BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028H23

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACD75598.1|  phototropin 2                                           152   2e-42   Verbena perennis
gb|ACD75649.1|  phototropin 2                                           152   4e-42   Junellia spathulata
gb|ACD75652.1|  phototropin 2                                           150   6e-42   Junellia crithmifolia
gb|ACD75593.1|  phototropin 2                                           150   1e-41   Verbena menthifolia
gb|ACD75642.1|  phototropin 2                                           150   1e-41   Glandularia parodii
gb|ACD75601.1|  phototropin 2                                           150   1e-41   Verbena macdougalii [New Mexico vervain]
gb|ACD75595.1|  phototropin 2                                           150   1e-41   Verbena hirtella
gb|ACD75594.1|  phototropin 2                                           150   1e-41   Verbena hastata [American blue vervain]
gb|ACD75600.1|  phototropin 2                                           150   1e-41   Verbena bracteata [creeping vervain]
gb|ACD75603.1|  phototropin 2                                           150   1e-41   Verbena bonariensis [purpletop]
gb|ACD75645.1|  phototropin 2                                           150   2e-41   Glandularia microphylla
gb|ACD75623.1|  phototropin 2                                           150   2e-41   Glandularia gooddingii var. nepetifolia
gb|ACD75614.1|  phototropin 2                                           149   2e-41   Verbena hispida
gb|ACD75641.1|  phototropin 2                                           150   2e-41   Glandularia flava
gb|ACD75661.1|  phototropin 2                                           150   2e-41   Aloysia virgata
gb|ACD75608.1|  phototropin 2                                           149   2e-41   Verbena litoralis [seashore vervain]
gb|ACD75629.1|  phototropin 2                                           149   2e-41   Glandularia bipinnatifida [Dakota mock vervain]
gb|ACD75647.1|  phototropin 2                                           149   2e-41   Junellia seriphioides
gb|ACD75586.1|  phototropin 2                                           149   3e-41   Verbena halei
gb|ACD75591.1|  phototropin 2                                           149   3e-41   Verbena orcuttiana
gb|ACD75587.1|  phototropin 2                                           149   3e-41   Verbena urticifolia [bur-vine]
gb|ACD75590.1|  phototropin 2                                           149   3e-41   Verbena lasiostachys
gb|ACD75648.1|  phototropin 2                                           149   4e-41   Junellia uniflora
gb|ACD75605.1|  phototropin 2                                           149   4e-41   Verbena montevidensis
gb|ACD75655.1|  phototropin 2                                           149   6e-41   Mulguraea asparagoides
gb|ACD75615.1|  phototropin 2                                           149   6e-41   Glandularia aristigera
gb|ACD75656.1|  phototropin 2                                           149   6e-41   Mulguraea asparagoides
gb|ACD75602.1|  phototropin 2                                           148   7e-41   Verbena bonariensis [purpletop]
gb|ACD75633.1|  phototropin 2                                           148   1e-40   Glandularia dissecta
gb|KDO68441.1|  hypothetical protein CISIN_1g0427722mg                  152   1e-40   Citrus sinensis [apfelsine]
gb|ACD75636.1|  phototropin 2                                           148   1e-40   Glandularia aurantiaca
gb|ACD75653.1|  phototropin 2                                           147   3e-40   Mulguraea scoparia
gb|KHN17358.1|  Phototropin-2                                           155   2e-39   Glycine soja [wild soybean]
ref|XP_003547866.1|  PREDICTED: phototropin-2-like                      155   3e-39   Glycine max [soybeans]
ref|XP_003531942.1|  PREDICTED: phototropin-2-like isoform X1           154   5e-39   Glycine max [soybeans]
ref|XP_010090738.1|  hypothetical protein L484_013760                   154   5e-39   
ref|XP_006384883.1|  hypothetical protein POPTR_0004s21940g             153   1e-38   
ref|XP_010270626.1|  PREDICTED: phototropin-2                           153   1e-38   Nelumbo nucifera [Indian lotus]
emb|CAA82993.1|  protein kinase                                         151   2e-38   Spinacia oleracea
ref|XP_006422370.1|  hypothetical protein CICLE_v10027745mg             153   2e-38   Citrus clementina [clementine]
emb|CBI37708.3|  unnamed protein product                                152   2e-38   Vitis vinifera
ref|XP_002280118.1|  PREDICTED: phototropin-2                           153   2e-38   Vitis vinifera
ref|XP_006422369.1|  hypothetical protein CICLE_v10027745mg             152   2e-38   
ref|XP_006486547.1|  PREDICTED: phototropin-2-like isoform X1           152   2e-38   Citrus sinensis [apfelsine]
ref|XP_004154580.1|  PREDICTED: phototropin-2-like                      150   2e-38   
ref|XP_006379377.1|  hypothetical protein POPTR_0009s171801g            150   4e-38   
gb|AFA36479.1|  nonphototrophic hypocotyl 1b                            142   4e-38   Lolium perenne [perennial ryegrass]
gb|KCW55711.1|  hypothetical protein EUGRSUZ_I01551                     150   4e-38   Eucalyptus grandis [rose gum]
ref|XP_011000842.1|  PREDICTED: phototropin-2-like isoform X2           152   4e-38   Populus euphratica
ref|XP_011000841.1|  PREDICTED: phototropin-2-like isoform X1           152   4e-38   Populus euphratica
ref|XP_008448153.1|  PREDICTED: phototropin-2                           151   5e-38   Cucumis melo [Oriental melon]
ref|XP_011040851.1|  PREDICTED: phototropin-2-like                      151   5e-38   Populus euphratica
ref|XP_009588418.1|  PREDICTED: phototropin-2                           151   6e-38   Nicotiana tomentosiformis
ref|XP_009805047.1|  PREDICTED: phototropin-2                           151   6e-38   Nicotiana sylvestris
ref|XP_010690596.1|  PREDICTED: phototropin-2                           150   7e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB79767.1|  hypothetical protein B456_013G065600                    150   7e-38   Gossypium raimondii
ref|XP_011091959.1|  PREDICTED: phototropin-2 isoform X2                151   8e-38   Sesamum indicum [beniseed]
gb|KHG27336.1|  Phototropin-2                                           151   8e-38   Gossypium arboreum [tree cotton]
ref|XP_011091958.1|  PREDICTED: phototropin-2 isoform X1                151   8e-38   Sesamum indicum [beniseed]
gb|KHG27337.1|  Phototropin-2                                           150   8e-38   Gossypium arboreum [tree cotton]
gb|KCW55712.1|  hypothetical protein EUGRSUZ_I01551                     150   9e-38   Eucalyptus grandis [rose gum]
gb|KCW55713.1|  hypothetical protein EUGRSUZ_I01551                     150   9e-38   Eucalyptus grandis [rose gum]
gb|KJB47146.1|  hypothetical protein B456_008G012600                    150   1e-37   Gossypium raimondii
gb|KHG01262.1|  Phototropin-2 -like protein                             150   1e-37   Gossypium arboreum [tree cotton]
ref|XP_007043127.1|  Phototropin 2 isoform 2                            150   1e-37   
ref|XP_007043126.1|  Phototropin 2 isoform 1                            150   1e-37   
emb|CDP08542.1|  unnamed protein product                                150   1e-37   Coffea canephora [robusta coffee]
gb|KJB79764.1|  hypothetical protein B456_013G065600                    149   1e-37   Gossypium raimondii
ref|XP_010028883.1|  PREDICTED: phototropin-2                           150   2e-37   
ref|XP_007156298.1|  hypothetical protein PHAVU_003G274800g             150   2e-37   Phaseolus vulgaris [French bean]
dbj|BAD89968.1|  phototropin                                            150   2e-37   Phaseolus vulgaris [French bean]
gb|KJB79759.1|  hypothetical protein B456_013G065600                    150   2e-37   Gossypium raimondii
gb|AHZ63856.1|  phototropin                                             150   2e-37   Podocarpus rubens
ref|XP_004140063.1|  PREDICTED: phototropin-2-like                      149   2e-37   Cucumis sativus [cucumbers]
ref|XP_006347791.1|  PREDICTED: phototropin-2-like isoform X1           149   3e-37   Solanum tuberosum [potatoes]
ref|NP_001234289.1|  phototropin-2                                      149   3e-37   
gb|ABI48276.1|  phototropin-2                                           149   3e-37   Solanum lycopersicum
ref|XP_010323569.1|  PREDICTED: phototropin-2 isoform X1                149   3e-37   Solanum lycopersicum
ref|XP_008235843.1|  PREDICTED: phototropin-2                           148   6e-37   Prunus mume [ume]
ref|XP_002514387.1|  serine/threonine protein kinase, putative          148   7e-37   
ref|XP_004509617.1|  PREDICTED: phototropin-2-like isoform X2           147   1e-36   
emb|CDY58574.1|  BnaC03g12530D                                          147   1e-36   Brassica napus [oilseed rape]
ref|XP_010518759.1|  PREDICTED: phototropin-2 isoform X3                145   1e-36   
ref|XP_010518758.1|  PREDICTED: phototropin-2 isoform X2                145   1e-36   
ref|XP_004509616.1|  PREDICTED: phototropin-2-like isoform X1           146   3e-36   Cicer arietinum [garbanzo]
ref|XP_009120327.1|  PREDICTED: phototropin-2                           146   3e-36   Brassica rapa
gb|EPS68603.1|  phototropin-2                                           144   3e-36   Genlisea aurea
ref|XP_009132080.1|  PREDICTED: phototropin-2-like isoform X2           146   4e-36   
emb|CDX88659.1|  BnaA03g09900D                                          146   4e-36   
gb|EMT18478.1|  Phototropin-2                                           141   5e-36   
emb|CDY43878.1|  BnaC09g33650D                                          145   5e-36   Brassica napus [oilseed rape]
ref|XP_008796425.1|  PREDICTED: phototropin-2                           145   5e-36   Phoenix dactylifera
emb|CDY62690.1|  BnaA10g29230D                                          145   5e-36   Brassica napus [oilseed rape]
ref|XP_010927466.1|  PREDICTED: phototropin-2-like isoform X3           145   5e-36   Elaeis guineensis
ref|XP_009132076.1|  PREDICTED: phototropin-2-like isoform X1           145   6e-36   Brassica rapa
ref|XP_007199701.1|  hypothetical protein PRUPE_ppa000797mg             145   6e-36   Prunus persica
ref|XP_009358919.1|  PREDICTED: phototropin-2 isoform X3                145   7e-36   Pyrus x bretschneideri [bai li]
ref|XP_010518754.1|  PREDICTED: phototropin-2 isoform X1                145   8e-36   
ref|XP_010927465.1|  PREDICTED: phototropin-2-like isoform X2           145   8e-36   
ref|XP_009126788.1|  PREDICTED: phototropin-2-like isoform X2           145   9e-36   Brassica rapa
ref|XP_010927468.1|  PREDICTED: phototropin-2-like isoform X4           144   1e-35   Elaeis guineensis
ref|XP_010927463.1|  PREDICTED: phototropin-2-like isoform X1           144   1e-35   Elaeis guineensis
ref|XP_006653257.1|  PREDICTED: phototropin-2-like                      144   1e-35   
ref|XP_009126786.1|  PREDICTED: phototropin-2-like isoform X1           144   2e-35   Brassica rapa
ref|XP_008364373.1|  PREDICTED: phototropin-2-like                      144   2e-35   
ref|XP_009358918.1|  PREDICTED: phototropin-2 isoform X2                144   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_009358915.1|  PREDICTED: phototropin-2 isoform X1                144   2e-35   Pyrus x bretschneideri [bai li]
emb|CDY32722.1|  BnaA02g07840D                                          144   3e-35   Brassica napus [oilseed rape]
gb|KDP47050.1|  hypothetical protein JCGZ_10777                         143   3e-35   Jatropha curcas
emb|CDY02797.1|  BnaC02g10920D                                          143   3e-35   
ref|XP_009415438.1|  PREDICTED: phototropin-2                           143   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004290098.1|  PREDICTED: phototropin-2                           143   3e-35   Fragaria vesca subsp. vesca
dbj|BAM36550.1|  phototropin 2                                          143   4e-35   Fragaria x ananassa
ref|NP_568874.2|  phototropin 2                                         140   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483375.1|  PREDICTED: phototropin-2 isoform X3                140   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006849852.1|  hypothetical protein AMTR_s00022p00051940          140   3e-34   Amborella trichopoda
ref|XP_006401122.1|  hypothetical protein EUTSA_v10012609mg             140   6e-34   Eutrema salsugineum [saltwater cress]
ref|NP_001052415.1|  Os04g0304200                                       139   6e-34   
ref|NP_851212.2|  phototropin 2                                         139   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483373.1|  PREDICTED: phototropin-2 isoform X1                139   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010453258.1|  PREDICTED: phototropin-2-like                      139   7e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010443529.1|  PREDICTED: phototropin-2-like                      139   7e-34   Camelina sativa [gold-of-pleasure]
ref|NP_851210.1|  phototropin 2                                         139   9e-34   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ST27.1|PHOT2_ORYSJ  RecName: Full=Phototropin-2; AltName: Fu...    139   9e-34   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60710.1|  hypothetical protein OsJ_14207                          139   9e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581132.1|  PREDICTED: phototropin-2                           139   1e-33   Brachypodium distachyon [annual false brome]
gb|AHZ63858.1|  phototropin                                             139   1e-33   Thuja plicata [giant arborvitae]
gb|AHZ63859.1|  phototropin                                             138   2e-33   Stangeria eriopus
dbj|BAP74418.1|  phototropin 2                                          137   3e-33   Vallisneria gigantea
ref|XP_004975243.1|  PREDICTED: phototropin-2-like isoform X1           137   4e-33   
gb|AET03431.2|  phototropin-2 protein                                   137   4e-33   Medicago truncatula
gb|AHZ63855.1|  phototropin                                             137   6e-33   Cephalotaxus harringtonia
ref|XP_008382524.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-...    135   3e-32   
gb|AHZ63900.1|  phototropin                                             134   5e-32   Timmia austriaca
ref|XP_003628955.1|  Phototropin                                        133   1e-31   
tpg|DAA49183.1|  TPA: putative phototropin family protein kinase        132   1e-31   
gb|AHZ63848.1|  phototropin                                             133   1e-31   Cephalotaxus harringtonia
gb|AHZ63857.1|  phototropin                                             133   1e-31   Cunninghamia lanceolata [China fir]
ref|XP_006281965.1|  hypothetical protein CARUB_v10028188mg             130   2e-31   
gb|EMS49903.1|  Phototropin-2                                           130   2e-31   Triticum urartu
gb|AHZ63901.1|  phototropin                                             130   2e-31   Polytrichum commune
gb|AHZ63899.1|  phototropin                                             132   2e-31   Scouleria aquatica
gb|AHZ63902.1|  phototropin                                             132   3e-31   Sphagnum lescurii
gb|EPS65128.1|  phototropin-1                                           129   3e-31   Genlisea aurea
ref|XP_002991589.1|  hypothetical protein SELMODRAFT_186203             132   3e-31   
ref|NP_001147477.1|  phototropin-1                                      132   3e-31   
ref|XP_002445377.1|  hypothetical protein SORBIDRAFT_07g014860          132   3e-31   Sorghum bicolor [broomcorn]
ref|XP_008674095.1|  PREDICTED: phototropin-1 isoform X1                131   4e-31   Zea mays [maize]
gb|ACD75534.1|  phototropin 1                                           122   4e-31   Verbena orcuttiana
gb|ACD75585.1|  phototropin 1                                           122   5e-31   Aloysia virgata
gb|ACD75557.1|  phototropin 1                                           122   5e-31   Glandularia gooddingii var. nepetifolia
ref|XP_002971709.1|  hypothetical protein SELMODRAFT_172224             131   6e-31   
gb|ACD75573.1|  phototropin 1                                           122   6e-31   Junellia uniflora
gb|ACD75576.1|  phototropin 1                                           122   6e-31   Junellia crithmifolia
ref|XP_010112314.1|  hypothetical protein L484_011180                   131   7e-31   
gb|ACD75536.1|  phototropin 1                                           122   7e-31   Verbena perennis
gb|AHZ63851.1|  phototropin                                             131   7e-31   Thuja plicata [giant arborvitae]
gb|ACD75556.1|  phototropin 1                                           122   8e-31   Glandularia gooddingii var. nepetifolia
gb|ACD75575.1|  phototropin 1                                           122   8e-31   Junellia spathulata
gb|AHZ63898.1|  phototropin                                             131   8e-31   Anomodon rostratus
gb|AHZ63886.1|  phototropin                                             130   1e-30   Conocephalum conicum
gb|AHZ63850.1|  phototropin                                             130   1e-30   Cunninghamia lanceolata [China fir]
gb|ACD75545.1|  phototropin 1                                           121   1e-30   Verbena hispida
gb|AHZ63861.1|  phototropin                                             130   1e-30   Gnetum montanum
gb|ACD75574.1|  phototropin 1                                           121   1e-30   Junellia seriphioides
gb|AHZ63885.1|  phototropin                                             130   1e-30   Marchantia polymorpha
dbj|BAP28445.1|  phototropin                                            130   2e-30   Marchantia polymorpha
gb|ACD75552.1|  phototropin 1                                           120   2e-30   Glandularia bipinnatifida [Dakota mock vervain]
gb|ACD75555.1|  phototropin 1                                           121   2e-30   Glandularia bipinnatifida [Dakota mock vervain]
gb|ACD75535.1|  phototropin 1                                           121   2e-30   Verbena canescens [gray vervain]
gb|ACD75538.1|  phototropin 1                                           121   2e-30   Verbena macdougalii [New Mexico vervain]
gb|ACD75542.1|  phototropin 1                                           120   2e-30   Verbena halei
gb|AGU41988.1|  phototropin 1                                           121   2e-30   Nicotiana tabacum [American tobacco]
gb|ACD75571.1|  phototropin 1                                           120   2e-30   Glandularia flava
gb|ACD75541.1|  phototropin 1                                           120   2e-30   Verbena bracteata [creeping vervain]
gb|ACD75547.1|  phototropin 1                                           121   2e-30   Verbena bonariensis [purpletop]
gb|ACD75572.1|  phototropin 1                                           121   2e-30   Glandularia parodii
gb|ACD75537.1|  phototropin 1                                           121   2e-30   Verbena urticifolia [bur-vine]
gb|ACD75584.1|  phototropin 1                                           121   2e-30   Mulguraea aspera
gb|ACD75554.1|  phototropin 1                                           120   2e-30   Glandularia bipinnatifida [Dakota mock vervain]
gb|ACD75540.1|  phototropin 1                                           121   2e-30   Verbena lasiostachys
gb|ACD75568.1|  phototropin 1                                           120   3e-30   Glandularia tenera
gb|ACD75577.1|  phototropin 1                                           120   3e-30   Mulguraea scoparia
gb|ACD75549.1|  phototropin 1                                           120   4e-30   Verbena rigida [veined verbena]
ref|XP_001766409.1|  PHOTB1 phototropin B1 blue light photoreceptor     129   5e-30   
ref|XP_010260111.1|  PREDICTED: phototropin-1                           128   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006828236.1|  hypothetical protein AMTR_s00023p00186390          128   6e-30   
gb|AHZ63878.1|  phototropin                                             128   7e-30   Selaginella kraussiana
gb|AAA50304.1|  protein kinase                                          125   8e-30   Pisum sativum [garden pea]
emb|CBI16229.3|  unnamed protein product                                128   8e-30   Vitis vinifera
gb|KHN05698.1|  Phototropin-1                                           127   8e-30   Glycine soja [wild soybean]
ref|XP_002281752.1|  PREDICTED: phototropin-1                           128   9e-30   Vitis vinifera
gb|ACD75558.1|  phototropin 1                                           119   9e-30   Glandularia gooddingii var. gooddingii
gb|ACD75548.1|  phototropin 1                                           119   1e-29   Verbena rigida [veined verbena]
gb|ACD75580.1|  phototropin 1                                           119   1e-29   Mulguraea asparagoides
gb|ACD75553.1|  phototropin 1                                           119   1e-29   Glandularia bipinnatifida [Dakota mock vervain]
gb|AHZ63860.1|  phototropin                                             127   2e-29   Welwitschia mirabilis
ref|XP_003539746.1|  PREDICTED: phototropin-1-like isoform X1           127   2e-29   Glycine max [soybeans]
ref|XP_001785726.1|  PHOTB2 phototropin B2 blue light photoreceptor     127   2e-29   
ref|XP_007132143.1|  hypothetical protein PHAVU_011G070300g             127   2e-29   Phaseolus vulgaris [French bean]
gb|ACD75570.1|  phototropin 1                                           118   2e-29   Glandularia microphylla
ref|XP_007132147.1|  hypothetical protein PHAVU_011G070300g             127   2e-29   Phaseolus vulgaris [French bean]
gb|KDO73051.1|  hypothetical protein CISIN_1g001847mg                   126   2e-29   Citrus sinensis [apfelsine]
ref|XP_007132144.1|  hypothetical protein PHAVU_011G070300g             126   2e-29   Phaseolus vulgaris [French bean]
ref|XP_003606545.1|  Phototropin                                        126   2e-29   
gb|AES88742.2|  nonphototropic hypocotyl protein                        126   3e-29   Medicago truncatula
gb|KDO73049.1|  hypothetical protein CISIN_1g001847mg                   126   3e-29   Citrus sinensis [apfelsine]
gb|KDO73050.1|  hypothetical protein CISIN_1g001847mg                   126   3e-29   Citrus sinensis [apfelsine]
gb|AHZ63852.1|  phototropin                                             126   3e-29   Stangeria eriopus
emb|CDP08961.1|  unnamed protein product                                126   3e-29   Coffea canephora [robusta coffee]
gb|KDO73045.1|  hypothetical protein CISIN_1g001847mg                   126   3e-29   Citrus sinensis [apfelsine]
gb|ACD75561.1|  phototropin 1                                           118   4e-29   Glandularia aurantiaca
gb|AHZ63875.1|  phototropin                                             126   4e-29   Pseudolycopodiella caroliniana
gb|KDO73046.1|  hypothetical protein CISIN_1g001847mg                   126   4e-29   Citrus sinensis [apfelsine]
ref|XP_006488214.1|  PREDICTED: phototropin-1-like                      126   4e-29   Citrus sinensis [apfelsine]
ref|XP_006424699.1|  hypothetical protein CICLE_v10027740mg             126   4e-29   Citrus clementina [clementine]
gb|KDO73043.1|  hypothetical protein CISIN_1g001847mg                   126   4e-29   Citrus sinensis [apfelsine]
gb|KDO73048.1|  hypothetical protein CISIN_1g001847mg                   126   4e-29   Citrus sinensis [apfelsine]
gb|AHZ63849.1|  phototropin                                             126   5e-29   Podocarpus rubens
gb|ACD75569.1|  phototropin 1                                           117   6e-29   Glandularia tenera
gb|AHZ63887.1|  phototropin                                             125   6e-29   Sphaerocarpos texanus
