.1| unknown [Medicago truncatula]
Length=160

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = -3

Query  313  MLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHMHTRVVA  134
            M ++ I LCYS IAP+IIPFGA+YFGLGWL+LRNQALKVYVP +ESYG+MWPH++ R++A
Sbjct  1    MQIVTIVLCYSCIAPLIIPFGALYFGLGWLVLRNQALKVYVPRYESYGRMWPHINNRILA  60

Query  133  ALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKFY  5
            +++LYQ+TM GYFGV++F YAPL+IPLPIL+ LF F+CSKKFY
Sbjct  61   SMVLYQVTMFGYFGVQQFVYAPLLIPLPILTVLFGFICSKKFY  103



>ref|XP_006287199.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
 gb|EOA20097.1| hypothetical protein CARUB_v10000374mg [Capsella rubella]
Length=685

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYNQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F
Sbjct  625  HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFNRYCAGRF  673



>gb|AAC79116.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  340  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  399

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  400  SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  459

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  460  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYESGARYWPDV  519

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F
Sbjct  520  HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRF  568



>ref|XP_002874888.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51147.1| hypothetical protein ARALYDRAFT_352535 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  453  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  512

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  513  SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  572

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  573  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYESGARYWPDV  632

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F
Sbjct  633  HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRF  681



>ref|NP_192199.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q9SY14.1|CSCL2_ARATH RecName: Full=CSC1-like protein At4g02900 [Arabidopsis thaliana]
 gb|AAD15333.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77775.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82248.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34619.1| hyperosmolality-gated Ca2+ permeable channel 1.7 [Arabidopsis 
thaliana]
Length=785

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KKF     L++P PIL+F F   C+ +F
Sbjct  625  HRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRF  673



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S+  R ++GKY  F ++NVF+G  I  T F+ L   + ++ N I   +  
Sbjct  444  MSKIEGFTSLSYLERRSAGKYHLFILVNVFLGSIITGTAFEQLHQFVNESANEIPKTVGA  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T+  +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG + +A
Sbjct  504  TVPMKATFFITYTMVDGWAGIAAEILRLVPLIIFHLKNTFLVKTEKDREQAMDPGSIAFA  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++ L YSV+API++PF  V+FGL +L+ R+Q + VY   +ES    WP +
Sbjct  564  SSEPRIQLYFLLGLVYSVVAPILLPFIVVFFGLAYLVFRHQIINVYDQKYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++  +I+ QL ++G    K    + PL++ LPIL+  F  +C  +F
Sbjct  624  HWRLIIGMIISQLLLMGLLSTKDAELSTPLLVVLPILTIWFHRICKNRF  672



>ref|XP_007040776.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma 
cacao]
 gb|EOY25277.1| Early-responsive to dehydration stress protein isoform 1 [Theobroma 
cacao]
Length=791

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R AS KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446  MSKIEGHIALSTLERRASAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + Y 
Sbjct  506  SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREKAMDPGSVDYP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLMGLLSTKKAANSTPLLVILPILTLAFHKYCKNRF  674



>ref|XP_010422520.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 137/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KK      L++P PIL+F F   C+ +F
Sbjct  625  HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQPILTFWFNRYCAGRF  673



>ref|XP_010430503.1| PREDICTED: CSC1-like protein At4g02900 [Camelina sativa]
Length=770

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 137/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KK      L++P PIL+F F   C+ +F
Sbjct  625  HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQPILTFWFNRYCAGRF  673



>ref|XP_007040777.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma 
cacao]
 gb|EOY25278.1| Early-responsive to dehydration stress protein isoform 2 [Theobroma 
cacao]
Length=804

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R AS KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446  MSKIEGHIALSTLERRASAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + Y 
Sbjct  506  SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREKAMDPGSVDYP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLMGLLSTKKAANSTPLLVILPILTLAFHKYCKNRF  674



>ref|XP_006396516.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
 gb|ESQ37969.1| hypothetical protein EUTSA_v10029277mg, partial [Eutrema salsugineum]
Length=766

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 137/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVIFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KK   A  L++P PIL+  F   C+ +F
Sbjct  625  HRRLIICLIISQLLMMGLLSTKKLAKATALLLPQPILTIWFNRYCAGRF  673



>gb|KDP46674.1| hypothetical protein JCGZ_12198 [Jatropha curcas]
Length=797

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R A+ KY+YF ++NVF+G  I  T F+ L S +  +P  I   +  
Sbjct  446  MSKIEGYIAVSTLERRAAAKYYYFMLVNVFLGSIIAGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENAMDPGSVDFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F L +L+ R+Q + VY   +ES G  WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFALAYLVYRHQIINVYNQQYESAGAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLMGLLSTKKAANSTPLLVILPILTLTFHKYCKSRF  674



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 137/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+G  I  T F+ L S I  + N +   +  
Sbjct  448  MSKFEGFTSLSSLERRSASRYYLFQLVNVFLGSIITGTAFEQLNSFIHQSANEVPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGIAGEILRVKPLIIYHLKNFFLVKTEKDREEAMDPGSLGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+FGL +L+ R+Q + VY   +ES    WP +
Sbjct  568  TGEPQIQLYFLLGLVYAVVTPILLPFIVVFFGLAYLVFRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  628  HGRIITALIISQLLLMGLLSTKRAAQSTPLLIALPVLTIWFHRFCKSRY  676



>ref|XP_002973564.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
 gb|EFJ25224.1| hypothetical protein SELMODRAFT_442177 [Selaginella moellendorffii]
Length=759

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  + S    + S KY+YF V+NVF    I    F+ LK+  + +P+ I  +LA 
Sbjct  446  MSKIEGHLALSQLEVSTSAKYYYFMVVNVFFASVIAGAAFEQLKTFFQQSPSQIPVILAG  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  +     ++ RI PLI++HLK  ++ KTD + + A +PG  G+ 
Sbjct  506  SIPQKATFFITYIMVDGWASIAADIMRIKPLIVYHLKNMFLVKTDKDRENAMSPGSAGFD  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T FP   L  ++   YS+I P I+PF  VY    +++ R+Q + VY P +ES    WPH+
Sbjct  566  TVFPQLELYFLLGTVYSIITPFILPFIIVYLAFAYVVYRHQVINVYDPEYESAAAFWPHI  625

Query  151  HTRVVAALILYQLTMIGYF-GVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H R++ +L++ Q+T+ G F G +     PL+I LPI++ +F + C  +F
Sbjct  626  HNRIIVSLLVEQITLFGVFAGKRAAASTPLLIGLPIMTIVFHYYCKNRF  674



>ref|XP_002975592.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
 gb|EFJ23221.1| hypothetical protein SELMODRAFT_150725 [Selaginella moellendorffii]
Length=759

 Score =   152 bits (385),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  + S    + S KY+YF V+NVF    I    F+ LK+  + +P+ I  +LA 
Sbjct  446  MSKIEGHLALSQLEVSTSAKYYYFMVVNVFFASVIAGAAFEQLKTFFQQSPSQIPVILAG  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  +     ++ RI PLI++HLK  ++ KTD + + A +PG  G+ 
Sbjct  506  SIPQKATFFITYIMVDGWASIAADIMRIKPLIVYHLKNMFLVKTDKDRENAMSPGSAGFD  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T FP   L  ++   YS+I P I+PF  VY    +++ R+Q + VY P +ES    WPH+
Sbjct  566  TVFPQLELYFLLGTVYSIITPFILPFIIVYLAFAYVVYRHQVINVYDPEYESAAAFWPHI  625

Query  151  HTRVVAALILYQLTMIGYF-GVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H R++ +L++ Q+T+ G F G +     PL+I LPI++ +F + C  +F
Sbjct  626  HNRIIVSLLVEQITLFGVFAGKRAAASTPLLIGLPIMTIVFHYYCKNRF  674



>ref|XP_010664612.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Vitis vinifera]
Length=624

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            LSK EG  + S   R +S KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  298  LSKIEGYIALSTLERRSSAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  357

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + + 
Sbjct  358  SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREHAMNPGSVDFP  417

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   + + R+Q + VY   +ES    WPH+
Sbjct  418  ETIPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYFIYRHQVINVYNQQYESGAAFWPHV  477

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + PL+I LPIL+  F   C  +F
Sbjct  478  HSRIIASLLISQLLLMGLLSTKKAANSTPLLIALPILTLTFHKYCKNRF  526



>gb|KFK30892.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=693

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  370  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  429

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  430  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNAFLVKTEQDRQQAMDPGHLDFA  489

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  490  TTEPRIQFYFLLGLVYAAVTPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  549

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KK   A  L++P PIL+  F   C+ +F
Sbjct  550  HRRLIICLIISQLLMMGLLSTKKLAKATVLLLPQPILTIWFNRYCAGRF  598



>gb|KFK30891.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=684

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  361  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  420

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  421  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNAFLVKTEQDRQQAMDPGHLDFA  480

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  481  TTEPRIQFYFLLGLVYAAVTPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  540

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KK   A  L++P PIL+  F   C+ +F
Sbjct  541  HRRLIICLIISQLLMMGLLSTKKLAKATVLLLPQPILTIWFNRYCAGRF  589



>ref|XP_001782141.1| predicted protein [Physcomitrella patens]
 gb|EDQ53035.1| predicted protein, partial [Physcomitrella patens]
Length=735

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 130/230 (57%), Gaps = 3/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            ++K EG  + S   R A+ KY+ F V+N+F G     T F  LK+   + + +  L   +
Sbjct  460  ITKLEGHLAVSKIERRAAAKYYIFVVVNIFFGSIFTGTAFQQLKTFVTSSSFLDFLNTLA  519

Query  508  lp--ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
                  A+FF+T++ +  + G   E+ R+ PL+ +H++    C+TD +  EA  PG L  
Sbjct  520  SSIPQKASFFITYIMVDGWSGPAGEILRLKPLVKYHIRNMLFCRTDKDRLEAADPGTLSL  579

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
                P   L  ++ L YSVI PIIIPF  V+ G G+L+ RNQ + VY P +ES G  W H
Sbjct  580  DESLPQLQLYFLMGLVYSVITPIIIPFIVVFMGFGFLVYRNQVINVYDPEYESAGAFWTH  639

Query  154  MHTRVVAALILYQLTMIGYFGVKK-FPYAPLVIPLPILSFLFAFVCSKKF  8
            +H R++AALI+  LT+IG F V + F   P ++ LPIL+ +F   C K+F
Sbjct  640  VHGRIIAALIIEHLTLIGLFLVNESFSSTPFMVALPILTLVFHNYCKKRF  689



>ref|XP_001754358.1| predicted protein [Physcomitrella patens]
 gb|EDQ80808.1| predicted protein, partial [Physcomitrella patens]
Length=734

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 138/230 (60%), Gaps = 3/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsi--islla  515
            LSK EG  S S   R A+ KY+YF V+N+F G  +  + F  LK+   + + +  ++ +A
Sbjct  460  LSKFEGHLSISKLERRAAAKYYYFVVVNIFFGSILTGSAFQQLKTFVTSSSVLGFLNTIA  519