gb|ACD75533.1|  phototropin 1                                           116   7e-29   Verbena hastata [American blue vervain]
gb|AHZ63873.1|  phototropin                                             125   8e-29   Osmunda regalis [royal fern]
ref|XP_004148228.1|  PREDICTED: phototropin-1-like                      125   8e-29   
ref|XP_004167957.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-...    124   8e-29   
gb|EYU36229.1|  hypothetical protein MIMGU_mgv1a0015913mg               121   9e-29   Erythranthe guttata [common monkey flower]
ref|XP_007016616.1|  Phototropin 1 isoform 2                            124   9e-29   
ref|XP_011005564.1|  PREDICTED: phototropin-1                           125   1e-28   Populus euphratica
ref|XP_008463863.1|  PREDICTED: phototropin-1                           125   1e-28   Cucumis melo [Oriental melon]
ref|XP_001774614.1|  PHOTA2 phototropin A2 blue light photoreceptor     125   1e-28   
gb|KGN47332.1|  hypothetical protein Csa_6G301020                       125   1e-28   Cucumis sativus [cucumbers]
ref|XP_007016620.1|  Phototropin 1 isoform 6                            124   1e-28   
gb|AHZ63895.1|  phototropin                                             125   1e-28   Anomodon rostratus
ref|XP_007016621.1|  Phototropin 1 isoform 7                            124   1e-28   
ref|NP_001234214.1|  phototropin-1                                      124   1e-28   
ref|XP_007016617.1|  Phototropin 1 isoform 3                            124   1e-28   
ref|XP_007016615.1|  Phototropin 1 isoform 1                            124   2e-28   
ref|XP_006365149.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-...    124   2e-28   
ref|XP_007016618.1|  Phototropin 1 isoform 4                            124   2e-28   
ref|XP_008349724.1|  PREDICTED: phototropin-1-like                      123   2e-28   
gb|AHZ63879.1|  phototropin                                             124   2e-28   Isoetes tegetiformans [Merlin's grass]
gb|AHZ63870.1|  phototropin                                             124   2e-28   Cystopteris reevesiana
gb|AHZ63889.1|  phototropin                                             124   2e-28   Scouleria aquatica
gb|AHZ63882.1|  phototropin                                             124   2e-28   Schistochila sp. LGOW
gb|AHZ63891.1|  phototropin                                             123   3e-28   Timmia austriaca
gb|AHZ63896.1|  phototropin                                             124   3e-28   Bryum argenteum
ref|XP_002298559.1|  kinase family protein                              123   3e-28   
gb|AHZ63892.1|  phototropin                                             121   3e-28   Polytrichum commune
ref|XP_004505926.1|  PREDICTED: phototropin-1-like isoform X1           123   3e-28   Cicer arietinum [garbanzo]
ref|XP_007208378.1|  hypothetical protein PRUPE_ppa000777mg             123   3e-28   Prunus persica
ref|XP_008359104.1|  PREDICTED: phototropin-1-like                      123   3e-28   
gb|AHZ63897.1|  phototropin                                             123   4e-28   Scouleria aquatica
gb|AHZ63872.1|  phototropin                                             123   4e-28   Pilularia globulifera
gb|KDP44148.1|  hypothetical protein JCGZ_05615                         123   4e-28   Jatropha curcas
ref|XP_002531832.1|  serine/threonine protein kinase, putative          123   4e-28   
ref|XP_001774256.1|  PHOTA1 phototropin A1 blue light photoreceptor     123   5e-28   
gb|KJB20227.1|  hypothetical protein B456_003G139300                    121   6e-28   Gossypium raimondii
ref|XP_009804992.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-1      122   7e-28   Nicotiana sylvestris
ref|XP_009409004.1|  PREDICTED: phototropin-1A-like isoform X2          122   8e-28   
gb|KJB20230.1|  hypothetical protein B456_003G139300                    122   1e-27   Gossypium raimondii
gb|AHZ63871.1|  phototropin                                             122   1e-27   Pteridium aquilinum [bracken]
gb|KJB20231.1|  hypothetical protein B456_003G139300                    121   1e-27   Gossypium raimondii
ref|XP_009409003.1|  PREDICTED: phototropin-1A-like isoform X1          122   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC23098.1|  phototropin                                            122   1e-27   Vicia faba [broad bean]
ref|XP_010685874.1|  PREDICTED: phototropin-1                           121   1e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008222543.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-1      121   1e-27   
gb|KJB20226.1|  hypothetical protein B456_003G139300                    121   1e-27   Gossypium raimondii
ref|XP_011089848.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-1      121   1e-27   
gb|KJB20229.1|  hypothetical protein B456_003G139300                    121   1e-27   Gossypium raimondii
ref|XP_009397489.1|  PREDICTED: phototropin-1A-like                     121   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHZ63874.1|  phototropin                                             121   2e-27   Lycopodium deuterodensum
ref|XP_009619168.1|  PREDICTED: LOW QUALITY PROTEIN: phototropin-1      121   2e-27   
ref|XP_010535562.1|  PREDICTED: phototropin-1                           121   2e-27   Tarenaya hassleriana [spider flower]
gb|KCW52761.1|  hypothetical protein EUGRSUZ_J02109                     120   2e-27   Eucalyptus grandis [rose gum]
gb|ACQ42250.1|  blue light photoreceptor                                119   2e-27   Fragaria x ananassa
gb|KHN30224.1|  Phototropin-1                                           120   3e-27   Glycine soja [wild soybean]
dbj|BAD89967.1|  phototropin                                            120   3e-27   Phaseolus vulgaris [French bean]
ref|XP_010922474.1|  PREDICTED: phototropin-1A isoform X4               120   3e-27   Elaeis guineensis
ref|XP_010922473.1|  PREDICTED: phototropin-1A isoform X3               120   3e-27   Elaeis guineensis
ref|XP_010922471.1|  PREDICTED: phototropin-1A isoform X1               120   3e-27   
emb|CDX77857.1|  BnaC03g53620D                                          119   3e-27   
ref|XP_003543487.1|  PREDICTED: phototropin-1-like                      120   4e-27   
ref|XP_009354522.1|  PREDICTED: phototropin-1 isoform X1                120   4e-27   
emb|CDY30927.1|  BnaA06g19860D                                          120   4e-27   
gb|KCW52763.1|  hypothetical protein EUGRSUZ_J02109                     120   4e-27   
gb|KCW52762.1|  hypothetical protein EUGRSUZ_J02109                     120   5e-27   
gb|AHZ63880.1|  phototropin                                             120   5e-27   
gb|AHZ63884.1|  phototropin                                             120   5e-27   
ref|XP_009354523.1|  PREDICTED: phototropin-1 isoform X2                120   5e-27   
ref|XP_004294642.2|  PREDICTED: phototropin-1 isoform X1                120   6e-27   
gb|KDO73044.1|  hypothetical protein CISIN_1g001847mg                   120   6e-27   
ref|XP_010033193.1|  PREDICTED: phototropin-1 isoform X3                119   6e-27   
ref|XP_010033189.1|  PREDICTED: phototropin-1 isoform X1                119   6e-27   
ref|XP_011461303.1|  PREDICTED: phototropin-1 isoform X2                119   6e-27   
ref|XP_010033192.1|  PREDICTED: phototropin-1 isoform X2                119   6e-27   
dbj|BAM36551.1|  phototropin 1                                          119   6e-27   
gb|AHZ63881.1|  phototropin                                             119   7e-27   
gb|AHZ63876.1|  phototropin                                             119   8e-27   
gb|KHN33432.1|  Phototropin-1                                           119   8e-27   
ref|XP_006419005.1|  hypothetical protein EUTSA_v10002386mg             119   8e-27   
ref|XP_010922475.1|  PREDICTED: phototropin-1A isoform X5               119   9e-27   
ref|XP_010922472.1|  PREDICTED: phototropin-1A isoform X2               119   1e-26   
gb|AHZ63868.1|  phototropin                                             119   1e-26   
ref|XP_006419006.1|  hypothetical protein EUTSA_v10002386mg             119   1e-26   
ref|XP_009150256.1|  PREDICTED: phototropin-1                           119   1e-26   
gb|AHZ63933.1|  phototropin                                             119   1e-26   
gb|AHZ63936.1|  phototropin                                             117   2e-26   
ref|XP_002875749.1|  hypothetical protein ARALYDRAFT_484960             118   2e-26   
gb|KEH39402.1|  phototropin-2 protein                                   117   2e-26   
gb|AHZ63869.1|  phototropin                                             118   2e-26   
gb|AHZ63894.1|  phototropin                                             117   2e-26   
ref|XP_008783644.1|  PREDICTED: phototropin-1A isoform X2               118   2e-26   
ref|XP_008783643.1|  PREDICTED: phototropin-1A isoform X1               118   2e-26   
gb|AHX73746.1|  phototropin                                             118   2e-26   
dbj|BAD94575.1|  nonphototropic hypocotyl 1                             117   3e-26   
gb|AHZ63883.1|  phototropin                                             117   3e-26   
dbj|BAP74417.1|  phototropin 1                                          117   3e-26   
dbj|BAH19411.1|  AT3G45780                                              117   3e-26   
gb|KEH39401.1|  phototropin-2 protein                                   117   3e-26   
ref|XP_003597291.1|  Phototropin                                        117   3e-26   
gb|AES67542.2|  phototropin-2 protein                                   117   4e-26   
gb|AHZ63890.1|  phototropin                                             117   4e-26   
ref|NP_190164.1|  phototropin 1                                         117   5e-26   
gb|AHZ63934.1|  phototropin                                             116   9e-26   
ref|XP_004487056.1|  PREDICTED: phototropin-1-like isoform X2           115   1e-25   
gb|KFK33944.1|  hypothetical protein AALP_AA5G081900                    115   1e-25   
ref|XP_010426006.1|  PREDICTED: phototropin-1                           115   1e-25   
ref|XP_004487055.1|  PREDICTED: phototropin-1-like isoform X1           115   2e-25   
ref|XP_008462011.1|  PREDICTED: phototropin-2-like isoform X1           115   2e-25   
dbj|BAD16729.1|  phototropin 2                                          115   2e-25   
ref|XP_008462012.1|  PREDICTED: phototropin-2-like isoform X2           115   2e-25   
ref|XP_010514900.1|  PREDICTED: phototropin-1-like                      115   2e-25   
ref|XP_006292321.1|  hypothetical protein CARUB_v10018535mg             115   2e-25   
gb|AHZ63935.1|  phototropin                                             114   4e-25   
gb|AHZ63854.1|  phototropin                                             114   5e-25   
gb|AAM15725.1|  phototropin 1                                           114   5e-25   
gb|AAB41023.2|  phototropin-like protein PsPK4                          114   6e-25   
ref|XP_004144626.1|  PREDICTED: phototropin-2-like                      113   1e-24   
gb|KGN43384.1|  hypothetical protein Csa_7G029980                       113   1e-24   
ref|XP_004169973.1|  PREDICTED: phototropin-2-like                      113   1e-24   
ref|XP_010503189.1|  PREDICTED: phototropin-1-like                      113   1e-24   
gb|AHZ63853.1|  phototropin                                             112   2e-24   
gb|AHZ63932.1|  phototropin                                             112   3e-24   
emb|CAA82994.1|  protein kinase                                         110   4e-24   
dbj|BAC23099.1|  phototropin                                            111   5e-24   
ref|XP_001763104.1|  PHOTA4 phototropin blue light photoreceptor        110   5e-24   
gb|AHZ63888.1|  phototropin                                             111   5e-24   
dbj|BAA95669.1|  phototropin                                            110   1e-23   
gb|AHZ63867.1|  phototropin                                             109   2e-23   
gb|AHZ63862.1|  phototropin                                             107   4e-23   
gb|AAC05083.1|  NPH1-1                                                  108   5e-23   
dbj|BAJ86753.1|  predicted protein                                      108   5e-23   
gb|AAC05084.1|  NPH1-2                                                  108   6e-23   
gb|EMS47081.1|  Phototropin-1A                                          107   6e-23   
ref|XP_010238839.1|  PREDICTED: phototropin-1A isoform X1               107   1e-22   
ref|XP_003579067.1|  PREDICTED: phototropin-1A isoform X2               107   1e-22   
ref|XP_002441654.1|  hypothetical protein SORBIDRAFT_08g000260          105   3e-22   
ref|XP_001765408.1|  PHOTA3 phototropin photoreceptor                   105   3e-22   
ref|XP_004977654.1|  PREDICTED: phototropin-1A-like isoform X2          105   4e-22   
ref|XP_004977653.1|  PREDICTED: phototropin-1A-like isoform X1          105   5e-22   
gb|AHZ63863.1|  phototropin                                             105   5e-22   
ref|XP_004978416.1|  PREDICTED: phototropin-1A-like                     105   5e-22   
gb|EMT10775.1|  Phototropin-1                                           104   8e-22   
gb|AHZ63877.1|  phototropin                                             104   1e-21   
gb|ABG21841.1|  Nonphototropic hypocotyl protein 1, putative, exp...    103   1e-21   
gb|AHZ63866.1|  phototropin                                             103   2e-21   
emb|CAB65325.1|  non-phototropic hypocotyl NPH1                         103   2e-21   
gb|ABG21842.1|  Nonphototropic hypocotyl protein 1, putative, exp...    103   2e-21   
dbj|BAA84780.1|  nonphototrophic hypocotyl 1a                           103   2e-21   
ref|NP_001065232.1|  Os12g0101800                                       103   2e-21   
ref|XP_006664257.1|  PREDICTED: phototropin-1A-like                     101   3e-21   
tpg|DAA59128.1|  TPA: blue-light receptor phototropin 1                 102   3e-21   
ref|NP_001104886.1|  blue-light receptor phototropin 1                  102   4e-21   
gb|AHZ63864.1|  phototropin                                             101   6e-21   
gb|EAZ17133.1|  hypothetical protein OsJ_32634                          102   7e-21   
gb|ABG22325.1|  Nonphototropic hypocotyl protein 1, putative, exp...    102   7e-21   
gb|AHZ63865.1|  phototropin                                             102   7e-21   
gb|EEC68662.1|  hypothetical protein OsI_37109                          102   7e-21   
ref|NP_001065225.1|  Os11g0102200                                       102   7e-21   
ref|XP_002982959.1|  hypothetical protein SELMODRAFT_10296              100   2e-20   
gb|AHZ63904.1|  phototropin                                             100   3e-20   
ref|XP_002965484.1|  hypothetical protein SELMODRAFT_230655             100   3e-20   
ref|XP_002864550.1|  hypothetical protein ARALYDRAFT_495918           99.4    6e-20   
gb|AAM13140.1|  unknown protein                                       98.2    6e-20   
gb|AHZ63918.1|  phototropin                                           98.6    8e-20   
gb|AHZ63919.1|  phototropin                                           94.7    2e-18   
dbj|BAE20161.1|  phototropin                                          94.0    3e-18   
gb|AHZ63911.1|  phototropin                                           92.8    8e-18   
gb|AHZ63893.1|  phototropin                                           90.9    4e-17   
gb|AHZ63921.1|  phototropin                                           89.7    9e-17   
ref|XP_001755321.1|  PHOTB3 phototropin blue light photoreceptor      88.2    2e-16   
gb|AHZ63920.1|  phototropin                                           88.2    3e-16   
gb|AHZ63903.1|  phototropin                                           88.2    3e-16   
gb|AHZ63910.1|  phototropin                                           87.0    7e-16   
gb|AHZ63917.1|  phototropin                                           86.7    8e-16   
ref|XP_007150257.1|  hypothetical protein PHAVU_005G138900g           84.7    5e-15   
gb|AHZ63915.1|  phototropin                                           84.3    5e-15   
gb|AHZ63916.1|  phototropin                                           84.3    6e-15   
gb|AHZ63801.1|  neochrome                                             84.3    6e-15   
gb|AHZ63913.1|  phototropin                                           84.0    7e-15   
gb|AHZ63914.1|  phototropin                                           83.2    1e-14   
gb|ABR23225.1|  hisactophilin C49S mutant/phototropin PHY3 fusion...  80.1    1e-14   
gb|AHZ63805.1|  neochrome                                             82.8    2e-14   
gb|AHX73745.1|  neochrome                                             82.8    2e-14   
gb|AHZ63802.1|  neochrome                                             81.6    5e-14   
dbj|BAC55265.1|  phytochrome 3                                        80.9    7e-14   
gb|KHG02092.1|  Phototropin-1 -like protein                           80.1    7e-14   
gb|AHZ63816.1|  neochrome                                             80.9    8e-14   
gb|AHZ63818.1|  neochrome                                             80.9    8e-14   
gb|ACY92450.1|  neochrome                                             80.9    9e-14   
gb|AHZ63803.1|  neochrome                                             80.9    9e-14   
gb|ACY92439.1|  neochrome                                             80.9    9e-14   
gb|ACY92435.1|  neochrome                                             79.7    2e-13   
gb|AHZ63819.1|  neochrome                                             79.7    2e-13   
gb|AHZ63828.1|  neochrome 1                                           79.3    2e-13   
gb|ACY92442.1|  neochrome                                             79.3    3e-13   
gb|ACT35018.1|  phytochrome 3                                         79.3    3e-13   
gb|AHZ63835.1|  neochrome                                             78.6    3e-13   
gb|ACY92444.1|  neochrome                                             79.0    3e-13   
gb|ACY92436.1|  neochrome                                             78.6    4e-13   
gb|ACT35017.1|  phytochrome 3                                         78.6    5e-13   
gb|ACY92437.1|  neochrome                                             78.6    5e-13   
dbj|BAA36192.2|  PHY3                                                 78.6    5e-13   
gb|ACY92438.1|  neochrome                                             78.6    5e-13   
gb|AHZ63838.1|  neochrome                                             78.2    6e-13   
gb|AHZ63806.1|  neochrome                                             78.2    6e-13   
gb|AHZ63829.1|  neochrome 1                                           77.8    7e-13   
gb|AHZ63808.1|  neochrome                                             78.2    7e-13   
gb|ACY92449.1|  neochrome                                             77.8    8e-13   
dbj|BAE20160.1|  phototropin                                          77.4    9e-13   
gb|ACY92441.1|  neochrome                                             77.8    9e-13   
gb|AHZ63812.1|  neochrome                                             77.4    1e-12   
gb|ACY92440.1|  neochrome                                             76.6    2e-12   
gb|AHZ63813.1|  neochrome                                             76.6    2e-12   
gb|AHZ63817.1|  neochrome                                             76.6    2e-12   
gb|AHZ63822.1|  neochrome                                             76.6    2e-12   
gb|ACT35019.1|  phytochrome 3                                         76.6    2e-12   
gb|AHZ63815.1|  neochrome                                             76.3    2e-12   
gb|AHZ63824.1|  neochrome                                             76.3    2e-12   
gb|AHZ63826.1|  neochrome                                             76.3    2e-12   
gb|AHZ63834.1|  neochrome 2                                           75.9    2e-12   
gb|ACY92448.1|  neochrome                                             76.3    2e-12   
gb|ACY92445.1|  neochrome                                             76.3    3e-12   
gb|AHZ63922.1|  phototropin                                           75.9    3e-12   
gb|AHZ63814.1|  neochrome 2                                           76.3    3e-12   
gb|AHZ63907.1|  phototropin                                           75.9    3e-12   
gb|AHZ63811.1|  neochrome                                             76.3    3e-12   
gb|AHZ63820.1|  neochrome                                             75.9    3e-12   
gb|AHZ63810.1|  neochrome                                             75.9    3e-12   
gb|ACY92446.1|  neochrome                                             75.9    3e-12   
gb|AHZ63912.1|  phototropin                                           73.9    1e-11   
pdb|4HHD|A  Chain A, 2.75 Angstrom Resolution Crystal Structure O...  70.1    1e-11   
gb|AHZ63825.1|  neochrome                                             73.9    2e-11   
gb|ACY92443.1|  neochrome                                             73.6    2e-11   
gb|ACO52468.1|  neochrome                                             73.2    2e-11   
dbj|BAC55267.1|  phytochrome 3                                        72.4    3e-11   
gb|ACY92447.1|  neochrome                                             72.8    3e-11   
gb|AHZ63832.1|  neochrome                                             72.0    5e-11   
gb|AHZ63799.1|  neochrome                                             71.6    8e-11   
gb|AHZ63807.1|  neochrome                                             71.2    9e-11   
gb|AHZ63823.1|  neochrome                                             71.2    1e-10   
gb|AHZ63821.1|  neochrome                                             70.5    2e-10   
gb|AHZ63905.1|  phototropin                                           68.6    6e-10   
gb|AHZ63837.1|  neochrome                                             68.2    7e-10   
dbj|BAC55266.1|  phytochrome 3                                        68.2    7e-10   
gb|AHZ63836.1|  neochrome                                             68.2    8e-10   
gb|AHZ63906.1|  phototropin                                           68.2    9e-10   
gb|AHZ63809.1|  neochrome                                             67.4    2e-09   
gb|AHZ63798.1|  neochrome                                             65.9    6e-09   
gb|AHZ63831.1|  neochrome                                             65.5    6e-09   
gb|AHZ63800.1|  neochrome                                             65.5    6e-09   
gb|AHZ63846.1|  neochrome                                             65.5    7e-09   
gb|EEC76993.1|  hypothetical protein OsI_15306                        64.7    1e-08   
gb|AHZ63830.1|  neochrome                                             63.9    2e-08   
gb|AHZ63847.1|  neochrome-like protein                                61.6    1e-07   
gb|AGJ83747.1|  phototropin-2-like protein                            60.1    3e-07   
pdb|2V1A|A  Chain A, N- And C-Terminal Helices Of Oat Lov2 (404-5...  56.2    7e-07   
pdb|2V0U|A  Chain A, N- And C-terminal Helices Of Oat Lov2 (404-5...  56.2    8e-07   
pdb|2WKR|A  Chain A, Structure Of A Photoactivatable Rac1 Contain...  57.0    3e-06   
pdb|2WKQ|A  Chain A, Structure Of A Photoactivatable Rac1 Contain...  57.0    3e-06   
pdb|2WKP|A  Chain A, Structure Of A Photoactivatable Rac1 Contain...  57.0    3e-06   
gb|AHG24895.1|  aDTX-lumitoxin                                        56.6    5e-06   
gb|AHG24896.1|  CONK1-lumitoxin                                       56.6    5e-06   
gb|AHG24897.1|  DTXK-lumitoxin                                        56.2    5e-06   
gb|AHZ63842.1|  neochrome 1                                           53.1    9e-05   
gb|AHZ63840.1|  neochrome                                             50.1    8e-04   



>gb|ACD75598.1| phototropin 2 [Verbena perennis]
Length=166

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERTEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S++W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSSAWAAIRKI  130



>gb|ACD75649.1| phototropin 2 [Junellia spathulata]
 gb|ACD75650.1| phototropin 2 [Junellia spathulata]
 gb|ACD75651.1| phototropin 2 [Junellia crithmifolia]
Length=166

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERTEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75652.1| phototropin 2 [Junellia crithmifolia]
Length=150

 Score =   150 bits (380),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  29   GELQYFIGVQLDGSDHVEPLRNRLSERTEQQSAKLVKATAENVDEAVRELPDANSRPEDL  88

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  89   WALHSQPVFPRPHKRDSIAWAAIRKI  114



>gb|ACD75593.1| phototropin 2 [Verbena menthifolia]
Length=154

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S++W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSSAWAAIRKI  130



>gb|ACD75642.1| phototropin 2 [Glandularia parodii]
Length=154

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSTAWAAIRKI  130



>gb|ACD75601.1| phototropin 2 [Verbena macdougalii]
Length=162

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S++W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSSAWAAIRKI  130



>gb|ACD75595.1| phototropin 2 [Verbena neomexicana var. hirtella]
 gb|ACD75596.1| phototropin 2 [Verbena neomexicana var. hirtella]
 gb|ACD75597.1| phototropin 2 [Verbena perennis]
Length=166

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S++W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSSAWAAIRKI  130



>gb|ACD75594.1| phototropin 2 [Verbena hastata]
 gb|ACD75599.1| phototropin 2 [Verbena canescens]
Length=164

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S++W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSSAWAAIRKI  130



>gb|ACD75600.1| phototropin 2 [Verbena bracteata]
Length=165

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S++W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSSAWAAIRKI  130



>gb|ACD75603.1| phototropin 2 [Verbena bonariensis]
Length=166

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S++W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSSAWAAIRKI  130



>gb|ACD75645.1| phototropin 2 [Glandularia microphylla]
Length=164

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSTAWAAIRKI  130



>gb|ACD75623.1| phototropin 2 [Glandularia gooddingii var. nepetifolia]
 gb|ACD75628.1| phototropin 2 [Glandularia bipinnatifida]
 gb|ACD75632.1| phototropin 2 [Glandularia bipinnatifida]
 gb|ACD75637.1| phototropin 2 [Glandularia guaranitica]
 gb|ACD75638.1| phototropin 2 [Glandularia guaranitica]
 gb|ACD75639.1| phototropin 2 [Glandularia incisa]
 gb|ACD75640.1| phototropin 2 [Glandularia flava]
 gb|ACD75643.1| phototropin 2 [Glandularia tenera]
 gb|ACD75644.1| phototropin 2 [Glandularia tenera]
Length=166

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSTAWAAIRKI  130



>gb|ACD75614.1| phototropin 2 [Verbena hispida]
Length=152

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  43   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  102

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  103  WALHSQPVFPRPHKRDSIAWAAIRKI  128



>gb|ACD75641.1| phototropin 2 [Glandularia flava]
Length=166

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSTAWAAIRKI  130



>gb|ACD75661.1| phototropin 2 [Aloysia virgata]
Length=161

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANLRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ S +W AI+K+
Sbjct  105  WAIHSQPVFPRPHKRESIAWAAIRKI  130



>gb|ACD75608.1| phototropin 2 [Verbena litoralis]
 gb|ACD75609.1| phototropin 2 [Verbena intermedia]
 gb|ACD75610.1| phototropin 2 [Verbena intermedia]
 gb|ACD75611.1| phototropin 2 [Verbena rigida]
 gb|ACD75612.1| phototropin 2 [Verbena rigida]
 gb|ACD75613.1| phototropin 2 [Verbena rigida]
Length=154

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75629.1| phototropin 2 [Glandularia bipinnatifida]
Length=154

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75647.1| phototropin 2 [Junellia seriphioides]
Length=162

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75586.1| phototropin 2 [Verbena halei]
 gb|ACD75588.1| phototropin 2 [Verbena urticifolia]
 gb|ACD75589.1| phototropin 2 [Verbena officinalis]
 gb|ACD75630.1| phototropin 2 [Glandularia bipinnatifida]
Length=164

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75591.1| phototropin 2 [Verbena orcuttiana]
Length=163

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75587.1| phototropin 2 [Verbena urticifolia]
 gb|ACD75592.1| phototropin 2 [Verbena menthifolia]
 gb|ACD75604.1| phototropin 2 [Verbena montevidensis]
 gb|ACD75607.1| phototropin 2 [Verbena litoralis]
 gb|ACD75619.1| phototropin 2 [Glandularia gooddingii var. gooddingii]
 gb|ACD75620.1| phototropin 2 [Glandularia gooddingii var. gooddingii]
 gb|ACD75621.1| phototropin 2 [Glandularia gooddingii var. gooddingii]
 gb|ACD75622.1| phototropin 2 [Glandularia gooddingii var. gooddingii]
 gb|ACD75624.1| phototropin 2 [Glandularia gooddingii var. nepetifolia]
 gb|ACD75625.1| phototropin 2 [Glandularia gooddingii var. nepetifolia]
 gb|ACD75626.1| phototropin 2 [Glandularia gooddingii var. nepetifolia]
 gb|ACD75627.1| phototropin 2 [Glandularia bipinnatifida]
 gb|ACD75631.1| phototropin 2 [Glandularia bipinnatifida]
 gb|ACD75634.1| phototropin 2 [Glandularia dissecta]
 gb|ACD75635.1| phototropin 2 [Glandularia parodii]
 gb|ACD75646.1| phototropin 2 [Junellia seriphioides]
Length=166

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75590.1| phototropin 2 [Verbena lasiostachys]
Length=165

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75648.1| phototropin 2 [Junellia uniflora]
Length=165

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75605.1| phototropin 2 [Verbena montevidensis]
 gb|ACD75606.1| phototropin 2 [Verbena litoralis]
Length=166

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQKSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75655.1| phototropin 2 [Mulguraea asparagoides]
 gb|ACD75657.1| phototropin 2 [Mulguraea aspera]
 gb|ACD75658.1| phototropin 2 [Mulguraea aspera]
 gb|ACD75659.1| phototropin 2 [Mulguraea aspera var. longidentata]
 gb|ACD75660.1| phototropin 2 [Mulguraea aspera var. longidentata]
Length=166

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ S +W AI+K+
Sbjct  105  WAIHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75615.1| phototropin 2 [Glandularia aristigera]
 gb|ACD75616.1| phototropin 2 [Glandularia aristigera]
 gb|ACD75617.1| phototropin 2 [Glandularia subincana]
 gb|ACD75618.1| phototropin 2 [Glandularia subincana]
Length=166

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+++E++SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERSEEQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75656.1| phototropin 2 [Mulguraea asparagoides]
Length=166

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ S +W AI+K+
Sbjct  105  WAIHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75602.1| phototropin 2 [Verbena bonariensis]
Length=154

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFP+PHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPKPHKRDSIAWAAIRKI  130



>gb|ACD75633.1| phototropin 2 [Glandularia dissecta]
Length=166

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFP+PHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPKPHKRDSIAWAAIRKI  130



>gb|KDO68441.1| hypothetical protein CISIN_1g0427722mg, partial [Citrus sinensis]
Length=323

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+KTEQ+SAK++KATAENV+EAVRELPDAN+ PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSEKTEQQSAKIVKATAENVNEAVRELPDANLRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ ++SW AIQK+
Sbjct  105  WAIHSQPVFPRPHKRDNSSWIAIQKI  130



>gb|ACD75636.1| phototropin 2 [Glandularia aurantiaca]
Length=166

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENV+EAVRELPDAN  PEDL
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVNEAVRELPDANSRPEDL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S +W AI+K+
Sbjct  105  WALHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|ACD75653.1| phototropin 2 [Mulguraea scoparia]
 gb|ACD75654.1| phototropin 2 [Mulguraea scoparia]
Length=163

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAKL+KATAENVDEAVRELPDAN  PE+L
Sbjct  45   GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKLVKATAENVDEAVRELPDANSRPENL  104

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ S +W AI+K+
Sbjct  105  WAIHSQPVFPRPHKRDSIAWAAIRKI  130



>gb|KHN17358.1| Phototropin-2 [Glycine soja]
Length=843

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 85/103 (83%), Gaps = 7/103 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+ TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  411  GELQYFIGVQLDGSDHVEPLKNRLSETTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  470

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQ  90
            WA+HS PVFPRPHKK + SW AIQK       +A    K+G+Q
Sbjct  471  WAIHSQPVFPRPHKKENPSWIAIQK-------VAARGEKIGLQ  506



>ref|XP_003547866.1| PREDICTED: phototropin-2-like [Glycine max]
Length=990

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 85/103 (83%), Gaps = 7/103 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+ TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  558  GELQYFIGVQLDGSDHVEPLKNRLSETTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  617

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQ  90
            WA+HS PVFPRPHKK + SW AIQK       +A    K+G+Q
Sbjct  618  WAIHSQPVFPRPHKKENPSWIAIQK-------VAARGEKIGLQ  653



>ref|XP_003531942.1| PREDICTED: phototropin-2-like isoform X1 [Glycine max]
 ref|XP_006585858.1| PREDICTED: phototropin-2-like isoform X2 [Glycine max]
 ref|XP_006585859.1| PREDICTED: phototropin-2-like isoform X3 [Glycine max]
 gb|KHN45109.1| Phototropin-2 [Glycine soja]
Length=996

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 85/103 (83%), Gaps = 7/103 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+ TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  564  GELQYFIGVQLDGSDHVEPLKNRLSETTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  623

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQ  90
            WA+HS PVFPRPHKK + SW AIQK       +A    K+G+Q
Sbjct  624  WAIHSQPVFPRPHKKDNPSWIAIQK-------VAARDEKIGLQ  659



>ref|XP_010090738.1| hypothetical protein L484_013760 [Morus notabilis]
 gb|EXB40457.1| hypothetical protein L484_013760 [Morus notabilis]
Length=838

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 85/106 (80%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+KTEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  405  GELQYFIGVQLDGSDHVEPLRNRLSEKTEQQSAKLVKATAENVDEAVRELPDANLKPEDL  464

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PV P+PHKK  +SW AIQK       I  +  K+G+   K
Sbjct  465  WAIHSKPVLPKPHKKDCSSWIAIQK-------ITAQGEKIGLHHFK  503



>ref|XP_006384883.1| hypothetical protein POPTR_0004s21940g [Populus trichocarpa]
 gb|ERP62680.1| hypothetical protein POPTR_0004s21940g [Populus trichocarpa]
Length=987

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLSD TE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  567  GELQYFIGVQLDGSDHVEPLQNRLSDATELQSAKLVKATAENVDEAVRELPDANLRPEDL  626

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHKK S SW AIQK+
Sbjct  627  WAIHSQPVFPRPHKKNSRSWTAIQKI  652



>ref|XP_010270626.1| PREDICTED: phototropin-2 [Nelumbo nucifera]
 ref|XP_010270627.1| PREDICTED: phototropin-2 [Nelumbo nucifera]
 ref|XP_010270628.1| PREDICTED: phototropin-2 [Nelumbo nucifera]
Length=949

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+KTE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  519  GELQYFIGVQLDGSDHVEPLRNRLSEKTELQSAKLVKATAENVDEAVRELPDANLRPEDL  578

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHKK S SW AIQK+
Sbjct  579  WAIHSQPVFPRPHKKHSPSWLAIQKI  604



>emb|CAA82993.1| protein kinase [Spinacia oleracea]
Length=724

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +SAK++KATAENVDEAVRELPDAN  PEDL
Sbjct  294  GELQYFIGVQLDGSDHVEPLRNRLSERTEIQSAKVVKATAENVDEAVRELPDANSRPEDL  353

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PV+PRPHK+GS+SW AIQK+
Sbjct  354  WAIHSEPVYPRPHKRGSSSWAAIQKI  379



>ref|XP_006422370.1| hypothetical protein CICLE_v10027745mg [Citrus clementina]
 ref|XP_006422371.1| hypothetical protein CICLE_v10027745mg [Citrus clementina]
 gb|ESR35610.1| hypothetical protein CICLE_v10027745mg [Citrus clementina]
 gb|ESR35611.1| hypothetical protein CICLE_v10027745mg [Citrus clementina]
Length=998