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
             S+P  A+FF+T++ +  + G   E+ R+ PL+ +H+K    CKTD++  EA +PG L  
Sbjct  520  LSIPQKASFFITYIMVDGWSGPAGEILRLTPLVKYHVKNTLFCKTDSDRLEAASPGTLTL  579

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
                P   L  ++ L YSVI P+IIPF  V+ G G+++ R+Q + VY  ++ES G  WPH
Sbjct  580  DETLPQLQLYFLMGLVYSVITPVIIPFIVVFMGFGFVVYRHQIINVYDSAYESAGSFWPH  639

Query  154  MHTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            +H R++AALI+  +T+I  F VK      P +I LP+L+ +F   C K+F
Sbjct  640  VHGRIIAALIIEHVTLISLFLVKDSCSSTPFMIALPVLTLVFNNYCKKRF  689



>ref|XP_002519965.1| Extensin-3 precursor, putative [Ricinus communis]
 gb|EEF42569.1| Extensin-3 precursor, putative [Ricinus communis]
Length=830

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 138/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R A+ KY+YF ++NVF+G  I  T F  L S +  +P  I   +  
Sbjct  446  MSKIEGYIAVSTLERRAAAKYYYFMLVNVFLGSIITGTAFQQLHSFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREKAMDPGSVDFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F L +L+ R+Q + VY   +ES G  WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFALAYLVYRHQVINVYNQQYESAGAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    K+   + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLMGLLSTKEAANSTPLLVILPILTLAFHKYCKNRF  674



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 139/229 (61%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            ++K EG  S S   R A+ +Y+ F ++NVF+G  I  +  + LK+ +  +P+ I   +  
Sbjct  449  MAKFEGHTSLSSLERRAASRYYLFALVNVFLGSIIAGSALEQLKTFMHQSPSEIPETIGV  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI++HLK  ++ KTD + +EA  PG +G+ 
Sbjct  509  AIPIKATFFITYIMVDGWAGIAAEILMLKPLIMYHLKNTFLVKTDKDREEAMDPGSIGFH  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            TR P   L +++ L YS + P+++PF  V+FGL +L+ R+Q + VY   +ES    WP +
Sbjct  569  TREPRIQLYILLGLVYSTMTPVLLPFIVVFFGLAYLVFRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVV+ALIL QL ++G    K    + P ++PLPI++  F   C+ ++
Sbjct  629  HGRVVSALILSQLVLMGLLSTKGAKISTPFLLPLPIMTVAFYKYCAGRY  677



>ref|XP_010522696.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Tarenaya hassleriana]
Length=800

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T+V +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG L ++
Sbjct  505  SIPMKATFFITYVMVDGWAGVAAEILRLVPLIIFHLKNTFLVKTEQDRQQAMDPGHLDFS  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  K WP +
Sbjct  565  ISEPRIQFYFLLGLVYAAVTPILLPFIIVFFTFSYIVFRHQVINVYDQKYESGAKYWPSV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++  L++ QL M+G    KK   A  +++PLPIL+  F   C+ +F
Sbjct  625  HRRLIICLLISQLLMMGLLSTKKLAMATAMLLPLPILTIWFNRYCAGRF  673



>ref|XP_010522697.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Tarenaya hassleriana]
Length=785

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T+V +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG L ++
Sbjct  505  SIPMKATFFITYVMVDGWAGVAAEILRLVPLIIFHLKNTFLVKTEQDRQQAMDPGHLDFS  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  K WP +
Sbjct  565  ISEPRIQFYFLLGLVYAAVTPILLPFIIVFFTFSYIVFRHQVINVYDQKYESGAKYWPSV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++  L++ QL M+G    KK   A  +++PLPIL+  F   C+ +F
Sbjct  625  HRRLIICLLISQLLMMGLLSTKKLAMATAMLLPLPILTIWFNRYCAGRF  673



>ref|XP_010522695.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Tarenaya hassleriana]
Length=803

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T+V +  + G   E+ R+VPLIIFHLK  ++ KT+ + ++A  PG L ++
Sbjct  505  SIPMKATFFITYVMVDGWAGVAAEILRLVPLIIFHLKNTFLVKTEQDRQQAMDPGHLDFS  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P      ++ L Y+ + PI++PF  V+F   +++ R+Q + VY   +ES  K WP +
Sbjct  565  ISEPRIQFYFLLGLVYAAVTPILLPFIIVFFTFSYIVFRHQVINVYDQKYESGAKYWPSV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++  L++ QL M+G    KK   A  +++PLPIL+  F   C+ +F
Sbjct  625  HRRLIICLLISQLLMMGLLSTKKLAMATAMLLPLPILTIWFNRYCAGRF  673



>ref|XP_002273732.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Vitis vinifera]
 emb|CBI23272.3| unnamed protein product [Vitis vinifera]
Length=772

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            LSK EG  + S   R +S KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446  LSKIEGYIALSTLERRSSAKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFLVKTERDREHAMNPGSVDFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   + + R+Q + VY   +ES    WPH+
Sbjct  566  ETIPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYFIYRHQVINVYNQQYESGAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + PL+I LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLMGLLSTKKAANSTPLLIALPILTLTFHKYCKNRF  674



>emb|CDY17981.1| BnaC03g30530D [Brassica napus]
Length=769

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVVFHLKNAFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKF  8
            H R+   LI+ QL M+G    KK      L++P PIL+  F   C+ +F
Sbjct  625  HRRLTICLIISQLLMMGLLSTKKLAKVTVLLLPQPILTIWFYRYCAGRF  673



>emb|CDX90914.1| BnaA03g25940D [Brassica napus]
Length=769

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVVFHLKNAFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKF  8
            H R+   LI+ QL M+G    KK      L++P PIL+  F   C+ +F
Sbjct  625  HRRLTICLIISQLLMMGLLSTKKLAKVTVLLLPQPILTIWFYRYCAGRF  673



>ref|XP_009134388.1| PREDICTED: CSC1-like protein At4g02900 [Brassica rapa]
Length=769

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ KYF+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKYFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVVFHLKNAFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAP-LVIPLPILSFLFAFVCSKKF  8
            H R+   LI+ QL M+G    KK      L++P PIL+  F   C+ +F
Sbjct  625  HRRLTICLIISQLLMMGLLSTKKLAKVTVLLLPQPILTIWFYRYCAGRF  673



>gb|KHG26829.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=807

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R AS KY+YF ++NVF+G  +  T F  L S +   P  I   +  
Sbjct  446  MSKIEGHIAISTLERRASAKYYYFMLVNVFLGSIVTGTAFQQLHSFLHQPPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + Y 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREMAMDPGSVDYP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    K+   + PLV+ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLMGLLSTKEAANSTPLVVILPILTLSFHKYCKSRF  674



>gb|KJB51550.1| hypothetical protein B456_008G222200 [Gossypium raimondii]
Length=709

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R AS KY+YF ++NVF+G  +  T F  L S +   P  I   +  
Sbjct  348  MSKIEGHIAISTLERRASAKYYYFMLVNVFLGSIVTGTAFQQLHSFLHQPPTQIPRTIGV  407

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + Y 
Sbjct  408  SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREMAMDPGSVDYP  467

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  468  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  527

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    K+   + PL++ LPIL+  F   C  +F
Sbjct  528  HSRIIASLLISQLLLMGLLSTKEAANSTPLLVILPILTLSFHKYCKSRF  576



>ref|XP_009356857.1| PREDICTED: CSC1-like protein At4g02900 [Pyrus x bretschneideri]
Length=757

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 133/231 (58%), Gaps = 6/231 (3%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            +SK EG+ S SH  R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445  MSKIEGLTSLSHLDRRSAAKYHLFILINVFLGSIVAGTALQQLEKLMNEPSTEFTKTVGR  504

Query  508  lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
                  TFF+T+V +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKGTFFITYVMVDGWSGIAAEILRLVPLILFHLKNTFLVKTEQDREQATDPGSLNFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L YSV+ PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  565  TNEPRTQLYFLLGLVYSVVTPILLPFILIFFAFAYVVYRHQIINVYDQKYESGAAFWPQV  624

Query  151  HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H RV+  LI+ Q+ ++G F   GV K  +  ++IP PIL+  F  VC  +F
Sbjct  625  HLRVIIGLIIAQVLLMGLFSTLGVAKSTF--ILIPQPILTIWFHRVCKGRF  673



>gb|EMS63788.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=792

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R  + KYF F  +NVF+G  +  T F  L S I  + N I   +  
Sbjct  446  MSKIEGHVSLSGLERKTASKYFLFIFVNVFLGSVVAGTAFQQLNSFIHQSTNKIPETIGE  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI+FH+K  ++ +T+ + ++A  PG L + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAAEVLRLKPLIMFHIKNTFLVRTEQDREQAMDPGSLEFG  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++ L Y+V+ PII+PF  V+FGL +L+ R+Q + VY   +ES  + WP +
Sbjct  566  STEPRIQLYFLLGLVYAVVTPIILPFIIVFFGLAYLVFRHQIINVYNQQYESGAQFWPDV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  8
            H R+V AL++ Q+ +IG    ++   + + ++PLP+L+  F +VC  +F
Sbjct  626  HGRIVTALVISQILLIGLLSTQEADQSTVALLPLPVLTIWFHYVCKGRF  674



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            ++K EG PS+S   R A+ +Y+ F+++NVF+G  I  T F+ L S I  +   I   +  
Sbjct  448  MAKFEGYPSKSSLERRAASRYYLFSLVNVFLGSIIAGTAFEQLDSFIHQSATEIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDKDREEAMNPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L L++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYLLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL + G    KK   + P +I LP+L+  F   C  +F
Sbjct  628  HGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLWFHRYCKGRF  676



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            ++K EG PS+S   R A+ +Y+ F ++NVF+G  I  T F+ L+S I  +   I   +  
Sbjct  448  MAKFEGYPSKSSLERRAASRYYLFCLVNVFLGSIITGTAFEQLESFIHQSATDIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNSFLVKTDKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L +++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYVLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYKQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL + G    KK   + P +I LP+L+  F   C  +F
Sbjct  628  HGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLXFHRYCKGRF  676



>ref|XP_008386531.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=757

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 133/231 (58%), Gaps = 6/231 (3%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            +SK EG+ S SH  R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445  MSKIEGLTSLSHLDRRSAAKYHLFILINVFLGSIVTGTALQQLEKLMNEPSTEFTKTVGR  504

Query  508  lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
                  TFF+T+V +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKGTFFITYVMVDGWSGIAAEILRLVPLILFHLKNTFLVKTEQDREQATDPGSLNFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L YSV+ PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  565  TNEPRTQLYFLLGLVYSVVTPILLPFILIFFAFAYVVYRHQIINVYDQKYESGAAFWPQV  624

Query  151  HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H RV+  LI+ Q+ ++G F   GV K  +  ++IP PIL+  F  VC  +F
Sbjct  625  HLRVIIGLIIAQVLLMGLFSTLGVAKSTF--ILIPQPILTLWFHRVCKGRF  673