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+KTEQ+SAK++KATAENV+EAVRELPDAN+ PEDL
Sbjct  543  GELQYFIGVQLDGSDHVEPLRNRLSEKTEQQSAKIVKATAENVNEAVRELPDANLRPEDL  602

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ ++SW AIQK+
Sbjct  603  WAIHSQPVFPRPHKRDNSSWIAIQKI  628



>emb|CBI37708.3| unnamed protein product [Vitis vinifera]
Length=979

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  550  GELQYFIGVQLDGSDHLEPLRNRLSEQTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  609

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHKK ++SW AIQK+
Sbjct  610  WAIHSQPVFPKPHKKNNSSWIAIQKI  635



>ref|XP_002280118.1| PREDICTED: phototropin-2 [Vitis vinifera]
 ref|XP_010645493.1| PREDICTED: phototropin-2 [Vitis vinifera]
Length=1001

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  572  GELQYFIGVQLDGSDHLEPLRNRLSEQTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  631

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHKK ++SW AIQK+
Sbjct  632  WAIHSQPVFPKPHKKNNSSWIAIQKI  657



>ref|XP_006422369.1| hypothetical protein CICLE_v10027745mg [Citrus clementina]
 gb|ESR35609.1| hypothetical protein CICLE_v10027745mg [Citrus clementina]
Length=985

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+KTEQ+SAK++KATAENV+EAVRELPDAN+ PEDL
Sbjct  543  GELQYFIGVQLDGSDHVEPLRNRLSEKTEQQSAKIVKATAENVNEAVRELPDANLRPEDL  602

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ ++SW AIQK+
Sbjct  603  WAIHSQPVFPRPHKRDNSSWIAIQKI  628



>ref|XP_006486547.1| PREDICTED: phototropin-2-like isoform X1 [Citrus sinensis]
 ref|XP_006486548.1| PREDICTED: phototropin-2-like isoform X2 [Citrus sinensis]
Length=976

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 81/86 (94%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+KTEQ+SAK++KATAENV+EAVRELPDAN+ PEDL
Sbjct  543  GELQYFIGVQLDGSDHVEPLRNRLSEKTEQQSAKIVKATAENVNEAVRELPDANLRPEDL  602

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ ++SW AIQK+
Sbjct  603  WAIHSQPVFPRPHKRDNSSWIAIQKI  628



>ref|XP_004154580.1| PREDICTED: phototropin-2-like [Cucumis sativus]
Length=629

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            +GELQYFIGVQLDGS HVEPL+NRLS+  E +SAKL+KATAENVDEAVRELPDAN+ PED
Sbjct  488  TGELQYFIGVQLDGSGHVEPLQNRLSETAELQSAKLVKATAENVDEAVRELPDANLRPED  547

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL  141
            LWA+HS PVFPRPHKK S+SW AIQK+
Sbjct  548  LWAIHSQPVFPRPHKKHSSSWTAIQKI  574



>ref|XP_006379377.1| hypothetical protein POPTR_0009s171801g, partial [Populus trichocarpa]
 gb|ERP57174.1| hypothetical protein POPTR_0009s171801g, partial [Populus trichocarpa]
Length=663

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TEQ+SAKL+KATAENVDEAVRELPDAN+  EDL
Sbjct  498  GELQYFIGVQLDGSDHVEPLRNRLSEATEQQSAKLVKATAENVDEAVRELPDANLRTEDL  557

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS  VFPRPHKK S SW AIQK+
Sbjct  558  WAIHSQTVFPRPHKKDSPSWTAIQKI  583



>gb|AFA36479.1| nonphototrophic hypocotyl 1b, partial [Lolium perenne]
Length=175

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  64   GELQYFIGVQLDGSDHVEPLRNRLSETTELQSAKLVKATAGNVDEAVRELPDANLRPEDL  123

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHSL V P+PHK+ ++SW AI+K+
Sbjct  124  WALHSLSVSPKPHKRDNSSWKAIEKI  149



>gb|KCW55711.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
Length=706

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLR+RLS++TEQ+ AKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  273  GELQYFIGVQLDGSDHVEPLRSRLSERTEQQGAKLVKATAENVDEAVRELPDANLRPEDL  332

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ S SW AIQK       I      +G+Q  K
Sbjct  333  WAIHSQPVFPRPHKRYSPSWIAIQK-------ITARGETIGLQHFK  371



>ref|XP_011000842.1| PREDICTED: phototropin-2-like isoform X2 [Populus euphratica]
 ref|XP_011000843.1| PREDICTED: phototropin-2-like isoform X3 [Populus euphratica]
Length=1004

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  569  GELQYFIGVQLDGSDHVEPLRNRLSEATEQQSAKLVKATAENVDEAVRELPDANLGPEDL  628

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS  VFPRPHKK S SW AIQK+
Sbjct  629  WAIHSQTVFPRPHKKDSPSWTAIQKI  654



>ref|XP_011000841.1| PREDICTED: phototropin-2-like isoform X1 [Populus euphratica]
Length=1006

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  571  GELQYFIGVQLDGSDHVEPLRNRLSEATEQQSAKLVKATAENVDEAVRELPDANLGPEDL  630

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS  VFPRPHKK S SW AIQK+
Sbjct  631  WAIHSQTVFPRPHKKDSPSWTAIQKI  656



>ref|XP_008448153.1| PREDICTED: phototropin-2 [Cucumis melo]
Length=938

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 7/107 (7%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            +GELQYFIGVQLDGS HVEPL+NRLS+  E +SAKL+KATAENVDEAVRELPDAN+ PED
Sbjct  486  TGELQYFIGVQLDGSGHVEPLQNRLSETAEMQSAKLVKATAENVDEAVRELPDANLRPED  545

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            LWA+HS PVFPRPHKK S+SW AIQK       I     K+G+Q  K
Sbjct  546  LWAIHSQPVFPRPHKKHSSSWTAIQK-------IIRRGEKIGLQHFK  585



>ref|XP_011040851.1| PREDICTED: phototropin-2-like [Populus euphratica]
 ref|XP_011040852.1| PREDICTED: phototropin-2-like [Populus euphratica]
Length=993

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+ TE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  560  GELQYFIGVQLDGSDHVEPLQNRLSEATELQSAKLVKATAENVDEAVRELPDANLRPEDL  619

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHKK S SW AIQK+
Sbjct  620  WAIHSQPVFPRPHKKNSPSWTAIQKI  645



>ref|XP_009588418.1| PREDICTED: phototropin-2 [Nicotiana tomentosiformis]
 ref|XP_009588419.1| PREDICTED: phototropin-2 [Nicotiana tomentosiformis]
 ref|XP_009588420.1| PREDICTED: phototropin-2 [Nicotiana tomentosiformis]
Length=962

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS++TEQ SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  533  GELQYFIGVQLDGSDHLEPLRNRLSEQTEQSSAKLVKATAENVDEAVRELPDANSKPEDL  592

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PV+PRPHK+ SA W AIQK+
Sbjct  593  WALHSKPVYPRPHKRDSALWTAIQKI  618



>ref|XP_009805047.1| PREDICTED: phototropin-2 [Nicotiana sylvestris]
 ref|XP_009805048.1| PREDICTED: phototropin-2 [Nicotiana sylvestris]
 ref|XP_009805049.1| PREDICTED: phototropin-2 [Nicotiana sylvestris]
Length=962

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS++TEQ SAKL+KATAENVDEAVRELPDAN  PEDL
Sbjct  533  GELQYFIGVQLDGSDHLEPLRNRLSEQTEQSSAKLVKATAENVDEAVRELPDANSKPEDL  592

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PV+PRPHK+ SA W AIQK+
Sbjct  593  WALHSKPVYPRPHKRDSALWTAIQKI  618



>ref|XP_010690596.1| PREDICTED: phototropin-2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690597.1| PREDICTED: phototropin-2 [Beta vulgaris subsp. vulgaris]
Length=905

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ EQ+SAK++KATA NVDEAVRELPDAN+ PEDL
Sbjct  475  GELQYFIGVQLDGSDHVEPLRNRLSERAEQQSAKVVKATAGNVDEAVRELPDANLRPEDL  534

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PV+P PHK+GS+SW AIQK       I     K+G+   K
Sbjct  535  WAIHSNPVYPMPHKRGSSSWAAIQK-------ITASGEKIGLDHFK  573



>gb|KJB79767.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
Length=810

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+ PLR+RLSD TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  517  GELQYFIGVQLDGSDHIVPLRSRLSDNTEQQSAKLIKATAENVDEAVRELPDANLRPEDL  576

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPH++ ++SW AIQK+
Sbjct  577  WAVHSQPVFPRPHRRDTSSWLAIQKI  602



>ref|XP_011091959.1| PREDICTED: phototropin-2 isoform X2 [Sesamum indicum]
Length=950

 Score =   151 bits (381),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  547  GELQYFIGVQLDGSDHVEPLKNRLSERTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  606

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHK+ S +W AI+K+
Sbjct  607  WAIHSQPVFPKPHKRDSTAWAAIRKI  632



>gb|KHG27336.1| Phototropin-2 [Gossypium arboreum]
Length=969

 Score =   151 bits (381),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+ PLR+RLSD TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  536  GELQYFIGVQLDGSDHIVPLRSRLSDNTEQQSAKLIKATAENVDEAVRELPDANLRPEDL  595

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPH++ S+SW AIQK+
Sbjct  596  WAVHSQPVFPRPHRRDSSSWLAIQKI  621



>ref|XP_011091958.1| PREDICTED: phototropin-2 isoform X1 [Sesamum indicum]
Length=977

 Score =   151 bits (381),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  547  GELQYFIGVQLDGSDHVEPLKNRLSERTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  606

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHK+ S +W AI+K+
Sbjct  607  WAIHSQPVFPKPHKRDSTAWAAIRKI  632



>gb|KHG27337.1| Phototropin-2 [Gossypium arboreum]
Length=950

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+ PLR+RLSD TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  517  GELQYFIGVQLDGSDHIVPLRSRLSDNTEQQSAKLIKATAENVDEAVRELPDANLRPEDL  576

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPH++ S+SW AIQK+
Sbjct  577  WAVHSQPVFPRPHRRDSSSWLAIQKI  602



>gb|KCW55712.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
Length=881

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLR+RLS++TEQ+ AKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  532  GELQYFIGVQLDGSDHVEPLRSRLSERTEQQGAKLVKATAENVDEAVRELPDANLRPEDL  591

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ S SW AIQK       I      +G+Q  K
Sbjct  592  WAIHSQPVFPRPHKRYSPSWIAIQK-------ITARGETIGLQHFK  630



>gb|KCW55713.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
Length=889

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLR+RLS++TEQ+ AKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  532  GELQYFIGVQLDGSDHVEPLRSRLSERTEQQGAKLVKATAENVDEAVRELPDANLRPEDL  591

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ S SW AIQK       I      +G+Q  K
Sbjct  592  WAIHSQPVFPRPHKRYSPSWIAIQK-------ITARGETIGLQHFK  630



>gb|KJB47146.1| hypothetical protein B456_008G012600 [Gossypium raimondii]
Length=995

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  562  GELQYFIGVQLDGSGHVEPLQNRLSEQTELQSAKLVKATAENVDEAVRELPDANLRPEDL  621

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S+SW AIQK+
Sbjct  622  WALHSQPVFPRPHKRHSSSWLAIQKI  647



>gb|KHG01262.1| Phototropin-2 -like protein [Gossypium arboreum]
Length=995

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  562  GELQYFIGVQLDGSGHVEPLQNRLSEQTELQSAKLVKATAENVDEAVRELPDANLRPEDL  621

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WALHS PVFPRPHK+ S+SW AIQK+
Sbjct  622  WALHSQPVFPRPHKRHSSSWLAIQKI  647



>ref|XP_007043127.1| Phototropin 2 isoform 2 [Theobroma cacao]
 gb|EOX98958.1| Phototropin 2 isoform 2 [Theobroma cacao]
Length=1009

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL NRLS+KTE +SAKL+KATAENVD+AVRELPDAN+ PEDL
Sbjct  576  GELQYFIGVQLDGSDHVEPLHNRLSEKTELDSAKLVKATAENVDDAVRELPDANLRPEDL  635

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ S+SW AIQK+
Sbjct  636  WAIHSQPVFPRPHKRDSSSWLAIQKI  661



>ref|XP_007043126.1| Phototropin 2 isoform 1 [Theobroma cacao]
 gb|EOX98957.1| Phototropin 2 isoform 1 [Theobroma cacao]
Length=1030

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL NRLS+KTE +SAKL+KATAENVD+AVRELPDAN+ PEDL
Sbjct  597  GELQYFIGVQLDGSDHVEPLHNRLSEKTELDSAKLVKATAENVDDAVRELPDANLRPEDL  656

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPHK+ S+SW AIQK+
Sbjct  657  WAIHSQPVFPRPHKRDSSSWLAIQKI  682



>emb|CDP08542.1| unnamed protein product [Coffea canephora]
Length=916

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TEQ+S+KL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  486  GELQYFIGVQLDGSDHVEPLRNRLSETTEQKSSKLVKATAENVDEAVRELPDANLRPEDL  545

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PV+PRPHKK +A W AIQK+
Sbjct  546  WAVHSQPVYPRPHKKYNAYWEAIQKI  571



>gb|KJB79764.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
Length=770

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+ PLR+RLSD TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  337  GELQYFIGVQLDGSDHIVPLRSRLSDNTEQQSAKLIKATAENVDEAVRELPDANLRPEDL  396

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPH++ ++SW AIQK+
Sbjct  397  WAVHSQPVFPRPHRRDTSSWLAIQKI  422



>ref|XP_010028883.1| PREDICTED: phototropin-2 [Eucalyptus grandis]
 ref|XP_010028884.1| PREDICTED: phototropin-2 [Eucalyptus grandis]
 ref|XP_010028885.1| PREDICTED: phototropin-2 [Eucalyptus grandis]
 ref|XP_010028886.1| PREDICTED: phototropin-2 [Eucalyptus grandis]
 ref|XP_010028887.1| PREDICTED: phototropin-2 [Eucalyptus grandis]
 gb|KCW55706.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
 gb|KCW55707.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
 gb|KCW55708.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
 gb|KCW55709.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
 gb|KCW55710.1| hypothetical protein EUGRSUZ_I01551 [Eucalyptus grandis]
Length=965

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLR+RLS++TEQ+ AKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  532  GELQYFIGVQLDGSDHVEPLRSRLSERTEQQGAKLVKATAENVDEAVRELPDANLRPEDL  591

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ S SW AIQK       I      +G+Q  K
Sbjct  592  WAIHSQPVFPRPHKRYSPSWIAIQK-------ITARGETIGLQHFK  630



>ref|XP_007156298.1| hypothetical protein PHAVU_003G274800g [Phaseolus vulgaris]
 gb|ESW28292.1| hypothetical protein PHAVU_003G274800g [Phaseolus vulgaris]
Length=996

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 7/103 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+ TE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  564  GELQYFIGVQLDGSDHVEPLKNRLSETTEFQSAKLVKATAENVDEAVRELPDANLRPEDL  623

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQ  90
            WA+HS PVFPRPHK+ + SW AIQK       +     K+G+Q
Sbjct  624  WAIHSQPVFPRPHKRDNPSWIAIQK-------VVARGEKIGLQ  659



>dbj|BAD89968.1| phototropin [Phaseolus vulgaris]
Length=996

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 7/103 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+ TE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  564  GELQYFIGVQLDGSDHVEPLKNRLSETTEFQSAKLVKATAENVDEAVRELPDANLRPEDL  623

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQ  90
            WA+HS PVFPRPHK+ + SW AIQK       +     K+G+Q
Sbjct  624  WAIHSQPVFPRPHKRDNPSWIAIQK-------VVARGEKIGLQ  659



>gb|KJB79759.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
 gb|KJB79760.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
 gb|KJB79761.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
 gb|KJB79762.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
 gb|KJB79763.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
 gb|KJB79765.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
 gb|KJB79766.1| hypothetical protein B456_013G065600 [Gossypium raimondii]
Length=950

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+ PLR+RLSD TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  517  GELQYFIGVQLDGSDHIVPLRSRLSDNTEQQSAKLIKATAENVDEAVRELPDANLRPEDL  576

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFPRPH++ ++SW AIQK+
Sbjct  577  WAVHSQPVFPRPHRRDTSSWLAIQKI  602



>gb|AHZ63856.1| phototropin [Podocarpus rubens]
Length=1073

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+HVEPLRNRLS+KTE ESAKL+KATAENVDEAVRELPDANM PEDL
Sbjct  648  GELQYFIGVQLDGSEHVEPLRNRLSEKTELESAKLVKATAENVDEAVRELPDANMRPEDL  707

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS  V P+PHKK ++SW AI+K+
Sbjct  708  WAMHSKMVLPKPHKKSNSSWAAIKKI  733



>ref|XP_004140063.1| PREDICTED: phototropin-2-like [Cucumis sativus]
 gb|KGN46635.1| hypothetical protein Csa_6G116680 [Cucumis sativus]
Length=921

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            +GELQYFIGVQLDGS HVEPL+NRLS+  E +SAKL+KATAENVDEAVRELPDAN+ PED
Sbjct  488  TGELQYFIGVQLDGSGHVEPLQNRLSETAELQSAKLVKATAENVDEAVRELPDANLRPED  547

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL  141
            LWA+HS PVFPRPHKK S+SW AIQK+
Sbjct  548  LWAIHSQPVFPRPHKKHSSSWTAIQKI  574



>ref|XP_006347791.1| PREDICTED: phototropin-2-like isoform X1 [Solanum tuberosum]
 ref|XP_006347792.1| PREDICTED: phototropin-2-like isoform X2 [Solanum tuberosum]
Length=953

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS++TEQ+SAKL+KATA NVDEAVRELPDAN  PEDL
Sbjct  524  GELQYFIGVQLDGSDHMEPLRNRLSEQTEQQSAKLVKATATNVDEAVRELPDANSRPEDL  583

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WALHSLPV+PRPHK+ SA W AI K       +     +LG+   K
Sbjct  584  WALHSLPVYPRPHKRHSALWTAIHK-------VTANGERLGLNNFK  622



>ref|NP_001234289.1| phototropin-2 [Solanum lycopersicum]
 gb|ABS57001.1| phototropin-2 [Solanum lycopersicum]
Length=952

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE++SAKL+KATA NVDEAVRELPDAN  PEDL
Sbjct  523  GELQYFIGVQLDGSDHVEPLRNRLSEQTEKQSAKLVKATATNVDEAVRELPDANSRPEDL  582

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WALHSLPV+PRPHK+ SA W AI K       +     +LG+   K
Sbjct  583  WALHSLPVYPRPHKRHSALWTAIHK-------VTANGERLGLNNFK  621



>gb|ABI48276.1| phototropin-2 [Solanum lycopersicum]
Length=952

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE++SAKL+KATA NVDEAVRELPDAN  PEDL
Sbjct  523  GELQYFIGVQLDGSDHVEPLRNRLSEQTEKQSAKLVKATATNVDEAVRELPDANSRPEDL  582

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WALHSLPV+PRPHK+ SA W AI K       +     +LG+   K
Sbjct  583  WALHSLPVYPRPHKRHSALWTAIHK-------VTANGERLGLNNFK  621



>ref|XP_010323569.1| PREDICTED: phototropin-2 isoform X1 [Solanum lycopersicum]
Length=952

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE++SAKL+KATA NVDEAVRELPDAN  PEDL
Sbjct  523  GELQYFIGVQLDGSDHVEPLRNRLSEQTEKQSAKLVKATATNVDEAVRELPDANSRPEDL  582

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WALHSLPV+PRPHK+ SA W AI K       +     +LG+   K
Sbjct  583  WALHSLPVYPRPHKRHSALWTAIHK-------VTANGERLGLNNFK  621



>ref|XP_008235843.1| PREDICTED: phototropin-2 [Prunus mume]
Length=999

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLSD++E ES+KL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  566  GELQYFIGVQLDGSDHVEPLRNRLSDRSELESSKLVKATAVNVDEAVRELPDANLRPEDL  625

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ + SW AIQ+       I     K+G+   K
Sbjct  626  WAIHSRPVFPRPHKRDTPSWLAIQE-------ITARGEKIGLHHFK  664



>ref|XP_002514387.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF47983.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=984

 Score =   148 bits (374),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  551  GELQYFIGVQLDGSDHVEPLRNRLSEQTELQSAKLVKATAENVDEAVRELPDANLRPEDL  610

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ + SW       IA+  I     K+G+Q  K
Sbjct  611  WAIHSQPVFPRPHKRENPSW-------IAIKEIISSGEKIGLQHFK  649



>ref|XP_004509617.1| PREDICTED: phototropin-2-like isoform X2 [Cicer arietinum]
Length=832

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS+ +E +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  532  GELQYFIGVQLDGSDHLEPLRNRLSEGSEIQSAKLVKATAENVDEAVRELPDANLRPEDL  591

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W+LHS PVFPRPHKK +  W AIQK+
Sbjct  592  WSLHSQPVFPRPHKKDNPCWVAIQKI  617



>emb|CDY58574.1| BnaC03g12530D [Brassica napus]
Length=920

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEP+RNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  471  GELQYFIGVQLDGSDHVEPIRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMTPEDL  530

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA HS PV+P PHKK SASW AIQK
Sbjct  531  WAAHSKPVYPLPHKKESASWKAIQK  555



>ref|XP_010518759.1| PREDICTED: phototropin-2 isoform X3 [Tarenaya hassleriana]
Length=669

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  457  GELQYFIGVQLDGSDHVEPLRNRLSERTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  516

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            W  HS PV P PHK+ + SW AIQK       I     KLG+   K
Sbjct  517  WDAHSKPVHPLPHKRENPSWKAIQK-------IQAAGEKLGLHHFK  555



>ref|XP_010518758.1| PREDICTED: phototropin-2 isoform X2 [Tarenaya hassleriana]
Length=671

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  457  GELQYFIGVQLDGSDHVEPLRNRLSERTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  516

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            W  HS PV P PHK+ + SW AIQK       I     KLG+   K
Sbjct  517  WDAHSKPVHPLPHKRENPSWKAIQK-------IQAAGEKLGLHHFK  555



>ref|XP_004509616.1| PREDICTED: phototropin-2-like isoform X1 [Cicer arietinum]
Length=965

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS+ +E +SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  532  GELQYFIGVQLDGSDHLEPLRNRLSEGSEIQSAKLVKATAENVDEAVRELPDANLRPEDL  591

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W+LHS PVFPRPHKK +  W AIQK+
Sbjct  592  WSLHSQPVFPRPHKKDNPCWVAIQKI  617



>ref|XP_009120327.1| PREDICTED: phototropin-2 [Brassica rapa]
 ref|XP_009120328.1| PREDICTED: phototropin-2 [Brassica rapa]
 ref|XP_009120329.1| PREDICTED: phototropin-2 [Brassica rapa]
 ref|XP_009120330.1| PREDICTED: phototropin-2 [Brassica rapa]
 ref|XP_009120331.1| PREDICTED: phototropin-2 [Brassica rapa]
Length=909

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  476  GELQYFIGVQLDGSDHVEPLRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMRPEDL  535

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PHKK S SW AIQK+
Sbjct  536  WAAHSKPVYPLPHKKESTSWKAIQKI  561



>gb|EPS68603.1| phototropin-2 [Genlisea aurea]
Length=624

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS+++E +SA L+K TAENVDEAVRELPDAN+ PEDL
Sbjct  424  GELQYFIGVQLDGSDHLEPLRNRLSERSEMQSAMLVKETAENVDEAVRELPDANLRPEDL  483

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHK+ +A W AI+K+
Sbjct  484  WAIHSEPVFPKPHKRDTAKWAAIRKI  509



>ref|XP_009132080.1| PREDICTED: phototropin-2-like isoform X2 [Brassica rapa]
Length=895

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEP+RNRLS+ TE +S+KL+KATA NV+EAVRELPDANM PEDL
Sbjct  474  GELQYFIGVQLDGSDHVEPIRNRLSEGTEMQSSKLVKATATNVNEAVRELPDANMTPEDL  533

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PHKK SASW AIQK+
Sbjct  534  WAAHSKPVYPMPHKKESASWKAIQKI  559



>emb|CDX88659.1| BnaA03g09900D [Brassica napus]
Length=924

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEP+RNRLS++TE +S+KL+KATA NV+EAVRELPDANM PEDL
Sbjct  477  GELQYFIGVQLDGSDHVEPIRNRLSERTEMQSSKLVKATATNVNEAVRELPDANMTPEDL  536

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA HS PV+P PHKK SASW AIQK
Sbjct  537  WAAHSKPVYPMPHKKESASWKAIQK  561



>gb|EMT18478.1| Phototropin-2 [Aegilops tauschii]
Length=358

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  77   GELQYFIGVQLDGSDHVEPLRNRLSENTEIQSAKLVKATAGNVDEAVRELPDANLRPEDL  136

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HSL V P+PHK+ ++SW AI+K+
Sbjct  137  WAMHSLSVSPKPHKRNNSSWRAIEKI  162



>emb|CDY43878.1| BnaC09g33650D [Brassica napus]
Length=913

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  475  GELQYFIGVQLDGSDHVEPLRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMRPEDL  534

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA HS PV+P PHKK S SW AIQK
Sbjct  535  WAAHSKPVYPLPHKKESTSWKAIQK  559



>ref|XP_008796425.1| PREDICTED: phototropin-2 [Phoenix dactylifera]
Length=916

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+K E ESAKL+KATAENV+EAVRELPDAN  P+DL
Sbjct  483  GELQYFIGVQLDGSDHVEPLRNRLSEKAELESAKLVKATAENVNEAVRELPDANSSPDDL  542

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHK+ ++SW AI+K+
Sbjct  543  WAIHSRPVFPKPHKRNNSSWIAIEKI  568



>emb|CDY62690.1| BnaA10g29230D [Brassica napus]
Length=914

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  476  GELQYFIGVQLDGSDHVEPLRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMRPEDL  535

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA HS PV+P PHKK S SW AIQK
Sbjct  536  WAAHSKPVYPLPHKKESTSWKAIQK  560



>ref|XP_010927466.1| PREDICTED: phototropin-2-like isoform X3 [Elaeis guineensis]
Length=833

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE ES+KL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  483  GELQYFIGVQLDGSGHVEPLRNRLSETTEIESSKLVKATAENVDEAVRELPDANLRPEDL  542

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVF +PHK+ ++SW AI+K+
Sbjct  543  WAIHSQPVFAKPHKRNNSSWIAIEKI  568



>ref|XP_009132076.1| PREDICTED: phototropin-2-like isoform X1 [Brassica rapa]
 ref|XP_009132077.1| PREDICTED: phototropin-2-like isoform X1 [Brassica rapa]
 ref|XP_009132078.1| PREDICTED: phototropin-2-like isoform X1 [Brassica rapa]
 ref|XP_009132079.1| PREDICTED: phototropin-2-like isoform X1 [Brassica rapa]
Length=912

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEP+RNRLS+ TE +S+KL+KATA NV+EAVRELPDANM PEDL
Sbjct  474  GELQYFIGVQLDGSDHVEPIRNRLSEGTEMQSSKLVKATATNVNEAVRELPDANMTPEDL  533

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PHKK SASW AIQK+
Sbjct  534  WAAHSKPVYPMPHKKESASWKAIQKI  559



>ref|XP_007199701.1| hypothetical protein PRUPE_ppa000797mg [Prunus persica]
 gb|EMJ00900.1| hypothetical protein PRUPE_ppa000797mg [Prunus persica]
Length=1000

 Score =   145 bits (367),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 82/106 (77%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ E ES+KL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  567  GELQYFIGVQLDGSDHVEPLRNRLSERAELESSKLVKATAVNVDEAVRELPDANLRPEDL  626

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ + SW AIQ+       I     K+G+   K
Sbjct  627  WAIHSRPVFPRPHKRDTPSWLAIQE-------ITARGEKIGLHHFK  665



>ref|XP_009358919.1| PREDICTED: phototropin-2 isoform X3 [Pyrus x bretschneideri]
Length=820

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE E +KL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  525  GELQYFIGVQLDGSGHVEPLRNRLSESTELEGSKLVKATAHNVDEAVRELPDANLKPEDL  584

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ + SW AI++       I     K+G+   K
Sbjct  585  WAIHSQPVFPRPHKRENPSWTAIRE-------ITARGEKIGLHHFK  623



>ref|XP_010518754.1| PREDICTED: phototropin-2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010518756.1| PREDICTED: phototropin-2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010518757.1| PREDICTED: phototropin-2 isoform X1 [Tarenaya hassleriana]
Length=892

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TEQ+SAKL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  457  GELQYFIGVQLDGSDHVEPLRNRLSERTEQQSAKLVKATAENVDEAVRELPDANLRPEDL  516

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            W  HS PV P PHK+ + SW AIQK       I     KLG+   K
Sbjct  517  WDAHSKPVHPLPHKRENPSWKAIQK-------IQAAGEKLGLHHFK  555



>ref|XP_010927465.1| PREDICTED: phototropin-2-like isoform X2 [Elaeis guineensis]
Length=869

 Score =   145 bits (365),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE ES+KL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  483  GELQYFIGVQLDGSGHVEPLRNRLSETTEIESSKLVKATAENVDEAVRELPDANLRPEDL  542

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVF +PHK+ ++SW AI+K+
Sbjct  543  WAIHSQPVFAKPHKRNNSSWIAIEKI  568



>ref|XP_009126788.1| PREDICTED: phototropin-2-like isoform X2 [Brassica rapa]
Length=894

 Score =   145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  476  GELQYFIGVQLDGSDHVEPLRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMRPEDL  535

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA +S PV+P PHKK S SW AIQK+
Sbjct  536  WAAYSKPVYPLPHKKESTSWKAIQKI  561



>ref|XP_010927468.1| PREDICTED: phototropin-2-like isoform X4 [Elaeis guineensis]
Length=799

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE ES+KL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  366  GELQYFIGVQLDGSGHVEPLRNRLSETTEIESSKLVKATAENVDEAVRELPDANLRPEDL  425

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVF +PHK+ ++SW AI+K+
Sbjct  426  WAIHSQPVFAKPHKRNNSSWIAIEKI  451



>ref|XP_010927463.1| PREDICTED: phototropin-2-like isoform X1 [Elaeis guineensis]
 ref|XP_010927464.1| PREDICTED: phototropin-2-like isoform X1 [Elaeis guineensis]
Length=916

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE ES+KL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  483  GELQYFIGVQLDGSGHVEPLRNRLSETTEIESSKLVKATAENVDEAVRELPDANLRPEDL  542

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVF +PHK+ ++SW AI+K+
Sbjct  543  WAIHSQPVFAKPHKRNNSSWIAIEKI  568



>ref|XP_006653257.1| PREDICTED: phototropin-2-like [Oryza brachyantha]
Length=785

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVD+AVRELPDAN+ PEDL
Sbjct  357  GELQYFIGVQLDGSDHVEPLRNRLSENTEIQSAKLVKATAENVDDAVRELPDANLRPEDL  416

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA+HS+PV P+PHK+ ++SW AI+K
Sbjct  417  WAIHSMPVSPKPHKRNNSSWIAIEK  441



>ref|XP_009126786.1| PREDICTED: phototropin-2-like isoform X1 [Brassica rapa]
 ref|XP_009126787.1| PREDICTED: phototropin-2-like isoform X1 [Brassica rapa]
Length=911

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  476  GELQYFIGVQLDGSDHVEPLRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMRPEDL  535

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA +S PV+P PHKK S SW AIQK+
Sbjct  536  WAAYSKPVYPLPHKKESTSWKAIQKI  561



>ref|XP_008364373.1| PREDICTED: phototropin-2-like [Malus domestica]
 ref|XP_008364374.1| PREDICTED: phototropin-2-like [Malus domestica]
 ref|XP_008364375.1| PREDICTED: phototropin-2-like [Malus domestica]
Length=958

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE E +KL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  525  GELQYFIGVQLDGSGHVEPLRNRLSETTELEGSKLVKATAHNVDEAVRELPDANLKPEDL  584

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ + SW AI++       I     K+G+   K
Sbjct  585  WAIHSQPVFPRPHKRENPSWTAIRE-------ITARGEKIGLHHFK  623



>ref|XP_009358918.1| PREDICTED: phototropin-2 isoform X2 [Pyrus x bretschneideri]
Length=950

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE E +KL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  517  GELQYFIGVQLDGSGHVEPLRNRLSESTELEGSKLVKATAHNVDEAVRELPDANLKPEDL  576

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ + SW AI++       I     K+G+   K
Sbjct  577  WAIHSQPVFPRPHKRENPSWTAIRE-------ITARGEKIGLHHFK  615



>ref|XP_009358915.1| PREDICTED: phototropin-2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009358916.1| PREDICTED: phototropin-2 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009358917.1| PREDICTED: phototropin-2 isoform X1 [Pyrus x bretschneideri]
Length=958

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE E +KL+KATA NVDEAVRELPDAN+ PEDL
Sbjct  525  GELQYFIGVQLDGSGHVEPLRNRLSESTELEGSKLVKATAHNVDEAVRELPDANLKPEDL  584

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PVFPRPHK+ + SW AI++       I     K+G+   K
Sbjct  585  WAIHSQPVFPRPHKRENPSWTAIRE-------ITARGEKIGLHHFK  623



>emb|CDY32722.1| BnaA02g07840D [Brassica napus]
Length=919

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  477  GELQYFIGVQLDGSDHVEPLRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMRPEDL  536

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA +S PV+P PHKK S SW AIQK
Sbjct  537  WAAYSKPVYPLPHKKESTSWKAIQK  561



>gb|KDP47050.1| hypothetical protein JCGZ_10777 [Jatropha curcas]
Length=906

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 82/106 (77%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS+KTE +SAKL+KATAENVD AVRELPDAN+ PEDL
Sbjct  473  GELQYFIGVQLDGSDHMEPLRNRLSEKTELQSAKLVKATAENVDGAVRELPDANLRPEDL  532

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PV P PHK+ S SW AIQK       I     K+G++  K
Sbjct  533  WAIHSQPVHPLPHKRHSPSWIAIQK-------ITSRGEKIGLEHFK  571



>emb|CDY02797.1| BnaC02g10920D [Brassica napus]
Length=918

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++TE +S+KL+KATA NVDEAVRELPDANM PEDL
Sbjct  472  GELQYFIGVQLDGSDHVEPLRNRLSERTEMQSSKLVKATATNVDEAVRELPDANMRPEDL  531

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA +S PV+P PHKK S SW AIQK
Sbjct  532  WAAYSKPVYPLPHKKESTSWKAIQK  556



>ref|XP_009415438.1| PREDICTED: phototropin-2 [Musa acuminata subsp. malaccensis]
Length=923

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+KTE  SAK++KATAENVDEAVRELPD N+ PE L
Sbjct  490  GELQYFIGVQLDGSDHVEPLRNRLSEKTELHSAKVVKATAENVDEAVRELPDPNLRPEYL  549

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHKK ++SW AI K+
Sbjct  550  WAIHSKPVFPKPHKKNNSSWVAINKI  575



>ref|XP_004290098.1| PREDICTED: phototropin-2 [Fragaria vesca subsp. vesca]
 ref|XP_011458115.1| PREDICTED: phototropin-2 [Fragaria vesca subsp. vesca]
Length=944

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ E ESAK++KATA NV+EAVRELPDAN+ PEDL
Sbjct  511  GELQYFIGVQLDGSDHVEPLRNRLSERAELESAKVVKATAVNVNEAVRELPDANLRPEDL  570

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHK+ SASW A+Q++
Sbjct  571  WAIHSQPVFPKPHKRDSASWLAMQEI  596



>dbj|BAM36550.1| phototropin 2 [Fragaria x ananassa]
Length=944

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS++ E ESAK++KATA NV+EAVRELPDAN+ PEDL
Sbjct  511  GELQYFIGVQLDGSDHVEPLRNRLSERAELESAKVVKATAVNVNEAVRELPDANLRPEDL  570

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PVFP+PHK+ SASW A+Q++
Sbjct  571  WAIHSQPVFPKPHKRDSASWLAMQEI  596



>ref|NP_568874.2| phototropin 2 [Arabidopsis thaliana]
 gb|AED97001.1| phototropin 2 [Arabidopsis thaliana]
Length=689

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  480  GELQYFIGVQLDGSDHVEPLQNRLSERTEMQSSKLVKATATNVDEAVRELPDANTRPEDL  539

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AI+K+
Sbjct  540  WAAHSKPVYPLPHNKESTSWKAIKKI  565



>ref|XP_010483375.1| PREDICTED: phototropin-2 isoform X3 [Camelina sativa]
Length=765

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+KTE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  470  GELQYFIGVQLDGSDHVEPLQNRLSEKTEMQSSKLVKATATNVDEAVRELPDANSRPEDL  529

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AI+K+
Sbjct  530  WAAHSRPVYPLPHNKESTSWKAIKKI  555



>ref|XP_006849852.1| hypothetical protein AMTR_s00022p00051940 [Amborella trichopoda]
 gb|ERN11433.1| hypothetical protein AMTR_s00022p00051940 [Amborella trichopoda]
Length=980

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPL+NRLS+ TE ESAKL+KATAE+VD AVRELPDAN+ PEDL
Sbjct  553  GELQYFIGVQLDGSDHLEPLQNRLSETTELESAKLVKATAESVDGAVRELPDANLRPEDL  612

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS PV P+PHK+ S SW AIQK+
Sbjct  613  WAIHSKPVLPKPHKRNSPSWRAIQKI  638



>ref|XP_006401122.1| hypothetical protein EUTSA_v10012609mg [Eutrema salsugineum]
 ref|XP_006401123.1| hypothetical protein EUTSA_v10012609mg [Eutrema salsugineum]
 ref|XP_006401124.1| hypothetical protein EUTSA_v10012609mg [Eutrema salsugineum]
 gb|ESQ42575.1| hypothetical protein EUTSA_v10012609mg [Eutrema salsugineum]
 gb|ESQ42576.1| hypothetical protein EUTSA_v10012609mg [Eutrema salsugineum]
 gb|ESQ42577.1| hypothetical protein EUTSA_v10012609mg [Eutrema salsugineum]
Length=916

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  481  GELQYFIGVQLDGSDHVEPLQNRLSERTELQSSKLVKATATNVDEAVRELPDANTRPEDL  540

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AIQK+
Sbjct  541  WAAHSKPVYPLPHNKESTSWKAIQKI  566