>gb|EMT11783.1| Putative membrane protein [Aegilops tauschii]
Length=792

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R  + KYF F  +NVF+G  +  T F  L S I  + N I   +  
Sbjct  446  MSKIEGHVSLSGLERRTASKYFLFIFVNVFLGSVVAGTAFQQLNSFIHQSTNKIPETIGE  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI+FH+K  ++ +T+ + ++A  PG L + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAAEVLRLKPLIMFHIKNTFLVRTEQDREQAMDPGSLEFG  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++ L Y+V+ PII+PF  V+FGL +L+ R+Q + VY   +ES  + WP +
Sbjct  566  STEPRIQLYFLLGLVYAVVTPIILPFIIVFFGLAYLVFRHQIINVYNQQYESGAQFWPGV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  8
            H R+V AL++ Q+ +IG    ++   + + ++PLP+L+  F +VC  +F
Sbjct  626  HGRIVTALVISQILLIGLLSTQEAEQSTVALLPLPVLTIWFHYVCKGRF  674



>ref|XP_008808245.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Phoenix dactylifera]
Length=759

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 137/230 (60%), Gaps = 3/230 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI--EDNPNsiislla  515
            +SK EG  S S   R ++ KY+ F ++NVF+   I    F+ L +   ++ PN    ++ 
Sbjct  444  MSKIEGYGSVSALERRSAAKYYLFILVNVFLANVIAGAAFEQLDTFVNKETPNKYPVIVG  503

Query  514  tslpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGY  335
            T++P+ ATFF+T++ L  + G   E+ R+ PLII+HLK  ++ KT+ + ++A  PG L +
Sbjct  504  TAIPAKATFFITYIMLDGWAGVASEIVRLKPLIIYHLKNAFLVKTEQDREQAMDPGSLDF  563

Query  334  ATRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPH  155
            A+  P   L  ++ L YSV+ PI +PF  V+F L +++ R+Q + VY   +ES    WP 
Sbjct  564  ASSEPRIQLYFLLGLVYSVVTPIFLPFIVVFFSLSYVVFRHQIINVYDQEYESGAAFWPD  623

Query  154  MHTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            +H R++ A+I+ QLT++G    K   +A P++I LPIL+  F   C  +F
Sbjct  624  VHRRLIIAMIISQLTLMGLMSTKDPKHATPVLIALPILTIWFHKYCKSRF  673



>gb|KJB51549.1| hypothetical protein B456_008G222200 [Gossypium raimondii]
Length=807

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R AS KY+YF ++NVF+G  +  T F  L S +   P  I   +  
Sbjct  446  MSKIEGHIAISTLERRASAKYYYFMLVNVFLGSIVTGTAFQQLHSFLHQPPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG + Y 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDREMAMDPGSVDYP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY P +ES    WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNPQYESGAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    K+   + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLMGLLSTKEAANSTPLLVILPILTLSFHKYCKSRF  674



>emb|CDP11732.1| unnamed protein product [Coffea canephora]
Length=798

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  ++S   R A+ KY+YF ++NVF+G  I  T F  L++ +  +   I   +  
Sbjct  447  MSKVEGYVAKSTLERKAAAKYYYFMLVNVFLGSIIAGTAFQQLRAFLHQSATQIPRTIGV  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ +  +A  PG + + 
Sbjct  507  SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNMFIVKTERDRVKAMDPGSVDFP  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ PI++PF  V+F   + + R+Q + VY   +ES G  WPH+
Sbjct  567  ETLPSLQLYFLLGLVYAVVTPILLPFILVFFAFAYFVYRHQVINVYNQQYESAGAFWPHV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++ +L++ QL ++G    KK   + PL+I LPIL+  F   C  +F
Sbjct  627  HSRIIWSLLISQLLLMGLLSTKKAANSTPLIIVLPILTLAFHNYCKNRF  675



>dbj|BAJ96091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP-Nsiisllat  512
            +SK EG  S S   R  + KYF F  +NVF+G  +  T F  L    + P N I   +  
Sbjct  446  MSKIEGHVSLSGLERRTASKYFLFIFVNVFLGSVVAGTAFQQLNRFINQPANKIPETIGE  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI+FH+K  ++ +T+ + ++A  PG L + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAAEVLRLKPLIMFHIKNTFLVRTEQDREQAMDPGSLEFG  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++ L Y+V++PII+PF  V+FGL +L+ R+Q + VY   +ES  + WP +
Sbjct  566  STEPRIQLYFLLGLVYAVVSPIILPFIIVFFGLAYLVFRHQIINVYNQQYESGAQFWPDV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  8
            H R+V AL++ Q+ +IG    ++   + + ++PLP+L+  F +VC  +F
Sbjct  626  HGRIVTALVISQVLLIGLLSTQEAEQSTVALLPLPVLTIWFRYVCKGRF  674



>ref|XP_006854105.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R  + KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  447  MSKVEGHLSLSKLERKTAEKYYYFMLVNVFLGSIVTGTAFEQLHSFLHQSPTQIPRTIGV  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ + + A  PG +  +
Sbjct  507  SIPMKATFFVTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENAMDPGSIELS  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WPH+
Sbjct  567  NSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEYESVAAFWPHV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++A+L++ Q  ++G    KK   + PL+I LP+L+  F   C  +F
Sbjct  627  HGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRF  675



>ref|XP_010278603.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nelumbo nucifera]
Length=709

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 131/228 (57%), Gaps = 1/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++GKY  F ++N+F+G  I  T F  L + I   P+ I   +  
Sbjct  445  MSKIEGHTSLSSLERRSAGKYHLFVLVNIFLGSVITGTAFQQLYQFINQPPHEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T+V +  + G   E+ R+ PLI+FHLK  ++ KTD E +EA   G + +A
Sbjct  505  TIPMKATFFITYVMVDGWAGIAAEILRLFPLIVFHLKNTFLVKTDEEREEAMDAGSIDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++   YSV+ P+I+PF  ++F L +++ R+Q + VY   +ES    WP +
Sbjct  565  SFEPQIQLYFLLGFVYSVVTPVILPFIVIFFALSYVVFRHQIINVYDQKYESGAAFWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H R+V  LI+ QL + G  G K    A L+IP+P+L+  F   C  +F
Sbjct  625  HRRLVIGLIISQLLLXGLMGTKGAGLASLLIPVPVLTIGFHRFCKVRF  672



>gb|KHG10946.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=740

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++GKY  F ++NVF+G  I  T F  LK+ +   P  I   +  
Sbjct  444  MSKVEGFSSCSSLDRRSAGKYHLFLLINVFLGSIITGTAFQQLKTFLHQPPTEIPKTVGE  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + +EA  PG L +A
Sbjct  504  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVIFHLKNMFLVKTEQDREEAMDPGCLNFA  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L YS + P+++PF  ++F   +++ R+Q + VY   +ES G  WP +
Sbjct  564  TYEPKIQLYFLLGLVYSTVTPVLLPFVIIFFAFSYVVFRHQVINVYAQRYESGGSFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  8
            H R++  L++ QL ++G    K    + + ++PLPIL+  F   C  +F
Sbjct  624  HRRLLIGLLISQLLLMGLLSTKSVEKSTIALLPLPILTVWFHVYCKGRF  672



>emb|CDP03600.1| unnamed protein product [Coffea canephora]
Length=756

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ KY  F ++NVF G  I    F+ L+S ++  P  I      
Sbjct  445  MSKIEGFTSLSSLDRRSAAKYHLFLLVNVFFGSIITGAAFEQLQSFLKQAPTEIPKTAGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG + ++
Sbjct  505  AIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNTFLVKTEQDREDAMDPGSINFS  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L YSV+ PI++PF  ++F   +++ R+Q + VY   +ES  K WP +
Sbjct  565  TSEPRIQLYFLLGLVYSVVTPILLPFIIIFFAFAYVVFRHQIINVYDQKYESGAKFWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ AL++ QL ++G    KK   + PL+I LP+L+  F   C  +F
Sbjct  625  HRRIIVALVISQLLLMGLLSTKKAANSTPLLIVLPVLTIWFHLFCKGRF  673



>ref|XP_010278586.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
 ref|XP_010278595.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nelumbo nucifera]
Length=756

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 131/228 (57%), Gaps = 1/228 (0%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++GKY  F ++N+F+G  I  T F  L + I   P+ I   +  
Sbjct  445  MSKIEGHTSLSSLERRSAGKYHLFVLVNIFLGSVITGTAFQQLYQFINQPPHEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T+V +  + G   E+ R+ PLI+FHLK  ++ KTD E +EA   G + +A
Sbjct  505  TIPMKATFFITYVMVDGWAGIAAEILRLFPLIVFHLKNTFLVKTDEEREEAMDAGSIDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++   YSV+ P+I+PF  ++F L +++ R+Q + VY   +ES    WP +
Sbjct  565  SFEPQIQLYFLLGFVYSVVTPVILPFIVIFFALSYVVFRHQIINVYDQKYESGAAFWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H R+V  LI+ QL + G  G K    A L+IP+P+L+  F   C  +F
Sbjct  625  HRRLVIGLIISQLLLXGLMGTKGAGLASLLIPVPVLTIGFHRFCKVRF  672



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 140/229 (61%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            ++K EG  S S   R A+ +Y+ F+++NVF+G  I  +  + LK+ +  +P+ I   + T
Sbjct  449  MAKFEGYASRSSLERRAASRYYLFSLVNVFLGSIIAGSALEQLKTFMHQSPSDIPVTIGT  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  509  AVPIKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNTFLVKTDKDREEAMDPGSIGFN  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L +++ L Y+ + P+++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  569  TGEPRIQLYILLGLVYATLTPVLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R+++AL++ QL ++G    KK   + P ++ LP+L+F F   C  +F
Sbjct  629  HGRILSALLISQLVLLGLLTTKKAAQSTPFLLALPVLTFAFYKYCQGRF  677



>ref|XP_010261636.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=780

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R AS KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446  MSKVEGHLSISSLERKASAKYYYFMLVNVFLGSIVTGTAFEQLDSFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+  L+I+HLK  ++ KT+ + ++A  PG +G  
Sbjct  506  SIPMKATFFITYIMVDGWAGIASEILRLKSLVIYHLKNMFLVKTERDREKAMDPGSVGLP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WPH+
Sbjct  566  ETLPTLQLYFLLGIVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEYESVAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++  L ++G    K    + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISHLLLMGLLSTKXAANSTPLLVVLPILTLWFHKYCKSRF  674



>ref|XP_002529341.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33058.1| conserved hypothetical protein [Ricinus communis]
Length=726

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 137/228 (60%), Gaps = 4/228 (2%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  441  MSKFEGFISLSGLERRSATRYYIFQFINVFLGSIITGTAFQQLNNFIHQSANDIPKTIGV  500

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  501  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  560

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L YSV++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  561  TGEPQIQLYFLLGLVYSVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  620

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKK  11
            H R+V ALI+ QL ++G    K+   + PL+I LP+L+    F+CS K
Sbjct  621  HGRIVTALIVSQLLLMGLLSTKQAAQSTPLLITLPVLTIW--FICSAK  666