>ref|NP_001052415.1| Os04g0304200 [Oryza sativa Japonica Group]
 dbj|BAF14329.1| Os04g0304200, partial [Oryza sativa Japonica Group]
Length=771

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVD+AVRELPDAN+ PEDL
Sbjct  343  GELQYFIGVQLDGSDHVEPLRNRLSENTEIQSAKLVKATAENVDDAVRELPDANLRPEDL  402

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA+HS+ V P+PHK+ + SW AI+K
Sbjct  403  WAIHSMRVSPKPHKRNNPSWIAIEK  427



>ref|NP_851212.2| phototropin 2 [Arabidopsis thaliana]
 gb|AED97003.1| phototropin 2 [Arabidopsis thaliana]
Length=898

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  480  GELQYFIGVQLDGSDHVEPLQNRLSERTEMQSSKLVKATATNVDEAVRELPDANTRPEDL  539

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AI+K+
Sbjct  540  WAAHSKPVYPLPHNKESTSWKAIKKI  565



>ref|XP_010483373.1| PREDICTED: phototropin-2 isoform X1 [Camelina sativa]
 ref|XP_010483374.1| PREDICTED: phototropin-2 isoform X2 [Camelina sativa]
Length=905

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+KTE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  470  GELQYFIGVQLDGSDHVEPLQNRLSEKTEMQSSKLVKATATNVDEAVRELPDANSRPEDL  529

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AI+K+
Sbjct  530  WAAHSRPVYPLPHNKESTSWKAIKKI  555



>ref|XP_010453258.1| PREDICTED: phototropin-2-like [Camelina sativa]
 ref|XP_010453266.1| PREDICTED: phototropin-2-like [Camelina sativa]
Length=905

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+KTE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  470  GELQYFIGVQLDGSDHVEPLQNRLSEKTEMQSSKLVKATATNVDEAVRELPDANSRPEDL  529

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AI+K+
Sbjct  530  WAAHSRPVYPLPHNKESTSWKAIKKI  555



>ref|XP_010443529.1| PREDICTED: phototropin-2-like [Camelina sativa]
 ref|XP_010443530.1| PREDICTED: phototropin-2-like [Camelina sativa]
Length=906

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS+KTE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  471  GELQYFIGVQLDGSDHVEPLQNRLSEKTEMQSSKLVKATATNVDEAVRELPDANSRPEDL  530

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AI+K+
Sbjct  531  WAAHSRPVYPLPHNKESTSWKAIKKI  556



>ref|NP_851210.1| phototropin 2 [Arabidopsis thaliana]
 ref|NP_851211.1| phototropin 2 [Arabidopsis thaliana]
 sp|P93025.2|PHOT2_ARATH RecName: Full=Phototropin-2; AltName: Full=Defective in chloroplast 
avoidance protein 1; AltName: Full=Non-phototropic hypocotyl 
1-like protein 1; Short=AtKin7; Short=NPH1-like protein 
1 [Arabidopsis thaliana]
 gb|AAC27293.2| non phototropic hypocotyl 1-like [Arabidopsis thaliana]
 dbj|BAB09904.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97002.1| phototropin 2 [Arabidopsis thaliana]
 gb|AED97004.1| phototropin 2 [Arabidopsis thaliana]
Length=915

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL+NRLS++TE +S+KL+KATA NVDEAVRELPDAN  PEDL
Sbjct  480  GELQYFIGVQLDGSDHVEPLQNRLSERTEMQSSKLVKATATNVDEAVRELPDANTRPEDL  539

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS PV+P PH K S SW AI+K+
Sbjct  540  WAAHSKPVYPLPHNKESTSWKAIKKI  565



>sp|Q9ST27.1|PHOT2_ORYSJ RecName: Full=Phototropin-2; AltName: Full=Non-phototropic hypocotyl 
protein 1B; Short=OsNPH1B [Oryza sativa Japonica Group]
 dbj|BAA84779.1| nonphototrophic hypocotyl 1b [Oryza sativa Japonica Group]
 emb|CAD40495.2| OSJNBa0079M09.13 [Oryza sativa Japonica Group]
 emb|CAH66070.1| OSIGBa0092O07.5 [Oryza sativa Indica Group]
Length=907

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVD+AVRELPDAN+ PEDL
Sbjct  479  GELQYFIGVQLDGSDHVEPLRNRLSENTEIQSAKLVKATAENVDDAVRELPDANLRPEDL  538

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA+HS+ V P+PHK+ + SW AI+K
Sbjct  539  WAIHSMRVSPKPHKRNNPSWIAIEK  563



>gb|EEE60710.1| hypothetical protein OsJ_14207 [Oryza sativa Japonica Group]
Length=888

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVD+AVRELPDAN+ PEDL
Sbjct  460  GELQYFIGVQLDGSDHVEPLRNRLSENTEIQSAKLVKATAENVDDAVRELPDANLRPEDL  519

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA+HS+ V P+PHK+ + SW AI+K
Sbjct  520  WAIHSMRVSPKPHKRNNPSWIAIEK  544



>ref|XP_003581132.1| PREDICTED: phototropin-2 [Brachypodium distachyon]
 ref|XP_010239787.1| PREDICTED: phototropin-2 [Brachypodium distachyon]
 ref|XP_010239788.1| PREDICTED: phototropin-2 [Brachypodium distachyon]
 ref|XP_010239789.1| PREDICTED: phototropin-2 [Brachypodium distachyon]
Length=909

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATA NVD+AVRELPDAN+ PEDL
Sbjct  484  GELQYFIGVQLDGSDHVEPLRNRLSETTEIQSAKLVKATAGNVDDAVRELPDANLRPEDL  543

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HSL V P+PHK+ ++SW AI K+
Sbjct  544  WAIHSLSVSPKPHKRNNSSWKAIAKI  569



>gb|AHZ63858.1| phototropin [Thuja plicata]
Length=1061

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+HVEPLRNRLS+KTE ESAKL+K TA NV EAV+ELPDAN+ PEDL
Sbjct  636  GELQYFIGVQLDGSEHVEPLRNRLSEKTELESAKLVKETAGNVGEAVKELPDANLRPEDL  695

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W +HS  V P+PHKKG +SW AI+K+
Sbjct  696  WVMHSQLVSPKPHKKGGSSWAAIKKI  721



>gb|AHZ63859.1| phototropin [Stangeria eriopus]
Length=1062

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+H+EPL+NRLS+KT+ ES+KL+KATAENVDEAVRELPDAN+ PEDL
Sbjct  626  GELQYFIGVQLDGSEHIEPLQNRLSEKTDLESSKLVKATAENVDEAVRELPDANLKPEDL  685

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W +HS  V P+PH K ++SW AI+K+
Sbjct  686  WKIHSKVVIPKPHMKNNSSWKAIKKI  711



>dbj|BAP74418.1| phototropin 2 [Vallisneria gigantea]
Length=872

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPL NRLSD +E ++AK++KATA+NV+EAVRELPDAN+ PEDL
Sbjct  433  GELQYFIGVQLDGSDHVEPLLNRLSDTSELQNAKMVKATAKNVNEAVRELPDANLRPEDL  492

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W LHS PV PRPHKK ++SW AI ++
Sbjct  493  WILHSQPVLPRPHKKNNSSWRAIHEI  518



>ref|XP_004975243.1| PREDICTED: phototropin-2-like isoform X1 [Setaria italica]
 ref|XP_004975244.1| PREDICTED: phototropin-2-like isoform X2 [Setaria italica]
Length=899

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +S KL+KATAENVDEAVRELPD N+ PEDL
Sbjct  471  GELQYFIGVQLDGSDHVEPLRNRLSENTELQSTKLVKATAENVDEAVRELPDPNVRPEDL  530

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA +S PV P+PHK+ ++SW AIQK+
Sbjct  531  WATYSKPVSPKPHKRYNSSWIAIQKI  556



>gb|AET03431.2| phototropin-2 protein [Medicago truncatula]
Length=935

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS H+EPLRNRLS+ +E +SAKL+KATAENVD AVRELPDAN+ PEDL
Sbjct  502  GELQYFIGVQLDGSDHLEPLRNRLSEGSEIQSAKLVKATAENVDGAVRELPDANLRPEDL  561

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS  V PRPHK+ + SW AIQK+
Sbjct  562  WAIHSQAVSPRPHKRDNPSWVAIQKI  587



>gb|AHZ63855.1| phototropin [Cephalotaxus harringtonia]
Length=1074

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+HVEPL+NRLS KTE ESAKL+KATA NVD+AVRELPDANM PE+L
Sbjct  649  GELQYFIGVQLDGSEHVEPLQNRLSKKTELESAKLVKATAGNVDDAVRELPDANMRPEEL  708

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W +HS  V P+PHKK ++SW AI K+
Sbjct  709  WVMHSKLVLPKPHKKYNSSWAAIAKI  734



>ref|XP_008382524.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-2-like [Malus domestica]
Length=941

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 80/106 (75%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLD S HVEP+ NRLS+ TE ESAKL+KATA NVDEAVRELPDAN+  EDL
Sbjct  536  GELQYFIGVQLDESGHVEPMGNRLSESTEIESAKLVKATAHNVDEAVRELPDANLRXEDL  595

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA+HS PV+PRPHK+ S SW AI++       I     K+G++  K
Sbjct  596  WAIHSQPVWPRPHKRESPSWTAIRE-------ITARGEKIGLRHFK  634



>gb|AHZ63900.1| phototropin, partial [Timmia austriaca]
Length=1165

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            SGELQYFIGVQLDGS+++EP R RLS+KTE+E AK+++ TA N+D AVRELPDANM PED
Sbjct  723  SGELQYFIGVQLDGSEYLEPERRRLSEKTEKEGAKVVQETANNIDGAVRELPDANMKPED  782

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL  141
            LW+ HSLPV+PRPH K S SW AI+K+
Sbjct  783  LWSKHSLPVYPRPHSKDSPSWEAIKKI  809



>ref|XP_003628955.1| Phototropin [Medicago truncatula]
Length=941

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 6/92 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMI----  231
            GELQYFIGVQLDGS H+EPLRNRLS+ +E +SAKL+KATAENVD AVRELPDAN++    
Sbjct  502  GELQYFIGVQLDGSDHLEPLRNRLSEGSEIQSAKLVKATAENVDGAVRELPDANLVRYSF  561

Query  230  --PEDLWALHSLPVFPRPHKKGSASWGAIQKL  141
              PEDLWA+HS  V PRPHK+ + SW AIQK+
Sbjct  562  WRPEDLWAIHSQAVSPRPHKRDNPSWVAIQKI  593



>tpg|DAA49183.1| TPA: putative phototropin family protein kinase [Zea mays]
Length=703

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVDEAVRELPD N+ PEDL
Sbjct  479  GELQYFIGVQLDGSDHVEPLRNRLSENTELQSAKLVKATAENVDEAVRELPDPNLRPEDL  538

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W ++S  V P+PHK+ ++SW A++K+
Sbjct  539  WDIYSRYVSPKPHKRYNSSWIAMEKI  564



>gb|AHZ63848.1| phototropin [Cephalotaxus harringtonia]
Length=1083

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHV+PL N++ +KTEQESA L+K TA NVDEAVRELPDAN+ PEDL
Sbjct  649  GEVQYFIGVQLDGSQHVKPLMNKIPEKTEQESAILVKNTAANVDEAVRELPDANLKPEDL  708

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  VFP+PH K ++SW AIQK+
Sbjct  709  WINHSKEVFPKPHMKSNSSWKAIQKI  734



>gb|AHZ63857.1| phototropin [Cunninghamia lanceolata]
Length=951

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+HVEPL +RLS+KTE ESAKL+K TA NV EAV+ELPDAN+ PEDL
Sbjct  519  GELQYFIGVQLDGSEHVEPLHSRLSEKTELESAKLVKETAGNVGEAVKELPDANLRPEDL  578

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W +HS  V P+PHKK S+SW AI+K+
Sbjct  579  WVMHSQLVLPKPHKKYSSSWAAIKKI  604



>ref|XP_006281965.1| hypothetical protein CARUB_v10028188mg [Capsella rubella]
 gb|EOA14863.1| hypothetical protein CARUB_v10028188mg [Capsella rubella]
Length=586

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 74/97 (76%), Gaps = 11/97 (11%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKL-----------LKATAENVDEAVR  255
            +GELQYFIGVQLDGS HVEPL+NRLS++TE +S+KL           +KATA NVDEAVR
Sbjct  471  AGELQYFIGVQLDGSDHVEPLQNRLSERTEMQSSKLKTLLITSALIQVKATATNVDEAVR  530

Query  254  ELPDANMIPEDLWALHSLPVFPRPHKKGSASWGAIQK  144
            ELPDAN  PEDLWA HS PV+P PH K S SW AI+K
Sbjct  531  ELPDANSRPEDLWAAHSRPVYPLPHNKESTSWKAIKK  567



>gb|EMS49903.1| Phototropin-2 [Triticum urartu]
Length=551

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 15/101 (15%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLL---------------KATAENVDE  264
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+               KATA NVDE
Sbjct  77   GELQYFIGVQLDGSDHVEPLRNRLSENTEIQSAKLVGQLSLSNFPFEDVKVKATAGNVDE  136

Query  263  AVRELPDANMIPEDLWALHSLPVFPRPHKKGSASWGAIQKL  141
            AVRELPDAN+ PEDLWA+HSL V P+PHK+ ++SW AI+K+
Sbjct  137  AVRELPDANLRPEDLWAMHSLSVSPKPHKQNNSSWKAIEKI  177



>gb|AHZ63901.1| phototropin, partial [Polytrichum commune]
Length=594

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+++EP   RLSDKTE+E AK+++ATA+N+D AVRELPDANM PEDL
Sbjct  154  GELQYFIGVQLDGSEYLEPEHRRLSDKTEKEGAKVVQATAKNIDGAVRELPDANMKPEDL  213

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HSLPV P+PH + S+SW AI ++
Sbjct  214  WAKHSLPVHPKPHSRNSSSWRAIMEM  239



>gb|AHZ63899.1| phototropin, partial [Scouleria aquatica]
Length=879

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDG+ ++EP R RLS+KTEQE  K+++ TA+N+D A+RELPDANM PEDL
Sbjct  441  GELQYFIGVQLDGTHYLEPERRRLSEKTEQEGTKVVQGTAKNIDGALRELPDANMKPEDL  500

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W+ HSLPV+PRPH K S SW AI KL
Sbjct  501  WSKHSLPVYPRPHSKNSPSWDAITKL  526



>gb|AHZ63902.1| phototropin [Sphagnum lescurii]
Length=1084

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            +GELQYFIGVQLDGS++VEP R RLS+KTE+E +K+++ATA+++D AVRELPDANM PED
Sbjct  658  NGELQYFIGVQLDGSEYVEPERKRLSEKTEKEGSKVVRATAKDIDGAVRELPDANMKPED  717

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL  141
            LWALHSL +F RPH K S SW A+ K+
Sbjct  718  LWALHSLSIFARPHSKQSKSWAAVNKV  744



>gb|EPS65128.1| phototropin-1, partial [Genlisea aurea]
Length=420

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS HVEPL N + D    ESAK++K TAENVDEAVRELPDANM PEDL
Sbjct  255  GEVQYFIGVQLDGSAHVEPLHNCIPDAKANESAKIVKETAENVDEAVRELPDANMKPEDL  314

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+KGS +W AIQ++
Sbjct  315  WKNHSKVVHPKPHRKGSPAWNAIQQI  340



>ref|XP_002991589.1| hypothetical protein SELMODRAFT_186203 [Selaginella moellendorffii]
 gb|EFJ07343.1| hypothetical protein SELMODRAFT_186203 [Selaginella moellendorffii]
Length=926

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+++EP+R RLS++TEQE AK+++ATA NVDEAVRELPDAN  P+DL
Sbjct  501  GELQYFIGVQLDGSEYIEPIRQRLSERTEQEGAKVVRATAANVDEAVRELPDANQTPDDL  560

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V+P+PHK  S +W AI+K+
Sbjct  561  WAKHSKVVYPKPHKVNSPAWDAIKKI  586



>ref|NP_001147477.1| phototropin-1 [Zea mays]
 gb|ACG27653.1| phototropin-1 [Zea mays]
Length=899

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVDEAVRELPD N+ PEDL
Sbjct  473  GELQYFIGVQLDGSDHVEPLRNRLSENTELQSAKLVKATAENVDEAVRELPDPNLRPEDL  532

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W ++S  V P+PHK+ ++SW A++K+
Sbjct  533  WDIYSRYVSPKPHKRYNSSWIAMEKI  558



>ref|XP_002445377.1| hypothetical protein SORBIDRAFT_07g014860 [Sorghum bicolor]
 gb|EES14872.1| hypothetical protein SORBIDRAFT_07g014860 [Sorghum bicolor]
Length=890

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVDEAVRELPD N+ PEDL
Sbjct  462  GELQYFIGVQLDGSDHVEPLRNRLSENTELQSAKLVKATAENVDEAVRELPDPNLRPEDL  521

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W ++S  V P+PH++ ++SW AI+K+
Sbjct  522  WDIYSKYVSPKPHRRYNSSWIAIEKI  547



>ref|XP_008674095.1| PREDICTED: phototropin-1 isoform X1 [Zea mays]
 ref|XP_008674103.1| PREDICTED: phototropin-1 isoform X1 [Zea mays]
 tpg|DAA49184.1| TPA: putative phototropin family protein kinase [Zea mays]
Length=905

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS HVEPLRNRLS+ TE +SAKL+KATAENVDEAVRELPD N+ PEDL
Sbjct  479  GELQYFIGVQLDGSDHVEPLRNRLSENTELQSAKLVKATAENVDEAVRELPDPNLRPEDL  538

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W ++S  V P+PHK+ ++SW A++K+
Sbjct  539  WDIYSRYVSPKPHKRYNSSWIAMEKI  564



>gb|ACD75534.1| phototropin 1 [Verbena orcuttiana]
Length=155

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V+P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVYPKPHRRDSPSWKAIQQI  131



>gb|ACD75585.1| phototropin 1 [Aloysia virgata]
Length=161

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AKL+K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKLVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKAVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75557.1| phototropin 1 [Glandularia gooddingii var. nepetifolia]
Length=161

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N +   T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPGATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++GS SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRGSPSWKAIQQI  131



>ref|XP_002971709.1| hypothetical protein SELMODRAFT_172224 [Selaginella moellendorffii]
 gb|EFJ27458.1| hypothetical protein SELMODRAFT_172224 [Selaginella moellendorffii]
Length=930

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+++EP+R RLS++TEQE AK+++ATA NVDEAVRELPDAN  P+DL
Sbjct  501  GELQYFIGVQLDGSEYIEPIRQRLSERTEQEGAKVVRATAANVDEAVRELPDANQTPDDL  560

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V+P+PHK  + +W AI+K+
Sbjct  561  WAKHSKVVYPKPHKVNTPAWDAIKKI  586



>gb|ACD75573.1| phototropin 1 [Junellia uniflora]
Length=152

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  43   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  102

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S+SW AIQ++
Sbjct  103  WKNHSKVVHPKPHRRDSSSWKAIQQI  128



>gb|ACD75576.1| phototropin 1 [Junellia crithmifolia]
Length=148

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  33   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  92