>ref|XP_010276749.1| PREDICTED: CSC1-like protein At1g32090 [Nelumbo nucifera]
Length=739

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R+ + KY+YF ++NVF+G  +  T F+ L S +  +P  I   +  
Sbjct  446  MSKVEGHLSISTIERSTAAKYYYFMLVNVFLGSIVTGTAFEQLDSFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+  L+IFHLK  ++ KT+ + ++A  PG +  +
Sbjct  506  SIPMKATFFITYIMVDGWAGIASEILRLKKLVIFHLKNMFLVKTERDKEKAMDPGSVKLS  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WPH+
Sbjct  566  ETLPTLQLYFLLGIVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQQYESVAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++A+L++  L ++G    KK   + PL++ LPIL+  F   C  +F
Sbjct  626  HNRIIASLLISHLLLMGLLSTKKAANSTPLLVVLPILTLWFHKYCKSRF  674



>ref|XP_006850790.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R ++ KY+ F +++VF G  +  T F+ LK  +  +P+ I   +  
Sbjct  446  MSKIEGHIAHSVLERRSAAKYYLFILVSVFFGNVLAGTAFEQLKMFMHQSPDQIPKTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI++HLK   + KT+ + ++A  PG LG+A
Sbjct  506  SIPMKATFFITYILVDGWSGVAAEVLRLKPLIMYHLKNALLVKTEKDREDAMNPGSLGFA  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  566  SSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRHQIINVYNQEYESAASFWPDV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPLV-IPLPILSFLFAFVCSKKF  8
            H R+V A+++ QL ++G    +    +  V IPLPIL+  F  VC  +F
Sbjct  626  HGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRF  674



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+G  I  T F  L K I  + N I   +  
Sbjct  444  MSKFEGFLSISGLERRSASRYYIFNIVNVFLGSIIAGTAFQQLNKFIHQSANEIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+ PLIIFHLK  +M KT+ +  EA  PG LG+ 
Sbjct  504  AIPMKATFFITYIMVDGWAGIAAEILRVRPLIIFHLKNFFMVKTEKDRDEAMDPGSLGFD  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQFYFLLGLVYAVVTPILLPFILVFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R+++A+++ QL ++G    K    + P ++ LPIL+  F   C  ++
Sbjct  624  HGRIISAMVISQLLLMGLMSTKHAALSTPFLLALPILTISFHLYCKGRY  672



>ref|XP_002986828.1| hypothetical protein SELMODRAFT_425683 [Selaginella moellendorffii]
 gb|EFJ12158.1| hypothetical protein SELMODRAFT_425683 [Selaginella moellendorffii]
Length=657

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            LSK EG  S S   R A+ K+FYF V NVF       +    LK  +  +P+ I  LL  
Sbjct  416  LSKVEGHLSLSKLDRMAAAKHFYFMVFNVFFASVFTGSALQQLKLFLHKSPSDIPQLLGD  475

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF++++ +  +     E+ R+ PL+ FH +     KT+ + ++A APG L   
Sbjct  476  AIPLKATFFISYIMVDGWASVAGEILRLKPLLFFHFRNMMFVKTEKDREKAMAPGGLSLN  535

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+VIAPII+PF   +FG  +L+ RNQ + VY P +ES G  WPH+
Sbjct  536  TALPHVGLYFLLGLVYAVIAPIILPFIVTFFGFSYLVYRNQVINVYHPEYESAGGFWPHI  595

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLF  32
            H RVVA++I+ QLT++G    K+   + P +  LP+L+F+F
Sbjct  596  HNRVVASMIIMQLTLLGLLSTKRAASSTPFLAGLPVLTFIF  636



>ref|XP_010657219.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657220.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657221.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657222.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657223.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657224.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 emb|CBI28840.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +++ F  +NVF+G  I  T F  L S I  + N I  ++ T
Sbjct  444  MSKFEGFISRSALERRSAARFYIFQFINVFLGSIITGTAFQQLNSFIHQSANDIPKIIGT  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ P+II+HLK  +  KT+ + +EA  PG L + 
Sbjct  504  SIPMKATFFITYIMVDGWAGVSGEILRLKPMIIYHLKNFFTVKTEKDREEAMDPGSLSFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ AL++ QL ++G    K+   + PL+I LP+L+  F F C  ++
Sbjct  624  HMRIIVALVVSQLLLMGLLSTKQAAQSTPLLIALPVLTIWFHFFCKGRY  672



>ref|XP_010455942.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Camelina sativa]
Length=770

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ K F+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKSFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  AT F+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATIFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KK      L++P  IL+F F   C+ +F
Sbjct  625  HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQLILTFWFNRYCAGRF  673



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 137/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L S +  + N I   +  
Sbjct  447  MSKFEGFISLSTLERRSATRYYIFQFVNVFLGSIITGTAFQQLNSFLNQSANDIPKTIGV  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  507  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES G  WP +
Sbjct  567  TGEPQIQLYFLLGLVYAVVSPILLPFILVFFSLAYVVYRHQVINVYNQEYESAGAFWPDV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++AAL++ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  627  HGRIIAALVVSQLLLMGLLSTKQAAQSTPLLITLPVLTIWFHVFCRGRY  675



>gb|KJB10672.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=608

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  284  MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  343

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  344  SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  403

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  404  TGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDV  463

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  464  HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRY  512



>ref|XP_010455941.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Camelina sativa]
Length=779

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +S+ EG  S S+  R ++ K F+F ++NVF+G  I  T F  LKS +E  P  I   +  
Sbjct  445  MSQIEGYTSLSYLDRRSAEKSFWFIIVNVFLGSIITGTAFQQLKSFLEQPPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  AT F+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATIFITYIMVDGWAGIAAEILRVVPLVVFHLKNTFLVKTEQDRQQAMDPGHLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ +API++PF  V+F   +++ R+Q + VY   +ES  + WP +
Sbjct  565  TSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFSYVVFRHQVINVYDQKYESGARYWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKF-PYAPLVIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL M+G    KK      L++P  IL+F F   C+ +F
Sbjct  625  HRRLIICLIISQLLMMGLLSTKKLAKVTALLLPQLILTFWFNRYCAGRF  673



>ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 
[Cucumis melo]
Length=629

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  305  MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  364

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  365  SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  424

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  425  TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  484

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  485  HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRY  533



>gb|KDP20707.1| hypothetical protein JCGZ_21178 [Jatropha curcas]
Length=694

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F ++NVF+G  I  T F+ LKS ++ + N I   +  
Sbjct  366  MSKFEGFTSLSSLERRSAARYYFFNIVNVFLGSIIAGTAFEQLKSFMKQSANDIPKTIGV  425

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  426  AIPMKATFFITYIMVDGWAGIAGEVLMLKPLILFHLKNFFLVKTEKDREEAMDPGSLGFN  485

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ + P ++PF  V+FG  +++ R+Q + VY   +ES    WP +
Sbjct  486  TGEPRIQFYFLLGLVYATVTPALLPFIIVFFGFAYVVFRHQIINVYNQEYESAAAYWPDV  545

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVV ALI+ Q+ MIG    K+   + P +I LPIL+  F   C  ++
Sbjct  546  HGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILTIWFHRFCKGRY  594



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + +  + N I   +  
Sbjct  444  MSKFEGFSSISALERRSATRYYIFQFVNVFLGSIITGTAFQQLNNFMHQSANEIPKTVGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K   ++ PL+I LP+L+  F   C  ++
Sbjct  624  HGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRY  672



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R A+ +++ F  +NVF+G  +  T F  L K +  + N I   +  
Sbjct  447  MSKFEGFVSTSSLERRAASRFYMFQFINVFLGSIVTGTAFQQLNKFLNQSANDIPKTIGV  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ +T+ + +EA  PG +G+ 
Sbjct  507  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVRTEKDREEATDPGTIGFN  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ ++PI++PF  V+FGL +++ R+Q + VY   +ES GK WP +
Sbjct  567  TGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAYVVYRHQVINVYNQKYESAGKFWPDV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVV ALI+ QL ++G    K    + PL++ LP+L+  F   C  ++
Sbjct  627  HRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPMLTIGFHIHCKCRY  675



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L   I  + + I   +  
Sbjct  465  MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNHFIHQSTSQIPKTIGV  524

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  525  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVKTEKDREEAMDPGTIGFN  584

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  585  TGEPQIQLYFLLGLVYAVVTPILLPFIIVFFALAYVVYRHQIINVYHQEYESAAAFWPDV  644

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVVAALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  645  HVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTICFHRFCKGRY  693



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + +  + N I   +  
Sbjct  444  MSKFEGFSSISALERRSATRYYIFQFVNVFLGSIITGTAFQQLNNFMHQSANEIPKTVGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K   ++ PL+I LP+L+  F   C  ++
Sbjct  624  HGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRY  672



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 136/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  444  MSKFEGCISLSVLERRSASRYYFFQFINVFLGSIIAGTAFQQLNNFIHQSTNQIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVYRHQIINVYNQEYESGAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  624  HARIIVALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGRY  672



>ref|XP_008455926.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
 ref|XP_008455927.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
Length=649

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  325  MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  384

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  385  SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  444

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  445  TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  504

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  505  HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRY  553



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L   I  + + I   +  
Sbjct  445  MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNHFIHQSTSQIPKTIGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  505  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVKTEKDREEAMDPGTIGFN  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  565  TGEPQIQLYFLLGLVYAVVTPILLPFIIVFFALAYVVYRHQIINVYHQEYESAAAFWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVVAALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  625  HVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTICFHRFCKGRY  673



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   145 bits (365),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R A+ +++ F  +NVF+G  +  T F  L S +  + N I   +  
Sbjct  447  MSKFEGFVSTSSLERRAATRFYMFQFINVFLGSIVTGTAFQQLNSFLNQSANDIPKTIGV  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ +T+ + +EA  PG +G+ 
Sbjct  507  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVRTEKDREEATDPGTIGFN  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ ++PI++PF  V+FGL +++ R+Q + VY   +ES GK WP +
Sbjct  567  TGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAFVVYRHQVINVYNQKYESAGKFWPDV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVV AL++ QL ++G    K    + P ++ LP+L+  F   C  ++
Sbjct  627  HRRVVTALVVSQLLLMGLLSTKHASKSTPFLLVLPLLTIGFHMHCKNRY  675



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG+ S S   R ++ +Y+ F  +NVF+G  I  T F  L + +  + N I   +  
Sbjct  444  MSKFEGLISTSALERRSATRYYLFQFINVFLGSIITGTAFQQLNNFLHQSANEIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ P II+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAAEILRLKPFIIYHLKNSFLVKTEKDREEAMDPGTLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVTPILLPFILVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ A+I+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  624  HGRIIFAMIISQLLLMGLLSTKEAAQSTPLLITLPVLTIGFHLFCKGRY  672



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG+ S S   +  +GKY+ F ++NVF+G  I  T F  L K I  +P  I   +  
Sbjct  445  MSKIEGLISLSSLEQRTAGKYYLFILVNVFLGSIITGTAFQQLHKFINQSPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L ++
Sbjct  505  SIPMKATFFITYIMVDGWAGVAAEILRLVPLIMFHLKNAFLVKTEQDREQAMDPGCLNFS  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+ + PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  565  ISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKYESGAAFWPSV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RV+  L++ QL ++G    K F  + P +I LP+L+F F   C+ +F
Sbjct  625  HQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRF  673



>ref|XP_007050676.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX94833.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=751

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP-Nsiisllat  512
            +SK EG  S S   R ++GKY  F ++NVF+G  I  T F  LKS  D P   I   +  
Sbjct  444  MSKIEGFSSLSSLDRRSAGKYHLFILVNVFLGSIITGTAFQQLKSFLDQPPTEIPKTVGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T+V +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  504  SIPMKATFFITYVMVDGWAGIAAEILRLVPLVIFHLKNTFLVKTEQDREQAMDPGCLDFA  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P     +++ L YS I P+++PF  ++F   +L+ R+Q + VY   +ES    WP +
Sbjct  564  TSEPRIQFYILLGLVYSAITPVLLPFIIIFFAFAYLVFRHQVINVYDQRYESGASFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  8
            H R++  LI+ QL ++G    KK   + + ++PLPIL+  F   C  +F
Sbjct  624  HRRLIIGLIISQLLLMGLLSTKKIDKSTIALLPLPILTIWFHRYCKGRF  672



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG+ S S   +  +GKY+ F ++NVF+G  I  T F  L K I  +P  I   +  
Sbjct  455  MSKIEGLISLSSLEQRTAGKYYLFILVNVFLGSIITGTAFQQLHKFINQSPTEIPKTVGV  514

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L ++
Sbjct  515  SIPMKATFFITYIMVDGWAGVAAEILRLVPLIMFHLKNAFLVKTEQDREQAMDPGCLNFS  574

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+ + PI++PF  ++F   +++ R+Q + VY   +ES    WP +
Sbjct  575  ISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKYESGAAFWPSV  634

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RV+  L++ QL ++G    K F  + P +I LP+L+F F   C+ +F
Sbjct  635  HQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRF  683



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            ++K EG  S+S   R A+ +Y+ FT +NVF+G  I  T F+ L S I  +   I   +  
Sbjct  448  MAKFEGFTSKSSLERRAASRYYLFTFVNVFLGSIIAGTAFEQLDSFIHQSATEIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTEKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVV+ALI+ QL + G    K+   + P +I LP+L+  F   C  +F
Sbjct  628  HGRVVSALIISQLLLFGLLSTKRAAQSTPFLIALPVLTIWFYRYCKGRF  676



>ref|XP_002969287.1| hypothetical protein SELMODRAFT_91711 [Selaginella moellendorffii]
 gb|EFJ29375.1| hypothetical protein SELMODRAFT_91711 [Selaginella moellendorffii]
Length=761

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            LSK EG  S S   R A+ K+FYF V NVF       +    LK  +  +P+ I  LL  
Sbjct  447  LSKVEGHLSLSKLDRMAAAKHFYFMVFNVFFASVFTGSALQQLKLFLHKSPSDIPQLLGD  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF++++ +  +     E+ R+ PL+ FH +     KT+ + ++A APG L   
Sbjct  507  AIPLKATFFISYIMVDGWASVAGEILRLKPLLFFHFRNMMFVKTEKDREKAMAPGGLSLN  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+VIAPII+PF   +FG  +L+ RNQ + VY P +ES G  WPH+
Sbjct  567  TALPHVGLYFLLGLVYAVIAPIILPFIVTFFGFSYLVYRNQVINVYHPEYESAGGFWPHI  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLF  32
            H RVVA++I+ QLT++G    K+   + P +  LP+L+F+F
Sbjct  627  HNRVVASMIIMQLTLLGLLSTKRAASSTPFLAGLPVLTFIF  667



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  444  MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  624  HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRY  672



>gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=729

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  405  MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  464

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  465  SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  524

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  525  TGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDV  584

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  585  HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRY  633



>ref|XP_003612662.1| Membrane protein, putative [Medicago truncatula]
 gb|AES95620.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=799

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R  + KY+YF ++NVF+G  I  T F+ L + +  +P  I   +  
Sbjct  446  MSKIEGYIALSTLERKTAAKYYYFMLVNVFLGSIITGTAFEQLHAFLHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KT+ +  +A  PG + + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIYHLKNMFIVKTERDRGKAMDPGSVEFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  566  ETLPSLQLYFLLGIVYAVMTPILLPFILVFFAFAYLVYRHQIINVYHQQYESAAAFWPQV  625

Query  151  HTRVVAALILYQLTMIGYFGVKK-FPYAPLVIPLPILSFLFAFVCSKKF  8
            H+R++A+LIL Q+ + G    KK     PL+I LPIL+F F   C ++F
Sbjct  626  HSRIIASLILSQILLFGLLSTKKAVKSTPLLIMLPILTFAFHKYCKRRF  674



>gb|KHG22816.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  325  MSKFEGFISLSALERRSASRYYFFQFINVFLGSIITGTAFQQLNNFIHQSTNEIPKTIGA  384

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  385  SIPMKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFN  444

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+++ PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  445  TGEPQIQLYFLLGLVYAIVTPILLPFIIVFFALAFVVFRHQIINVYNQEYESAAAYWPDV  504

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  505  HLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPVLTIWFHRFCKGRY  553



>gb|EMS63833.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=804

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 131/229 (57%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  S S   R  + KY+YF ++NVF+G  I  T F+ L S   D P+ I   +  
Sbjct  443  MSKVEGYVSLSSLERRTASKYYYFMLVNVFLGSIIAGTAFEQLDSFFHDPPSQIPRTIGV  502

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KT+ + + A  P  +   
Sbjct  503  AVPMKATFFMTYIMVDGWAGIANEILRVKPLVIYHLKNMFIVKTERDRERAMDPRSISLG  562

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  563  ENLPSLQLYFLLGLVYAVVTPILLPFIIVFFAFAYLVYRHQIINVYNQEYESAAAFWPQV  622

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++  +T+ G     K  Y+ PL+I LP+L+  F   C  +F
Sbjct  623  HSRIIASLLISHVTLFGLMSTMKAAYSTPLLIFLPLLTIWFHKYCKSRF  671



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  444  MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  504  SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  624  HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRY  672



>gb|AFI41197.1| dehydration stress protein, partial [Arabidopsis thaliana]
Length=806

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R A+ KY+YF ++NVF+G  I  T F+ L S +  +P+ I   +  
Sbjct  447  MSKIEGYIAISTLERRAAAKYYYFMLVNVFLGSIIAGTAFEQLHSFLHQSPSQIPRTIGV  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ +   A  PG + + 
Sbjct  507  SIPMKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFIVKTEEDRVRAMDPGFVDFK  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+ + PI++PF  ++F   +L+ R+Q + VY   +ES G  WPH+
Sbjct  567  ETIPSLQLYFLLGIVYTAVTPILLPFILIFFAFAYLVYRHQIINVYNQQYESCGAFWPHV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++A+L++ QL ++G    KK   + PL+I LP+L+  F   C  +F
Sbjct  627  HGRIIASLLISQLLLMGLLASKKAADSTPLLIILPVLTLSFHKYCKHRF  675



>ref|XP_004158583.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
Length=768

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  444  MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  504  SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  624  HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFHRFCKGRY  672



>gb|EMT13890.1| Putative membrane protein [Aegilops tauschii]
Length=801

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 131/229 (57%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  S S   R  + KY+YF ++NVF+G  I  T F+ L S   D P+ I   +  
Sbjct  443  MSKVEGYVSLSSLERRTASKYYYFMLVNVFLGSIIAGTAFEQLDSFFHDPPSQIPRTIGV  502

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+ PL+I+HLK  ++ KT+ + + A  P  +   
Sbjct  503  AVPMKATFFMTYIMVDGWAGIANEILRMKPLVIYHLKNMFIVKTERDRERAMDPRSIALG  562

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  563  ENLPSLQLYFLLGLVYAVVTPILLPFIIVFFAFAYLVYRHQIINVYNQEYESAAAFWPQV  622

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++  +T+ G     K  Y+ PL+I LP+L+  F   C  +F
Sbjct  623  HSRIIASLLISHVTLFGLLSTMKAAYSTPLLIFLPLLTIWFHKYCKSRF  671



>ref|XP_004151944.1| PREDICTED: uncharacterized protein RSN1-like [Cucumis sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ KY+ F  +NVF+G  I  T F  L K +  + N I   +  
Sbjct  444  MSKFEGFISRSSLERRSASKYYIFLFVNVFLGSIITGTAFQQLNKFLHQSANDIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+TF+ +  + G   E+ R+ PLII+HL+  ++ KT+ + +EA  PG L + 
Sbjct  504  SIPMKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEAMDPGTLEFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P+++PF   +FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++AAL++ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  624  HGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFHRFCKGRY  672



>ref|XP_011463550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=718

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  394  MSKFEGFTSISALERRSATRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANDIPITIGV  453

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI++HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  454  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIMYHLKNTFLVKTEKDREEAMDPGTLGFN  513

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  514  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  573

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ AL++ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  574  HGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRY  622



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 131/229 (57%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDN-PNsiisllat  512
            +SK EG  S S     ++GKY  F ++NVF+G  I  T    LKS  D  P  I   +  
Sbjct  445  MSKIEGFASLSSLETRSAGKYHLFVLVNVFLGSIITGTALQQLKSFLDQAPTEIPKTVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL++FHLK  ++ KT+ + ++A  PG LG+A
Sbjct  505  SIPMKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNTFLVKTEKDREQAMDPGCLGFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++   YSV+ P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  565  TSEPRIQLYFLLGFVYSVVTPVLLPFIIVFFALAYMVFRHQVINVYDQKYESGAAFWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
              R++  +++ QL ++G    K    + PL+I LPIL+  F   C  +F
Sbjct  625  QRRLIIGMVISQLLLMGLMSTKGAKSSTPLLIVLPILTIWFHLFCKGRF  673



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R A+ +Y+ F ++NVF+   I    F+ L S +  +PN I   +  
Sbjct  450  MSKFEGFTSISSLERRAAFRYYIFNLVNVFLASVITGAAFEQLNSFLNQSPNQIPKTIGV  509

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KTD + +EA  PG +G+ 
Sbjct  510  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTDKDREEAMDPGSIGFN  569

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  570  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  629

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  630  HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  678



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            ++K EG  S+S   R A+ +Y+ F+ +NVF+G  I  T F+ L + I  +   I   +  
Sbjct  448  MAKFEGFTSKSSLERRAASRYYLFSFVNVFLGSIIAGTAFEQLDTFIHQSATEIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KTD + +EA  PG +G+ 
Sbjct  508  AIPMKATFFVTYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTDKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RVV+ALI+ QL + G    K+   + P +I LP+L+  F   C  +F
Sbjct  628  HGRVVSALIISQLLLFGLLSTKEAAQSTPFLIALPVLTIWFYRYCKGRF  676



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  443  MSKFEGFTSISALERRSATRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANDIPITIGV  502

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI++HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  503  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIMYHLKNTFLVKTEKDREEAMDPGTLGFN  562