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S+SW AIQ++
Sbjct  93   WKNHSKVVHPKPHRRDSSSWKAIQQI  118



>ref|XP_010112314.1| hypothetical protein L484_011180 [Morus notabilis]
 gb|EXC33203.1| hypothetical protein L484_011180 [Morus notabilis]
Length=962

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPLRN + ++T +ES K++K TAENVDEAVRELPDANM PEDL
Sbjct  533  GEVQYFIGVQLDGSQHVEPLRNCIPEQTAKESEKVIKETAENVDEAVRELPDANMKPEDL  592

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S SW AIQK+
Sbjct  593  WMNHSKMVQPKPHRKDSPSWKAIQKI  618



>gb|ACD75536.1| phototropin 1 [Verbena perennis]
Length=150

 Score =   122 bits (306),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QESAK +K TA NVDEAVRELPDAN  PEDL
Sbjct  35   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQESAKFVKETAVNVDEAVRELPDANTKPEDL  94

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  95   WKNHSKVVHPKPHRRDSPSWKAIQQI  120



>gb|AHZ63851.1| phototropin [Thuja plicata]
Length=1079

 Score =   131 bits (329),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHV+PL N++ ++TEQE + L+K TA NVDEAVRELPDANM PEDL
Sbjct  645  GEVQYFIGVQLDGSQHVKPLTNKIPEETEQEGSLLVKTTAANVDEAVRELPDANMKPEDL  704

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  VFP+PH K ++SW AIQK+
Sbjct  705  WINHSKEVFPKPHMKSNSSWKAIQKI  730



>gb|ACD75556.1| phototropin 1 [Glandularia gooddingii var. nepetifolia]
Length=155

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRKDSPSWKAIQQI  131



>gb|ACD75575.1| phototropin 1 [Junellia spathulata]
Length=160

 Score =   122 bits (306),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S+SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSSSWKAIQQI  131



>gb|AHZ63898.1| phototropin, partial [Anomodon rostratus]
Length=1114

 Score =   131 bits (329),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDG+ ++EP R RLS KTE E AK+++ TA+N+D A+RELPDANM P+DL
Sbjct  677  GELQYFIGVQLDGTHYLEPERRRLSQKTESEGAKVVQKTADNIDGALRELPDANMRPQDL  736

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HSLPV+PRPH K S SW A++KL
Sbjct  737  WAKHSLPVYPRPHSKNSPSWDAVRKL  762



>gb|AHZ63886.1| phototropin [Conocephalum conicum]
Length=1105

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+H+EP+R RLS+KTE+E  K+++ATA+NVD AVRELPDANM  EDL
Sbjct  672  GELQYFIGVQLDGSEHIEPIRRRLSEKTEEEGRKIVQATAKNVDGAVRELPDANMSIEDL  731

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  VFPRPHK+ S +W A++K+
Sbjct  732  WANHSRVVFPRPHKRQSPTWNAMRKV  757



>gb|AHZ63850.1| phototropin [Cunninghamia lanceolata]
Length=1079

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHV+PL N++ +KTEQE A ++K TA NV+EAVRELPDANM PEDL
Sbjct  645  GEVQYFIGVQLDGSQHVKPLTNKIPEKTEQEGAIVVKKTATNVNEAVRELPDANMKPEDL  704

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  VFP+PH K ++SW AIQK+
Sbjct  705  WINHSKEVFPKPHMKSNSSWKAIQKI  730



>gb|ACD75545.1| phototropin 1 [Verbena hispida]
Length=158

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  43   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  102

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  103  WKNHSKVVHPKPHRRDSPSWKAIQQI  128



>gb|AHZ63861.1| phototropin [Gnetum montanum]
Length=991

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDG++H++PL +RLS++TE ESAK++K TAENVD A RELPDAN+ PEDL
Sbjct  566  GELQYFIGVQLDGTEHIQPLESRLSERTELESAKIVKETAENVDNAARELPDANLKPEDL  625

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS  V P+PHK+ + SW AI K+
Sbjct  626  WAVHSSIVLPKPHKRNNDSWKAINKI  651



>gb|ACD75574.1| phototropin 1 [Junellia seriphioides]
Length=161

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEP+ N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPIHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S+SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSSSWKAIQQI  131



>gb|AHZ63885.1| phototropin [Marchantia polymorpha]
Length=1119

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+H+EP+R RLS+KTE+E  ++++ATA+NVD AVRELPDANM  EDL
Sbjct  686  GELQYFIGVQLDGSEHIEPIRRRLSEKTEEEGKRIVQATAKNVDGAVRELPDANMSIEDL  745

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  VFPRPHK+ S++W A++K+
Sbjct  746  WANHSRVVFPRPHKRQSSTWHAMRKI  771



>dbj|BAP28445.1| phototropin [Marchantia polymorpha]
 dbj|BAP28446.1| phototropin [Marchantia polymorpha]
Length=1115

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+H+EP+R RLS+KTE+E  ++++ATA+NVD AVRELPDANM  EDL
Sbjct  682  GELQYFIGVQLDGSEHIEPIRRRLSEKTEEEGKRIVQATAKNVDGAVRELPDANMSIEDL  741

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  VFPRPHK+ S++W A++K+
Sbjct  742  WANHSRVVFPRPHKRQSSTWHAMRKI  767



>gb|ACD75552.1| phototropin 1 [Glandularia bipinnatifida]
Length=140

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  31   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  90

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  91   WKNHSKVVHPKPHRRDSPSWKAIQQI  116



>gb|ACD75555.1| phototropin 1 [Glandularia bipinnatifida]
Length=155

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75535.1| phototropin 1 [Verbena canescens]
Length=158

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  43   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  102

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  103  WKNHSKVVHPKPHRRDSPSWKAIQQI  128



>gb|ACD75538.1| phototropin 1 [Verbena macdougalii]
 gb|ACD75539.1| phototropin 1 [Verbena officinalis]
 gb|ACD75581.1| phototropin 1 [Mulguraea aspera var. longidentata]
 gb|ACD75582.1| phototropin 1 [Mulguraea aspera var. longidentata]
Length=148

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  33   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  92

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  93   WKNHSKVVHPKPHRRDSPSWKAIQQI  118



>gb|ACD75542.1| phototropin 1 [Verbena halei]
Length=146

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  31   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  90

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  91   WKNHSKVVHPKPHRRDSPSWKAIQQI  116



>gb|AGU41988.1| phototropin 1, partial [Nicotiana tabacum]
Length=150

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL N + +    ESAKL+K TA NVDEAVRELPDAN  PEDL
Sbjct  8    GEVQYFIGVQLDGSQHVEPLHNSIPEDKATESAKLVKETAGNVDEAVRELPDANSKPEDL  67

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAK  102
            W  HS  V  +PH+K S SW AIQK+  +  PI ++  K
Sbjct  68   WRNHSKVVHAKPHRKDSPSWKAIQKVLDSGEPIGLKHFK  106



>gb|ACD75571.1| phototropin 1 [Glandularia flava]
Length=133

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  24   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  83

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  84   WKNHSKVVHPKPHRRDSPSWKAIQQI  109



>gb|ACD75541.1| phototropin 1 [Verbena bracteata]
Length=149

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  34   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  93

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  94   WKNHSKVVHPKPHRRDSPSWKAIQQI  119



>gb|ACD75547.1| phototropin 1 [Verbena bonariensis]
Length=158

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  43   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  102

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  103  WKNHSKVVHPKPHRRDSPSWKAIQQI  128



>gb|ACD75572.1| phototropin 1 [Glandularia parodii]
Length=155

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75537.1| phototropin 1 [Verbena urticifolia]
 gb|ACD75543.1| phototropin 1 [Verbena menthifolia]
 gb|ACD75544.1| phototropin 1 [Verbena menthifolia]
 gb|ACD75546.1| phototropin 1 [Verbena intermedia]
 gb|ACD75550.1| phototropin 1 [Verbena rigida]
 gb|ACD75551.1| phototropin 1 [Verbena litoralis]
 gb|ACD75559.1| phototropin 1 [Glandularia gooddingii var. gooddingii]
 gb|ACD75560.1| phototropin 1 [Glandularia gooddingii var. gooddingii]
 gb|ACD75562.1| phototropin 1 [Glandularia dissecta]
 gb|ACD75563.1| phototropin 1 [Glandularia guaranitica]
 gb|ACD75564.1| phototropin 1 [Glandularia incisa]
 gb|ACD75565.1| phototropin 1 [Glandularia incisa]
 gb|ACD75566.1| phototropin 1 [Glandularia aristigera]
 gb|ACD75567.1| phototropin 1 [Glandularia aristigera]
 gb|ACD75579.1| phototropin 1 [Mulguraea asparagoides]
 gb|ACD75583.1| phototropin 1 [Mulguraea aspera]
Length=161

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75584.1| phototropin 1 [Mulguraea aspera]
Length=161

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75554.1| phototropin 1 [Glandularia bipinnatifida]
Length=155

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WENHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75540.1| phototropin 1 [Verbena lasiostachys]
Length=161

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75568.1| phototropin 1 [Glandularia tenera]
Length=161

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRESPSWKAIQQI  131



>gb|ACD75577.1| phototropin 1 [Mulguraea scoparia]
 gb|ACD75578.1| phototropin 1 [Mulguraea scoparia]
Length=161

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA N+DEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNIDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75549.1| phototropin 1 [Verbena rigida]
Length=161

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEP+ N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPIHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>ref|XP_001766409.1| PHOTB1 phototropin B1 blue light photoreceptor [Physcomitrella 
patens]
 dbj|BAD32624.1| phototropin [Physcomitrella patens]
 gb|EDQ68737.1| PHOTB1 phototropin B1 blue light photoreceptor [Physcomitrella 
patens]
Length=1133

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+++EP R RLS+KTE+E AK+++ TA N+D+AVRELPDAN+ PEDL
Sbjct  696  GELQYFIGVQLDGSEYLEPERRRLSEKTEKEGAKVVQETANNIDDAVRELPDANLKPEDL  755

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*I  135
            W+ HSLPV P+PH K S +W AI K+ I
Sbjct  756  WSKHSLPVHPKPHNKVSRAWDAIHKMKI  783



>ref|XP_010260111.1| PREDICTED: phototropin-1 [Nelumbo nucifera]
 ref|XP_010260113.1| PREDICTED: phototropin-1 [Nelumbo nucifera]
 ref|XP_010260114.1| PREDICTED: phototropin-1 [Nelumbo nucifera]
Length=1006

 Score =   128 bits (322),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL+N + + T ++ AKL+K TAENVDEAVRELPDAN+ P+DL
Sbjct  576  GEVQYFIGVQLDGSEHVEPLQNCIPENTAEKGAKLVKETAENVDEAVRELPDANLKPDDL  635

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  VFP+PH++ S+SW AIQK+
Sbjct  636  WVNHSKKVFPKPHRRDSSSWRAIQKI  661



>ref|XP_006828236.1| hypothetical protein AMTR_s00023p00186390 [Amborella trichopoda]
 gb|ERM95652.1| hypothetical protein AMTR_s00023p00186390 [Amborella trichopoda]
Length=1061

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + D+   ESAKL+K TAENVDEAVRELPDAN+ PEDL
Sbjct  608  GEVQYFIGVQLDGSEHVEPLHNCIPDRKANESAKLVKETAENVDEAVRELPDANLKPEDL  667

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K + SW AIQK+
Sbjct  668  WITHSKLVLPKPHRKDNPSWRAIQKI  693



>gb|AHZ63878.1| phototropin [Selaginella kraussiana]
Length=987

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 77/106 (73%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS++VEP R RLS++TEQE AK+++ATA NVDEAVRELPDAN  P+DL
Sbjct  569  GELQYFIGVQLDGSEYVEPARKRLSERTEQEGAKVVRATAANVDEAVRELPDANQTPDDL  628

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA HS  V  +PHK  S +W AI+K       +     KLG+Q  K
Sbjct  629  WAKHSKVVLAKPHKTNSPAWEAIRK-------VRSRGEKLGIQHFK  667



>gb|AAA50304.1| protein kinase [Pisum sativum]
 prf||1909355A protein kinase
Length=428

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR+++ T +E   L+K TAENVD+A+RELPDANM PEDL
Sbjct  6    GEVQYFIGVQLDGSQHVEPLHNRIAEDTAKEGENLVKKTAENVDDALRELPDANMKPEDL  65

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQK+
Sbjct  66   WMNHSKMVHPKPHRREDAAWRAIQKI  91



>emb|CBI16229.3| unnamed protein product [Vitis vinifera]
Length=958

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T +ESAKL+K TAEN+D+AVRELPDAN+ PEDL
Sbjct  529  GEVQYFIGVQLDGSEHVEPLHNCIPESTAKESAKLVKETAENIDDAVRELPDANLKPEDL  588

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W+ HS  V P+PH+K S++W AIQK+
Sbjct  589  WSNHSKVVLPKPHRKESSAWKAIQKI  614



>gb|KHN05698.1| Phototropin-1 [Glycine soja]
Length=731

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR++D T +E  +L+K TAENVD+A+RELPDANM PEDL
Sbjct  358  GEVQYFIGVQLDGSQHVEPLHNRIADDTAKEGEQLVKDTAENVDDALRELPDANMKPEDL  417

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQ++
Sbjct  418  WMNHSKVVHPKPHRRDEAAWKAIQQI  443



>ref|XP_002281752.1| PREDICTED: phototropin-1 [Vitis vinifera]
 ref|XP_010651089.1| PREDICTED: phototropin-1 [Vitis vinifera]
Length=1004

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T +ESAKL+K TAEN+D+AVRELPDAN+ PEDL
Sbjct  575  GEVQYFIGVQLDGSEHVEPLHNCIPESTAKESAKLVKETAENIDDAVRELPDANLKPEDL  634

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W+ HS  V P+PH+K S++W AIQK+
Sbjct  635  WSNHSKVVLPKPHRKESSAWKAIQKI  660



>gb|ACD75558.1| phototropin 1 [Glandularia gooddingii var. gooddingii]
Length=155

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AI+++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIRQI  131



>gb|ACD75548.1| phototropin 1 [Verbena rigida]
Length=161

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++   SW AIQ++
Sbjct  106  WKNHSKGVHPKPHRRDXPSWKAIQQI  131



>gb|ACD75580.1| phototropin 1 [Mulguraea asparagoides]
Length=161

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NV+EAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVEEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|ACD75553.1| phototropin 1 [Glandularia bipinnatifida]
Length=155

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  H   V P+PH++ S SW AIQ++
Sbjct  106  WKNHPKVVHPKPHRRDSPSWKAIQQI  131



>gb|AHZ63860.1| phototropin [Welwitschia mirabilis]
Length=1016

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+HVEPL+NRLS+ TE +SAK++K TA+NVD A RELPDAN+ P+DL
Sbjct  595  GELQYFIGVQLDGSEHVEPLQNRLSENTELQSAKIVKQTAQNVDIAARELPDANLKPDDL  654

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA+HS  V P+PHK  ++ W AI K+
Sbjct  655  WAIHSTIVLPKPHKGTNSLWKAINKI  680



>ref|XP_003539746.1| PREDICTED: phototropin-1-like isoform X1 [Glycine max]
 ref|XP_006592247.1| PREDICTED: phototropin-1-like isoform X2 [Glycine max]
 ref|XP_006592248.1| PREDICTED: phototropin-1-like isoform X3 [Glycine max]
 ref|XP_006592249.1| PREDICTED: phototropin-1-like isoform X4 [Glycine max]
Length=977

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR++D T +E  +L+K TAENVD+A+RELPDANM PEDL
Sbjct  549  GEVQYFIGVQLDGSQHVEPLHNRIADDTAKEGEQLVKDTAENVDDALRELPDANMKPEDL  608

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQ++
Sbjct  609  WMNHSKVVHPKPHRRDEAAWKAIQQI  634



>ref|XP_001785726.1| PHOTB2 phototropin B2 blue light photoreceptor [Physcomitrella 
patens]
 dbj|BAD32625.1| phototropin [Physcomitrella patens]
 gb|EDQ49461.1| PHOTB2 phototropin B2 blue light photoreceptor [Physcomitrella 
patens]
Length=1171

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            +GELQYFIGVQLDGS+++EP R RLS+KTE+E AK+++ TA N+D AVRELPDANM PED
Sbjct  729  NGELQYFIGVQLDGSEYLEPERRRLSEKTEKEGAKVVQETANNIDGAVRELPDANMKPED  788

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL  141
            LW+ HSLPV P+PH   S SW AI+K 
Sbjct  789  LWSKHSLPVHPKPHSINSPSWEAIRKF  815



>ref|XP_007132143.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 gb|ESW04137.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
Length=918

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR+++ T +E  KL+K TAENVD+A+RELPDAN+ PEDL
Sbjct  549  GEVQYFIGVQLDGSQHVEPLHNRIAENTAKEGEKLVKDTAENVDDALRELPDANLKPEDL  608

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQK+
Sbjct  609  WMNHSKVVHPKPHRRDEAAWKAIQKI  634



>gb|ACD75570.1| phototropin 1 [Glandularia microphylla]
Length=157

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVD AVRELPDAN  PEDL
Sbjct  42   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDGAVRELPDANTKPEDL  101

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  102  WKNHSKVVHPKPHRRDSPSWKAIQQI  127



>ref|XP_007132147.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 ref|XP_007132148.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 ref|XP_007132149.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 ref|XP_007132150.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 dbj|BAD89966.1| phototropin [Phaseolus vulgaris]
 gb|ESW04141.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 gb|ESW04142.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 gb|ESW04143.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 gb|ESW04144.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
Length=976

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR+++ T +E  KL+K TAENVD+A+RELPDAN+ PEDL
Sbjct  549  GEVQYFIGVQLDGSQHVEPLHNRIAENTAKEGEKLVKDTAENVDDALRELPDANLKPEDL  608

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQK+
Sbjct  609  WMNHSKVVHPKPHRRDEAAWKAIQKI  634



>gb|KDO73051.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
Length=905

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  577  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  636

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  637  WANHSKVVHPKPHRKDSPPWKAIQKI  662



>ref|XP_007132144.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 ref|XP_007132145.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 ref|XP_007132146.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 gb|ESW04138.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 gb|ESW04139.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
 gb|ESW04140.1| hypothetical protein PHAVU_011G070300g [Phaseolus vulgaris]
Length=975

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR+++ T +E  KL+K TAENVD+A+RELPDAN+ PEDL
Sbjct  549  GEVQYFIGVQLDGSQHVEPLHNRIAENTAKEGEKLVKDTAENVDDALRELPDANLKPEDL  608

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQK+
Sbjct  609  WMNHSKVVHPKPHRRDEAAWKAIQKI  634



>ref|XP_003606545.1| Phototropin [Medicago truncatula]
Length=940

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR+++ T +E   L+K TAENVD+A+RELPDANM PEDL
Sbjct  549  GEVQYFIGVQLDGSQHVEPLHNRIAEDTAKEGENLVKKTAENVDDALRELPDANMKPEDL  608

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQK+
Sbjct  609  WMNHSKVVHPKPHRRDDAAWRAIQKI  634



>gb|AES88742.2| nonphototropic hypocotyl protein [Medicago truncatula]
Length=974

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR+++ T +E   L+K TAENVD+A+RELPDANM PEDL
Sbjct  549  GEVQYFIGVQLDGSQHVEPLHNRIAEDTAKEGENLVKKTAENVDDALRELPDANMKPEDL  608