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  563  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  622

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ AL++ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  623  HGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRY  671



>ref|NP_192343.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849296.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849297.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9XEA1.1|CSCL5_ARATH RecName: Full=Protein OSCA1; AltName: Full=CSC1-like protein 
At4g04340; AltName: Full=Protein reduced hyperosmolality-induced 
[Ca(2+)]i increase 1 [Arabidopsis thaliana]
 gb|AAD36947.1|AF069441_7 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB77902.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAM13208.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82380.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82381.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82382.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34613.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Arabidopsis 
thaliana]
Length=772

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+G  I    F+ L S +  +PN I   +  
Sbjct  449  MSKFEGFTSVSFLERRSASRYYIFNLVNVFLGSVIAGAAFEQLNSFLNQSPNQIPKTIGM  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  509  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEKDREEAMNPGSIGFN  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  569  TGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+ ALI+ QL ++G  G K     AP +I LP+++  F   C  +F
Sbjct  629  HGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITIGFHRFCKGRF  677



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  + N I   +  
Sbjct  444  MSKFEGFNSISALERRSATRYYIFQFINVFLGSIITGTAFQQLDTFIHQSANKIPETIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T+  +  + G   E+ R+ PLII+H K  ++ KT+ + +EA  PG LG+ 
Sbjct  504  SIPMKATFFITYTMVDGWAGVAGEILRLKPLIIYHFKNFFLVKTEKDREEAMDPGSLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVTPVLLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ AL++ QL ++G    K+   + PL+I LP+L+  F F C  ++
Sbjct  624  HRRIITALVVSQLLLMGLLSTKEATQSTPLLITLPVLTIWFHFFCKGRY  672



>ref|XP_006287117.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
 gb|EOA20015.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
Length=772

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+   I    F+ L S +  +PN I   +  
Sbjct  449  MSKFEGFTSISSLERRSASRYYIFNLVNVFLANVIAGAAFEQLDSFLNQSPNQIPKTVGM  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  509  AIPMKATFFITYIMIDGWAGVAGEILMLKPLIIFHLKNAFLVKTEKDREEAMDPGSIGFN  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  569  TGEPQIQLYFLLGLVYAPVTPLLLPFILVFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G  G K     AP +I LP+++  F   C  ++
Sbjct  629  HGRIITALIISQLLLMGLLGTKHAASAAPFLIALPVITIGFHRFCKGRY  677



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +PN I   +  
Sbjct  453  MSKFEGFSSISALERRSATRYYIFQFINVFLGSIITGTAFQQLNNFIHQSPNEIPKTIGV  512

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  +M KT+ + +EA  PG LG+ 
Sbjct  513  SIPMKATFFITYIMVDGWAGVAGEILRLRPLIIYHLKNFFMVKTETDREEAMNPGSLGFN  572

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  573  TGEPQIQLYFLLGLVYAVVSPILLPFIVIFFGLAYIVYRHQIMNVYNQEYESAAAFWPDV  632

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K    + P +I LP+L+  F   C  ++
Sbjct  633  HGRIIIALIVSQLLLLGLLSTKDASQSTPFLITLPVLTICFDRYCKGRY  681



>ref|XP_008363487.1| PREDICTED: uncharacterized protein RSN1-like [Malus domestica]
Length=567

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S     R ++ +Y+ F  +NVF+G  I  T F  L   I  + N I   +  
Sbjct  241  MSKFEGFGSIXALERRSASRYYIFQFVNVFLGSIITGTAFQQLDEFIHQSANEIPKTIGV  300

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  301  SIPMKATFFITYIMVDGWAGIAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  360

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  361  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  420

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  421  HGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHXFCKGRY  469



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 134/225 (60%), Gaps = 2/225 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  444  MSKFEGFNSISALERRSATRYYIFQFVNVFLGSIITGTAFQQLDKFIHQSANEIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + ++A  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREDAMDPGTLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVC  20
            H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C
Sbjct  624  HGRIITALIISQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFC  668



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            ++K EG  S S   R A+ +Y+ F+++NVF+G  I  T F+ L S I  +   I   +  
Sbjct  448  MAKFEGYTSVSSLERRAASRYYLFSLVNVFLGSIITGTAFEQLDSFIHQSATDIPQTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KTD + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPQIQLYFLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL + G    KK   + P +I LP+L+  F   C  +F
Sbjct  628  HGRIITALIISQLLLFGLLSTKKAASSTPFLIALPVLTLWFRSYCKGRF  676



>gb|AAL07154.1| unknown protein [Arabidopsis thaliana]
Length=772

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+G  I    F+ L S +  +PN I   +  
Sbjct  449  MSKFEGFTSVSFLERRSASRYYIFNLVNVFLGSVIAGAAFEQLNSFLNQSPNQIPKTIGM  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  509  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEKDREEAMNPGSIGFN  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  569  TGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+ ALI+ QL ++G  G K     AP +I LP+++  F   C  +F
Sbjct  629  HGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITTGFHRFCKGRF  677



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 133/225 (59%), Gaps = 2/225 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  444  MSKFEGFNSISALERRSATRYYIFQFVNVFLGSIITGTAFQQLDKFIHQSANEIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK   + KT+ + +EA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFLLVKTEKDREEAMDPGTLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVC  20
            H R++ ALI+ QL ++G    K+   + PL+I LP+L+  F   C
Sbjct  624  HGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFC  668



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I    F+ L ++   + N I   +  
Sbjct  444  MSKFEGFCSISALERRSATRYYIFQFVNVFLGSIITGAAFNQLNNLLHQSANEIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI FHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGSLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + PL+I LPIL+  F   C  +F
Sbjct  624  HGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIWFHIFCKGRF  672



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNP-Nsiisllat  512
            +SK EG  S S   R  + KYF F  +NVF+G  I  T F  L +    P + I   +  
Sbjct  445  MSKIEGHISVSGLDRKTASKYFLFLFVNVFLGSVITGTAFQQLDTFIHQPASKIPETVGE  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T+V +  + G   E+ R+ PL++FH+K  ++ +T+ + ++A  PG L + 
Sbjct  505  SIPMKATFFITYVMVDGWAGVAAEVLRLKPLVMFHIKNTFLVRTEQDREQAMNPGSLDFG  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+F L +L+ R+Q + VY   +ES G  WP +
Sbjct  565  TTEPRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQYESGGLFWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  8
              R+VAALI+ Q+ ++G    ++   + + ++PLP+L+  F +VC  +F
Sbjct  625  QRRIVAALIVSQILLLGLLSTQEAEKSTVSLLPLPVLTIWFHYVCKGRF  673



>ref|XP_002872689.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48948.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+G  I    F+ L S +  +PN I   +  
Sbjct  449  MSKFEGFTSVSSLERRSASRYYIFNLVNVFLGNVIAGAAFEQLNSFLNQSPNQIPKTIGM  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK   + KT+ + +EA  PG +G+ 
Sbjct  509  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNALLVKTEKDREEAMNPGSIGFN  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  ++F L +++ R+Q + VY   +ES    WP +
Sbjct  569  TGEPQIQLYFLLGLVYAPVTPMLLPFILIFFALAYVVYRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+ ALI+ QL ++G  G K   + AP +I LP+++  F   C  ++
Sbjct  629  HGRVITALIISQLLLMGLLGTKHAAFAAPFLIALPVITIGFHRFCKGRY  677



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R  + KY+ F  +NVF+G  I  T F  L + I  + N I  ++  
Sbjct  445  MSKIEGHTSLSGLDRRTASKYYLFLFVNVFLGSVITGTAFQQLNNFIHQSANKIPEIVGE  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T+V +  + G   E+ R+ PL++FH+K  ++ +T+ + ++A  PG L + 
Sbjct  505  SIPMKATFFITYVMVDGWAGVAAEVLRLKPLVMFHIKNTFLVRTERDREQAMDPGSLDFG  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ PI++PF  V+F L +L+ R+Q + VY   +ES  + WP +
Sbjct  565  TTEPRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQYESGAQFWPDV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYAPL-VIPLPILSFLFAFVCSKKF  8
              R+V ALI+ Q+ ++G    ++   + + ++PLP+LS  F +VC  +F
Sbjct  625  QRRLVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHYVCKGRF  673



>ref|XP_010090368.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB39338.1| Uncharacterized membrane protein [Morus notabilis]
Length=878

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 131/229 (57%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsi-isllat  512
            +S+ EG  S S   R ++ KY  F ++NVF+G  +  T F  L+   + P++     +  
Sbjct  445  MSRIEGFASLSSLERRSAEKYHLFILVNVFLGSIVTGTAFQQLEKFINEPSTEFTKTIGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+VPL+IFHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFMTYIMVDGWAGIAAEILRLVPLVIFHLKNTFLVKTEEDREKAMDPGCLDFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L YSVI P+++PF  V+F   +++ R+Q + VY   +ES    WPH+
Sbjct  565  TSEPRIQFYFLLGLVYSVITPVLLPFIVVFFAFSFMVFRHQIINVYDQKYESAAAFWPHV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RV+  LI+ QL ++G F  K    +  L+I  PIL+  F   C  +F
Sbjct  625  HRRVIIGLIIAQLLLMGLFSTKGLAKSTSLLIAQPILTIWFHRFCKGRF  673



>ref|XP_010422263.1| PREDICTED: LOW QUALITY PROTEIN: protein OSCA1-like [Camelina 
sativa]
Length=772

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+   I    F+ L S+   +PN I   +  
Sbjct  449  MSKFEGFTSISSLERRSASRYYIFNLVNVFLANVIAGAAFEQLNSLLNQSPNQIPKTVGM  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  509  AIPMKATFFITYIMIDGWAGVAGEILMLKPLIIFHLKNAFLVKTEKDREEAMDPGSIGFN  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++P+  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  569  TGEPXIQLYFLLGLVYAPVTPMLLPYILVFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV++ALI+ QL ++G    K+    AP +I LP+++  F   C  ++
Sbjct  629  HGRVISALIISQLLLMGLLATKRAALAAPFLIALPVITIGFHRFCKGRY  677



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 130/231 (56%), Gaps = 6/231 (3%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            +SK EG  S S   R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445  MSKIEGFTSLSSLDRRSAAKYHLFILINVFLGSIVTGTALQQLEKLMNEPSTEFTKTVGR  504

Query  508  lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
                 ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWSGVAAEIVRLVPLILFHLKNTFLVKTEEDREQAMDPGSLNFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y V+ PI++PF  ++F   +L+ R+Q + VY   +ES    WP +
Sbjct  565  TNEPRTQLYFLLGLVYCVVTPILLPFILIFFSFAYLVFRHQIINVYDQKYESAAAFWPQV  624

Query  151  HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H RV+  LI+ Q+ ++G F   GV K  +  +++  P+L+  F  VC  +F
Sbjct  625  HLRVIIGLIISQILLMGLFSTLGVAKSTF--ILVAQPVLTIWFHRVCKGRF  673



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG+ S+S   R ++ KY+ F   NVF+G  +  +  D LK+ I  + N I   +  
Sbjct  444  MSKFEGLISQSSLERRSASKYYIFLFFNVFLGSIVTGSALDQLKAYIHQSANEIPRTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T+V +  + G   E+ R+  LIIFHLK  ++ KT+ + +EA  PG + + 
Sbjct  504  AIPMRATFFITYVMVDGWTGVAGEILRLRALIIFHLKNFFLVKTEKDREEAMDPGSICFD  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ P+++PF  V+FGL +++ R+Q + VY   +ES  + WP +
Sbjct  564  WCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQYESGAQFWPSV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL +IG    K F    P+++ LP+L+F F   C  +F
Sbjct  624  HGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRF  672



>ref|XP_007200309.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
 gb|EMJ01508.1| hypothetical protein PRUPE_ppa001848mg [Prunus persica]
Length=756

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 130/231 (56%), Gaps = 6/231 (3%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSIEDNPNsiisllats  509
            +SK EG  S S   R ++ KY  F ++NVF+G  +  T    L+ + + P++  +     
Sbjct  445  MSKIEGFTSLSSLDRRSAAKYHLFILINVFLGSIVTGTALQQLEKLMNEPSTEFTKTVGR  504

Query  508  lp-ssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
                 ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A  PG L +A
Sbjct  505  SIPMKATFFITYIMVDGWSGVAAEIVRLVPLILFHLKNTFLVKTEEDREQAMDPGSLNFA  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y V+ PI++PF  ++F   +L+ R+Q + VY   +ES    WP +
Sbjct  565  TNEPRTQLYFLLGLVYCVVTPILLPFILIFFSFAYLVFRHQIINVYDQKYESAAAFWPQV  624

Query  151  HTRVVAALILYQLTMIGYF---GVKKFPYAPLVIPLPILSFLFAFVCSKKF  8
            H RV+  LI+ Q+ ++G F   GV K  +  +++  P+L+  F  VC  +F
Sbjct  625  HLRVIIGLIISQILLMGLFSTLGVAKSTF--ILVAQPVLTIWFHRVCKGRF  673



>ref|XP_004245915.1| PREDICTED: CSC1-like protein At1g32090 [Solanum lycopersicum]
Length=815

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R  + KY+YF ++NVF+G  +  T F  L + + ++   I   +  
Sbjct  446  MSKIEGHVALSVLERRTAAKYYYFMLVNVFLGSIVAGTAFQQLHAFLHESATQIPRNIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ +++ A  PG + + 
Sbjct  506  SIPMKATFFMTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDVERAMDPGSIDFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  ++F   +L+ R+Q + VY   +ES    WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILIFFAFAYLVYRHQVINVYNQRYESCAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++A+L++ QL ++G    KK   + P ++ LP+L+  F   C  +F
Sbjct  626  HGRIIASLVISQLLLMGLLSTKKAAKSTPFLVVLPVLTLTFHKYCKSRF  674



>ref|XP_004146108.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 ref|XP_004164183.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
sativus]
 gb|KGN55705.1| hypothetical protein Csa_3G006670 [Cucumis sativus]
Length=795

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 137/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R A+ KY+YF ++NVF+G  +  T F+ L S I  +P  I   +  
Sbjct  446  MSKIEGHVAVSALERRAAAKYYYFMLVNVFLGSIVTGTAFEQLDSFIHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  +M KT+ +  +A  PG + + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNLFMVKTERDRAKAMDPGSVEFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + YSV+ PI++PF  V+F   +L+ R+Q + VY   +ES G  WPH+
Sbjct  566  ETLPSLQLYFLLGIVYSVVTPILLPFILVFFAFAYLVYRHQIINVYNQHYESVGAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLLGLLSTKKAANSTPLLVALPILTLFFHKYCKNRF  674



>ref|XP_010235059.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Brachypodium 
distachyon]
Length=699

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  S S   R  + KY+YF ++NVF+G  I  T F+ L S   D P+ I   +  
Sbjct  348  MSKVEGYVSLSSLERRTASKYYYFMLVNVFLGSIIAGTAFEQLYSFFHDPPSQIPRTIGV  407

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + + A  PG +G  
Sbjct  408  AVPMKATFFMTYIMVDGWAGIANEILRVKPLIIYHLKNMFIVKTERDRERAMDPGSIGLG  467

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  468  ENLPSLQLYFLLGLVYAVVTPILLPFIIVFFAFAFLVYRHQIINVYNQEYESAAAFWPQV  527

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ Q+T+ G     K  Y+ PL+I LP+L+  F   C  +F
Sbjct  528  HSRIIASLLISQVTLFGLLSTMKAAYSTPLLIFLPLLTIWFHKYCKSRF  576



>ref|XP_006352918.1| PREDICTED: uncharacterized protein RSN1-like [Solanum tuberosum]
Length=815

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R  + KY+YF ++NVF+G  +  T F  L + + ++   I   +  
Sbjct  446  MSKIEGHVALSVLERRTAAKYYYFMLVNVFLGSIVAGTAFQQLHAFLHESATQIPRNIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  ++ KT+ +++ A  PG + + 
Sbjct  506  SIPMKATFFMTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDVERAMDPGSVDFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  ++F   +L+ R+Q + VY   +ES    WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILIFFAFAYLVYRHQVINVYNQRYESCAAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++A+L++ QL ++G    KK   + P ++ LP+L+  F   C  +F
Sbjct  626  HGRIIASLVISQLLLMGLLSTKKAAKSTPFLVVLPVLTLTFHKYCKSRF  674



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R A+ +Y+ F ++NVF+   I    F+ L S +  + N I   +  
Sbjct  374  MSKFEGFTSISSLERRAAFRYYIFNLVNVFLASVIAGAAFEQLNSFLNQSANQIPKTIGV  433

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KTD + +EA  PG +G+ 
Sbjct  434  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTDKDREEAMDPGSIGFN  493

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  494  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  553

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  554  HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  602



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  440  MSKFEGFISISGLERRSAARYYIFQFINVFLGSIITGTAFQQLDNFIHQSATEIPKTIGV  499

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  +M KT+ +++EA  PG LG+ 
Sbjct  500  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKMFFMVKTEKDMEEAMDPGTLGFN  559

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  560  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  619

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ A+I+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  620  HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHLFCKGRY  668



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  444  MSKFEGFISISGLERRSAARYYIFQFINVFLGSIITGTAFQQLDNFIHQSATEIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  +M KT+ +++EA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKMFFMVKTEKDMEEAMDPGTLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ A+I+ QL ++G    K+   + PL+I LP+L+  F   C  ++
Sbjct  624  HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLIALPVLTIWFHLFCKGRY  672



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  444  MSKFEGFISLSGLERRSAARYYIFQFVNVFLGSIITGTAFQQLDNFIHQSATQIPKTVGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + KEA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDKKEAMDPGTLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ A+I+ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  624  HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRY  672



>ref|XP_003574401.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Brachypodium 
distachyon]
Length=794

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKSI-EDNPNsiisllat  512
            +SK EG  S S   R  + KY+YF ++NVF+G  I  T F+ L S   D P+ I   +  
Sbjct  443  MSKVEGYVSLSSLERRTASKYYYFMLVNVFLGSIIAGTAFEQLYSFFHDPPSQIPRTIGV  502

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + + A  PG +G  
Sbjct  503  AVPMKATFFMTYIMVDGWAGIANEILRVKPLIIYHLKNMFIVKTERDRERAMDPGSIGLG  562

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WP +
Sbjct  563  ENLPSLQLYFLLGLVYAVVTPILLPFIIVFFAFAFLVYRHQIINVYNQEYESAAAFWPQV  622

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ Q+T+ G     K  Y+ PL+I LP+L+  F   C  +F
Sbjct  623  HSRIIASLLISQVTLFGLLSTMKAAYSTPLLIFLPLLTIWFHKYCKSRF  671



>emb|CDX79125.1| BnaA01g11920D [Brassica napus]
Length=695

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+   I    F+ L + +  +PN I   +  
Sbjct  448  MSKFEGFTSISSLERRSASRYYIFNFVNVFLASVITGAAFEQLSAFLNQSPNQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNTFLVKTEKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AALI+ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFNHFCKGRY  676



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG+ S S   R ++ KY+ F   NVF+G  I  +  + L+S +  + N I   +  
Sbjct  444  MSKVEGLTSVSSLERRSASKYYIFLFFNVFLGSIIAGSALEQLQSYLHQSANQIPRTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T+V +  + G   E+ R+ PL+IFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  504  AIPMKATFFITYVMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGSIGFD  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++ L Y+V+ P ++PF  ++FGL +++ R+Q + VY   +ES    WP +
Sbjct  564  SNEPQIQLYFLLGLVYAVVTPFLLPFILIFFGLAYVVYRHQIINVYNQEYESAAAFWPSV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL  +G    K    + P+++ LP+++F F   C  ++
Sbjct  624  HGRIITALIISQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRY  672



>ref|XP_010496174.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=772

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+   I    F+ L S +  +PN I   +  
Sbjct  449  MSKFEGFTSISSLERRSASRYYIFNFVNVFLANVIAGAAFEQLSSFLNQSPNQIPKTVGM  508

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  509  AIPMKATFFITYIMIDGWAGVAGEILMLKPLIIFHLKNAFLVKTEKDREEAMDPGSIGFN  568

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++P+  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  569  TGEPQIQLYFLLGLVYAPVTPMLLPYILVFFGLAYIVYRHQIINVYNQEYESAAAFWPDV  628

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV++ALI+ QL ++G    K+    AP +I LP+++  F   C  ++
Sbjct  629  HGRVISALIISQLLLMGLLATKRAALAAPFLIALPVITIGFHRFCKGRY  677



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG+ S+S   R ++ KY+ F   NVF+G  +  +  D LK+ I  + N I   +  
Sbjct  444  MSKFEGLISQSSLERRSASKYYIFLFFNVFLGSIVTGSALDQLKAYIHQSANEIPRTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T+V +  + G   E+ R+  LIIFHLK  ++ KT+ + +EA  PG + + 
Sbjct  504  AIPMRATFFITYVMVDGWTGVAGEILRLRALIIFHLKNFFLVKTEKDREEAMDPGSICFD  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ L Y+V+ P+++PF  V+FGL +++ R+Q + VY   +ES  + WP +
Sbjct  564  WCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVYNQQYESGAQFWPSV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL +IG    K F    P+++ LP+L+F F   C  +F
Sbjct  624  HGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRF  672



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTL-KSIEDNPNsiisllat  512
            +SK EG  S+S   R  + +Y+ F  +NVF+G  I  T F  L K I  + N I   +  
Sbjct  444  MSKFEGFISQSSLERRCASRYYIFQFINVFLGSIITGTAFQQLDKFIHQSANEIPKTIGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLI +HLK   + KT+ + +EA  PG +G+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFLLVKTEKDREEAMDPGTIGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L YSV+ P ++P+  V+FGL +L+ R+Q + VY   +ES G  WP +
Sbjct  564  TGEPQIQLYFLLGLVYSVVTPFLLPYIIVFFGLAYLVYRHQIINVYNQEYESAGAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R+V AL++ QL ++G    K+   + PL+I LP+L+  F   C   +
Sbjct  624  HGRIVFALVVSQLLLMGLLSTKEAANSTPLLIALPVLTIWFHRFCKGSY  672



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/229 (36%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + I  +   I   +  
Sbjct  444  MSKFEGFISLSSLERRSAARYYIFQFINVFLGSIITGTAFQQLDNFIHQSATQIPKTVGV  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG LG+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTLGFN  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V++PI++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  623

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ A+I+ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  624  HGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRY  672



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R A+ +Y+ F ++NVF+   I    F+ L S +  + N I   +  
Sbjct  448  MSKFEGFTSISSLERRAAFRYYIFNLVNVFLASVIAGAAFEQLNSFLNQSANQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KTD + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTDKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  676



>ref|XP_004300169.1| PREDICTED: CSC1-like protein At1g32090 [Fragaria vesca subsp. 
vesca]
Length=833

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R  + KY+YF ++NVF+G  +  T F  L + +  +P  I   +  
Sbjct  447  MSKIEGHIALSTLERRTAAKYYYFMLVNVFLGSIVTGTAFQQLHAFLHQSPTQIPRNIGE  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++PS ATFF+T++ +  +     E+ R+ PL+IFHLK  ++ KT+ + ++A  PG + + 
Sbjct  507  TIPSKATFFITYIMVDGWAAVAGEILRLKPLVIFHLKNMFLVKTERDREKATNPGSVDFP  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES    WPH+
Sbjct  567  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYDQQYESAAAFWPHV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + P ++ LPIL+  F   C  +F
Sbjct  627  HSRIIASLLISQLLLMGLLSTKKAANSTPFLVALPILTLSFHKYCKYRF  675



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R A+ +Y+ F ++NVF+   I    F+ L S +  + N I   +  
Sbjct  448  MSKFEGFTSISSLERRAAFRYYIFNLVNVFLASVIAGAAFEQLNSFLNQSANQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KTD + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDSWAGVAGEILMLKPLIMFHLKNAFLVKTDKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALVISQLFLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  676



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y++F ++NVF+G  I  T F+ L S I+ + N I   +  
Sbjct  446  MSKFEGFASLSSLERRSATRYYFFNIVNVFLGSIITGTAFEQLNSFIKQSANDIPKTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG LG+ 
Sbjct  506  AIPMKATFFITYIMVDGWAGIAGEVLMLKPLIIFHLKNFFLVKTEKDREEAMHPGSLGFN  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P      ++ L Y+ + P ++PF  V+F   +++ R+Q + VY   +ES    WP +
Sbjct  566  TGEPRIQFYFLLGLVYATVTPTLLPFIIVFFAFAYVVFRHQIINVYDQEYESGAAFWPDV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RV+ ALI+ Q+ MIG    K+   + P +I LP+L+  F   C  ++
Sbjct  626  HGRVITALIISQVLMIGLLSTKRAAQSTPFLIVLPVLTIWFHRFCKGRY  674



>ref|XP_008448614.1| PREDICTED: uncharacterized protein RSN1 [Cucumis melo]
 ref|XP_008448615.1| PREDICTED: uncharacterized protein RSN1 [Cucumis melo]
Length=795

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 137/229 (60%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R A+ KY+YF ++NVF+G  +  T F+ L S I  +P  I   +  
Sbjct  446  MSKIEGHVAVSALERRAAAKYYYFMLVNVFLGSIVTGTAFEQLDSFIHQSPTQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PL+IFHLK  +M KT+ +  +A  PG + + 
Sbjct  506  SIPMKATFFITYIMVDGWAGIASEILRLKPLVIFHLKNLFMVKTERDRAKAMDPGSVEFP  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
               P   L  ++ + Y+V+ PI++PF  V+F   +L+ R+Q + VY   +ES G  WPH+
Sbjct  566  ETLPSLQLYFLLGIVYAVVTPILLPFILVFFAFAYLVYRHQIINVYNQHYESVGAFWPHV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H+R++A+L++ QL ++G    KK   + PL++ LPIL+  F   C  +F
Sbjct  626  HSRIIASLLISQLLLLGLLSTKKAANSTPLLVALPILTLFFHKYCKNRF  674



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 135/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  +  + L + ++ +PN I   +  
Sbjct  446  MSKFEGFISISSLERRSASRYYLFNFVNVFLGSIITGSALEQLNTFMKQSPNQIPRTIGV  505

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF++++ +  + G   E+  + PLIIFHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  506  AIPMKATFFISYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTEKDREEAMDPGSIGFN  565

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  566  TGEPRIQLYFLLGLVYAVVTPVLLPFIIVFFCLAYVVFRHQIINVYNQEYESGAAFWPDV  625

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ ALI+ QL ++G    K+   + P +I LPIL+  F + C  +F
Sbjct  626  HGRIIGALIISQLLLMGLLSTKQAAQSTPFLIALPILTISFHYYCKGRF  674



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  + S   R ++ +Y+ F  +NVF+   I  T  + LK+ +   PN I  ++  
Sbjct  444  MSKFEGFEALSKLERRSASRYYIFNFVNVFLASVITGTAINQLKTFLSQPPNKIFEIIGM  503

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + + A   G +G+ 
Sbjct  504  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNWFLVKTEKDREAAMDAGSIGFD  563

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L +++ L Y+V+ PI++PF  V+FG  +L+ R+Q + VY   +ES    WP +
Sbjct  564  TGEPQIQLYILLGLVYAVVTPILLPFILVFFGFSYLVYRHQIINVYNQEYESAAAFWPSV  623

Query  151  HTRVVAALILYQLTMIGYFGVKK-FPYAPLVIPLPILSFLFAFVCSKKF  8
            H R+++A++  QL ++G  G KK    +P +I LPIL+  F   C  +F
Sbjct  624  HGRIISAMVFSQLLLMGLIGTKKAASSSPFLIALPILTIWFHRFCKGRF  672



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+   I    F+ L S +  +PN I   +  
Sbjct  448  MSKFEGFTSISSLERRSAFRYYIFNLVNVFLASVITGAAFEQLNSFLNQSPNQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  676



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+   I    F+ L + +  +PN I   +  
Sbjct  448  MSKFEGFTSISSLERRSASRYYIFNFVNVFLASVITGAAFEQLSAFLNQSPNQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNTFLVKTEKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AALI+ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  676



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+   I    F+ L S +  +PN I   +  
Sbjct  448  MSKFEGFTSISSLERRSAFRYYIFNLVNVFLASVITGAAFEQLNSFLNQSPNQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  676



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+   I    F+ L S +  +PN I   +  
Sbjct  448  MSKFEGFTSISSLERRSAFRYYIFNLVNVFLASVITGAAFEQLNSFLNQSPNQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  676



>ref|XP_006469645.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
Length=599

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 134/229 (59%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F  +NVF+G  I  T F  L + +  + N I   + T
Sbjct  284  MSKFEGFISRSALERRSATRYYIFLFINVFLGSIITGTAFQQLDNFMHQSANDIPKTIGT  343

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            S+P  ATFF+T++ +  + G   E+ R+ PLII+HLK  ++ KT+ + +EA  PG +G+ 
Sbjct  344  SIPMKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTVGFN  403

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+V+ P ++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  404  TGEPQIQLYFLLGLVYAVVTPFLLPFIIVFFALAFVVYRHQIINVYNQEYESAAAFWPDV  463

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H R++ AL++ QL ++G    K+   + PL+I LPIL+  F   C  ++
Sbjct  464  HGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRY  512



>gb|EYU46618.1| hypothetical protein MIMGU_mgv1a001779mg [Erythranthe guttata]
Length=760

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG+ S S   R ++GKY +F ++NVF G  I    F  LK+ +  +P+ I   +  
Sbjct  445  MSKIEGLTSLSSLDRRSAGKYHFFLLVNVFFGSLITGAAFQQLKTFLNQSPSEIPITVGV  504

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+ R+VPLI+FHLK  ++ KT+ + ++A   G + + 
Sbjct  505  AIPMKATFFITYIMVDGWAGIAAEILRLVPLIMFHLKNTFLVKTEQDREQAMDAGCINFP  564

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            +  P   L  ++ L YSV+ P+I+PF  V+F   +++ R+Q + VY   +ES    WP +
Sbjct  565  SSEPRIQLYFLLGLVYSVVTPLILPFIIVFFAFSYVVFRHQIINVYDQKYESGAAFWPAV  624

Query  151  HTRVVAALILYQLTMIGYFGVKKFPYA-PLVIPLPILSFLFAFVCSKKF  8
            H RV+  L++ Q  ++G    K+   A P +I LP+L+  F   C  +F
Sbjct  625  HRRVIIGLVISQFLLLGLLSTKRIAKATPFLIALPVLTIWFHRFCKGRF  673



>ref|XP_006396700.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 ref|XP_006396701.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38153.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38154.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=770

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 132/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R A+ +Y+ F  +NVF+   I    F+ L S +  +PN I   +  
Sbjct  447  MSKFEGFTSLSSLERRAASRYYIFNFVNVFLANVIAGAAFEQLNSFLNQSPNQIPKTIGV  506

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLII+HLK  ++ KT+ + + A  PG +G+ 
Sbjct  507  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEKDREAAMDPGSIGFN  566

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+FGL +++ R+Q + VY   +ES    WP +
Sbjct  567  TGEPQIQLYFLLGLVYAPVTPMLLPFILVFFGLAYIVYRHQIINVYNQEYESGAAFWPDV  626

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV++ALI+ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  627  HGRVISALIISQLLLMGLLGTKHAASAAPFLIVLPVLTIGFHRFCKGRY  675



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 133/229 (58%), Gaps = 2/229 (1%)
 Frame = -3

Query  688  LSKAEGIPSESHAVRAASGKYFYFTVLNVFIGVTIGSTLFDTLKS-IEDNPNsiisllat  512
            +SK EG  S S   R ++ +Y+ F ++NVF+   +    F+ L S +  +PN I   +  
Sbjct  448  MSKFEGFTSISSLERRSAFRYYIFNLVNVFLASVVTGAAFEQLNSFLNQSPNQIPKTIGV  507

Query  511  slpssaTFFLTFVALKFFVGYGLELSRIVPLIIFHLKKKYMCKTDAEIKEAWAPGDLGYA  332
            ++P  ATFF+T++ +  + G   E+  + PLI+FHLK  ++ KT+ + +EA  PG +G+ 
Sbjct  508  AIPMKATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEKDREEAMDPGSIGFN  567

Query  331  TRFPGDMLVLIICLCYSVIAPIIIPFGAVYFGLGWLLLRNQALKVYVPSFESYGKMWPHM  152
            T  P   L  ++ L Y+ + P+++PF  V+F L +++ R+Q + VY   +ES    WP +
Sbjct  568  TGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVYNQEYESAAAFWPDV  627

Query  151  HTRVVAALILYQLTMIGYFGVKKFPY-APLVIPLPILSFLFAFVCSKKF  8
            H RV+AAL++ QL ++G  G K     AP +I LP+L+  F   C  ++
Sbjct  628  HGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCKGRY  676



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520