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQK+
Sbjct  609  WMNHSKVVHPKPHRRDDAAWRAIQKI  634



>gb|KDO73049.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
Length=931

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  574  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  633

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  634  WANHSKVVHPKPHRKDSPPWKAIQKI  659



>gb|KDO73050.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
Length=934

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  574  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  633

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  634  WANHSKVVHPKPHRKDSPPWKAIQKI  659



>gb|AHZ63852.1| phototropin [Stangeria eriopus]
Length=1084

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS++V P  NR+S+K E+E+A  +K TAENVDEAVRELPDAN+ PEDL
Sbjct  647  GEVQYFIGVQLDGSEYVVPSENRISEKAEKENATSVKETAENVDEAVRELPDANLKPEDL  706

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IA  132
            WA HS  V P+PHK  ++SW AIQK+ IA
Sbjct  707  WANHSKVVLPKPHKGNNSSWKAIQKILIA  735



>emb|CDP08961.1| unnamed protein product [Coffea canephora]
Length=1049

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPLRN + +    E AKL+K TAENVDEAVRELPDANM PEDL
Sbjct  621  GEVQYFIGVQLDGSEHVEPLRNCIPESRAGEGAKLVKETAENVDEAVRELPDANMKPEDL  680

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH++ ++SW AIQ++
Sbjct  681  WANHSKVVRPKPHRRDNSSWKAIQQI  706



>gb|KDO73045.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
Length=975

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  574  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  633

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  634  WANHSKVVHPKPHRKDSPPWKAIQKI  659



>gb|ACD75561.1| phototropin 1 [Glandularia aurantiaca]
Length=161

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAV ELPDAN  PEDL
Sbjct  46   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVGELPDANTKPEDL  105

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  106  WKNHSKVVHPKPHRRDSPSWKAIQQI  131



>gb|AHZ63875.1| phototropin [Pseudolycopodiella caroliniana]
Length=1063

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+ VEP   RLS+KTE+ESAKL++ATA +VDEAVRELPDAN+ P+DL
Sbjct  626  GELQYFIGVQLDGSEQVEPNLKRLSEKTEKESAKLVQATAVDVDEAVRELPDANLTPDDL  685

Query  218  WALHSLPVFPRPHKKGSASWGAIQK  144
            WA HS  V P+PHK  S++W AI+K
Sbjct  686  WAKHSKVVVPKPHKVNSSTWAAIRK  710



>gb|KDO73046.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
 gb|KDO73047.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
Length=1002

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  574  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  633

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  634  WANHSKVVHPKPHRKDSPPWKAIQKI  659



>ref|XP_006488214.1| PREDICTED: phototropin-1-like [Citrus sinensis]
Length=1002

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  574  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  633

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  634  WANHSKVVHPKPHRKDSPPWKAIQKI  659



>ref|XP_006424699.1| hypothetical protein CICLE_v10027740mg [Citrus clementina]
 gb|ESR37939.1| hypothetical protein CICLE_v10027740mg [Citrus clementina]
Length=1002

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  574  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  633

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  634  WANHSKVVHPKPHRKDSPPWKAIQKI  659



>gb|KDO73043.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
Length=1005

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  577  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  636

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  637  WANHSKVVHPKPHRKDSPPWKAIQKI  662



>gb|KDO73048.1| hypothetical protein CISIN_1g001847mg [Citrus sinensis]
Length=1002

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPLRN + + T +ES KL+K TAENV+EAV+ELPDAN+ PEDL
Sbjct  574  GEVQYFIGVQLDGSEHLEPLRNSIPEATAEESEKLVKQTAENVNEAVKELPDANLTPEDL  633

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S  W AIQK+
Sbjct  634  WANHSKVVHPKPHRKDSPPWKAIQKI  659



>gb|AHZ63849.1| phototropin [Podocarpus rubens]
Length=1076

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDG+QHVEP  N++ +KTE++ A+L+K TA NVD+AV+ELPDAN+ PEDL
Sbjct  640  GEVQYFIGVQLDGTQHVEPHLNKIPEKTEEDGARLVKETAANVDDAVKELPDANLKPEDL  699

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  VFP+PHKK ++SW AI+K+
Sbjct  700  WLNHSKLVFPKPHKKNNSSWKAIEKI  725



>gb|ACD75569.1| phototropin 1 [Glandularia tenera]
Length=152

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  43   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  102

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V  +PH++ S SW AIQ++
Sbjct  103  WKNHSKVVHLKPHRRDSPSWKAIQQI  128



>gb|AHZ63887.1| phototropin, partial [Sphaerocarpos texanus]
Length=1056

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+H+EP+R RLS+KTE+E  K+++ATA+NVD AVR+LPDANM  EDL
Sbjct  622  GELQYFIGVQLDGSEHIEPIRRRLSEKTEEEGKKIVQATAKNVDGAVRDLPDANMTIEDL  681

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W+ HS  V PRPHK+ ++SW A++K+
Sbjct  682  WSNHSRVVSPRPHKRQTSSWHAMRKV  707



>gb|ACD75533.1| phototropin 1 [Verbena hastata]
Length=142

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEPL N + + T QE+AK +K TA NVDEAVRELPDAN  PEDL
Sbjct  33   GEVQYFIGVQLDGSEHVEPLHNCIPEATAQENAKFVKETAVNVDEAVRELPDANTKPEDL  92

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W   S  V P+PH++ S SW AIQ++
Sbjct  93   WKNPSKVVHPKPHRRDSPSWKAIQQI  118



>gb|AHZ63873.1| phototropin [Osmunda regalis]
Length=1084

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+ +EP+R RLS+KTE+ESAK+++ATA +VDEAVRELPDAN+ P+DL
Sbjct  648  GELQYFIGVQLDGSEQLEPIRKRLSEKTEKESAKIVRATAVDVDEAVRELPDANLTPDDL  707

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PHK  +  W AIQ +
Sbjct  708  WANHSKTVLPKPHKMHNELWKAIQMI  733



>ref|XP_004148228.1| PREDICTED: phototropin-1-like [Cucumis sativus]
Length=952

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL N +++ T +E  KL+K TAENVD A RELPDAN+ PEDL
Sbjct  522  GEVQYFIGVQLDGSQHVEPLSNCIAESTAKEGEKLIKETAENVDLAARELPDANLTPEDL  581

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S SW AIQK+
Sbjct  582  WANHSKLVQPKPHRKDSPSWQAIQKI  607



>ref|XP_004167957.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-1-like, partial [Cucumis 
sativus]
Length=760

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL N +++ T +E  KL+K TAENVD A RELPDAN+ PEDL
Sbjct  330  GEVQYFIGVQLDGSQHVEPLSNCIAESTAKEGEKLIKETAENVDLAARELPDANLTPEDL  389

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S SW AIQK+
Sbjct  390  WANHSKLVQPKPHRKDSPSWQAIQKI  415



>gb|EYU36229.1| hypothetical protein MIMGU_mgv1a0015913mg, partial [Erythranthe 
guttata]
Length=351

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL N + + T  ESAKL+K TA N+D+AVRELPDAN  PEDL
Sbjct  1    GEVQYFIGVQLDGSQHVEPLHNCIPEATATESAKLVKETAANIDDAVRELPDANAKPEDL  60

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++ S SW AIQ++
Sbjct  61   WKNHSKVVRPKPHRRNSPSWNAIQEV  86



>ref|XP_007016616.1| Phototropin 1 isoform 2 [Theobroma cacao]
 gb|EOY34235.1| Phototropin 1 isoform 2 [Theobroma cacao]
Length=798

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS  V+PL NRL D   QES +L+K TAENVDEAVRELPDANM PEDL
Sbjct  573  GEVQYFIGVQLDGSAKVDPLHNRLPDSAAQESEQLVKKTAENVDEAVRELPDANMNPEDL  632

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S  W AIQK+
Sbjct  633  WMNHSKVVHPKPHRKDSPFWKAIQKI  658



>ref|XP_011005564.1| PREDICTED: phototropin-1 [Populus euphratica]
Length=986

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEP  N + + T  ES +L+K TAENVD+AVRELPDANM PEDL
Sbjct  558  GEVQYFIGVQLDGSEHVEPRTNSIPEATAIESEQLVKHTAENVDDAVRELPDANMRPEDL  617

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V+P+PH+K S SW AIQK+
Sbjct  618  WANHSKVVYPKPHRKDSPSWKAIQKI  643



>ref|XP_008463863.1| PREDICTED: phototropin-1 [Cucumis melo]
Length=1021

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL N +++ T +E  KL+K TAENVD A RELPDAN+ PEDL
Sbjct  591  GEVQYFIGVQLDGSQHVEPLSNCIAETTAKEGEKLIKETAENVDLAARELPDANLTPEDL  650

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S SW AIQK+
Sbjct  651  WANHSKLVQPKPHRKDSPSWKAIQKI  676



>ref|XP_001774614.1| PHOTA2 phototropin A2 blue light photoreceptor [Physcomitrella 
patens]
 dbj|BAD32623.1| phototropin [Physcomitrella patens]
 gb|EDQ60548.1| PHOTA2 phototropin A2 blue light photoreceptor [Physcomitrella 
patens]
Length=1095

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGSQ+VEP+R+RLSD TE+ SAKL++ TA N+D AVRELPDAN  PEDL
Sbjct  658  GELQYFIGVQLDGSQYVEPVRHRLSDNTEKASAKLVRETARNIDVAVRELPDANTSPEDL  717

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA HS  V P+PH  G+A+W A+ K       +     KLG++  K
Sbjct  718  WANHSEFVKPKPHMGGTAAWKALIK-------VRSSGQKLGLKHFK  756



>gb|KGN47332.1| hypothetical protein Csa_6G301020 [Cucumis sativus]
Length=1033

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL N +++ T +E  KL+K TAENVD A RELPDAN+ PEDL
Sbjct  603  GEVQYFIGVQLDGSQHVEPLSNCIAESTAKEGEKLIKETAENVDLAARELPDANLTPEDL  662

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH+K S SW AIQK+
Sbjct  663  WANHSKLVQPKPHRKDSPSWQAIQKI  688



>ref|XP_007016620.1| Phototropin 1 isoform 6 [Theobroma cacao]
 gb|EOY34239.1| Phototropin 1 isoform 6 [Theobroma cacao]
Length=908

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS  V+PL NRL D   QES +L+K TAENVDEAVRELPDANM PEDL
Sbjct  573  GEVQYFIGVQLDGSAKVDPLHNRLPDSAAQESEQLVKKTAENVDEAVRELPDANMNPEDL  632

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S  W AIQK+
Sbjct  633  WMNHSKVVHPKPHRKDSPFWKAIQKI  658



>gb|AHZ63895.1| phototropin [Anomodon rostratus]
Length=1155

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            SGELQYFIGVQLDGS+++EP R+RLS + E+E AK+++ TA N+D AVRELPDANM PED
Sbjct  713  SGELQYFIGVQLDGSEYLEPERHRLSREKEREGAKVVQETANNIDGAVRELPDANMKPED  772

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL  141
            LW+ HSLPV+ RPH K S SW A  K+
Sbjct  773  LWSKHSLPVYARPHSKNSPSWEAFTKI  799



>ref|XP_007016621.1| Phototropin 1 isoform 7 [Theobroma cacao]
 gb|EOY34240.1| Phototropin 1 isoform 7 [Theobroma cacao]
Length=903

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS  V+PL NRL D   QES +L+K TAENVDEAVRELPDANM PEDL
Sbjct  573  GEVQYFIGVQLDGSAKVDPLHNRLPDSAAQESEQLVKKTAENVDEAVRELPDANMNPEDL  632

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S  W AIQK+
Sbjct  633  WMNHSKVVHPKPHRKDSPFWKAIQKI  658



>ref|NP_001234214.1| phototropin-1 [Solanum lycopersicum]
 gb|ABN42185.2| phototropin-1 [Solanum lycopersicum]
Length=1018

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL+N + +    ESAKL+K TA NVDEAVRELPDAN  PEDL
Sbjct  589  GEVQYFIGVQLDGSQHVEPLQNSIPEDKATESAKLIKETAGNVDEAVRELPDANSKPEDL  648

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAK  102
            W  HS  V P+PH+K S SW AIQK+  +  PI ++  K
Sbjct  649  WRNHSKVVQPKPHRKDSPSWKAIQKILESGEPIGLKHFK  687



>ref|XP_007016617.1| Phototropin 1 isoform 3, partial [Theobroma cacao]
 gb|EOY34236.1| Phototropin 1 isoform 3, partial [Theobroma cacao]
Length=977

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS  V+PL NRL D   QES +L+K TAENVDEAVRELPDANM PEDL
Sbjct  573  GEVQYFIGVQLDGSAKVDPLHNRLPDSAAQESEQLVKKTAENVDEAVRELPDANMNPEDL  632

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S  W AIQK+
Sbjct  633  WMNHSKVVHPKPHRKDSPFWKAIQKI  658



>ref|XP_007016615.1| Phototropin 1 isoform 1 [Theobroma cacao]
 ref|XP_007016619.1| Phototropin 1 isoform 1 [Theobroma cacao]
 gb|EOY34234.1| Phototropin 1 isoform 1 [Theobroma cacao]
 gb|EOY34238.1| Phototropin 1 isoform 1 [Theobroma cacao]
Length=1001

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS  V+PL NRL D   QES +L+K TAENVDEAVRELPDANM PEDL
Sbjct  573  GEVQYFIGVQLDGSAKVDPLHNRLPDSAAQESEQLVKKTAENVDEAVRELPDANMNPEDL  632

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S  W AIQK+
Sbjct  633  WMNHSKVVHPKPHRKDSPFWKAIQKI  658



>ref|XP_006365149.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-1-like [Solanum tuberosum]
Length=1022

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL N + +    ESAKL+K TA NVDEAVRELPDAN  PEDL
Sbjct  593  GEVQYFIGVQLDGSQHVEPLHNSIPEDKATESAKLIKETAGNVDEAVRELPDANSKPEDL  652

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAK  102
            W  HS  V P+PH+K S SW AIQK+  +  PI+++  K
Sbjct  653  WRNHSKVVQPKPHRKDSPSWKAIQKIMESGEPISLKHFK  691



>ref|XP_007016618.1| Phototropin 1 isoform 4 [Theobroma cacao]
 gb|EOY34237.1| Phototropin 1 isoform 4 [Theobroma cacao]
Length=996

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS  V+PL NRL D   QES +L+K TAENVDEAVRELPDANM PEDL
Sbjct  573  GEVQYFIGVQLDGSAKVDPLHNRLPDSAAQESEQLVKKTAENVDEAVRELPDANMNPEDL  632

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH+K S  W AIQK+
Sbjct  633  WMNHSKVVHPKPHRKDSPFWKAIQKI  658



>ref|XP_008349724.1| PREDICTED: phototropin-1-like [Malus domestica]
Length=699

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EPL+N + + T +ES KL++ TAENVDEA RELPDAN+ PEDL
Sbjct  270  GEVQYFIGVQLDGSEHIEPLKNAIPEDTVKESEKLIRETAENVDEAARELPDANLKPEDL  329

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVE  111
            W  HS  V P+PH+K + SW AIQK+  +  PI ++
Sbjct  330  WMNHSKXVHPKPHRKYTPSWVAIQKILDSGEPIGLK  365



>gb|AHZ63879.1| phototropin [Isoetes tegetiformans]
Length=999

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS +VEP+ NRLS+++E + AKL++ATA NVDEA+RELPD N+ P+D+
Sbjct  576  GELQYFIGVQLDGSDNVEPVMNRLSERSENQGAKLVRATARNVDEAIRELPDPNLTPDDI  635

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PHK+ + SW AI+++
Sbjct  636  WAKHSKIVVPKPHKRNNDSWAAIREV  661



>gb|AHZ63870.1| phototropin [Cystopteris reevesiana]
Length=1048

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS+ +EP++ RLS+KTE+E AK+++ATA NVDEAVRELPDAN+ PEDL
Sbjct  613  GELQYFIGVQLDGSEQLEPIQRRLSEKTEKEGAKIVRATAYNVDEAVRELPDANLTPEDL  672

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V  +PHK  S SW AIQ++
Sbjct  673  WANHSKSVSAKPHKVHSDSWKAIQQV  698



>gb|AHZ63889.1| phototropin [Scouleria aquatica]
Length=1066

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS++VEP+R+RLSD TE+ SAKL++ TA N+D AVRELPDAN  PEDL
Sbjct  630  GELQYFIGVQLDGSEYVEPVRHRLSDNTEKASAKLVRETARNIDVAVRELPDANTTPEDL  689

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V P+PH  G+A+W A+ K+
Sbjct  690  WANHSKFVKPKPHMGGTAAWEALVKV  715



>gb|AHZ63882.1| phototropin [Schistochila sp. LGOW]
Length=1073

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  404  TSGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPE  225
            + GELQYFIGVQLDGS+H+EP+R R+S++TEQE  K+++ TA NVD A+RELPDAN   E
Sbjct  635  SKGELQYFIGVQLDGSEHIEPIRRRMSERTEQEGKKIVQFTARNVDGALRELPDANTSLE  694

Query  224  DLWALHSLPVFPRPHKKGSASWGAIQKL  141
            DLWA HS  VFP+PH++ +++W AI+K+
Sbjct  695  DLWANHSHEVFPKPHRRNTSTWDAIRKI  722



>gb|AHZ63891.1| phototropin [Timmia austriaca]
Length=875

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS++VEP+R+RLSD TE+ SAKL++ TA+N+D AVRELPDAN  PEDL
Sbjct  440  GELQYFIGVQLDGSEYVEPIRHRLSDNTEKASAKLVRETAKNIDVAVRELPDANTTPEDL  499

Query  218  WALHSLPVFPRPHKKGSASWGAI  150
            WA HS  V P+PH  G+A+W A+
Sbjct  500  WANHSKFVNPKPHMGGTAAWQAL  522



>gb|AHZ63896.1| phototropin [Bryum argenteum]
Length=1137

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -1

Query  401  SGELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPED  222
            SGELQYFIGVQLDGS+++EP R RLS   E+E AK+++ TA N+D AVRELPDANM PED
Sbjct  695  SGELQYFIGVQLDGSEYLEPERKRLSRDKEKEGAKIVQDTANNIDGAVRELPDANMKPED  754

Query  221  LWALHSLPVFPRPHKKGSASWGAIQKL  141
            LW+ HSLPV+ RPH K S +W AI K+
Sbjct  755  LWSKHSLPVYARPHSKFSPAWEAIMKI  781



>ref|XP_002298559.1| kinase family protein [Populus trichocarpa]
 gb|EEE83364.1| kinase family protein [Populus trichocarpa]
Length=977

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+HVEP  N + + T  ES +L+K TAENVD+A RELPDANM PEDL
Sbjct  548  GEVQYFIGVQLDGSEHVEPRTNSIPEATAIESEQLVKQTAENVDDAARELPDANMRPEDL  607

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            WA HS  V+P+PH+K S SW AIQK+
Sbjct  608  WANHSKVVYPKPHRKDSPSWKAIQKI  633



>gb|AHZ63892.1| phototropin, partial [Polytrichum commune]
Length=542

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 75/106 (71%), Gaps = 7/106 (7%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GELQYFIGVQLDGS++VEP+R+RLS+ TE+ SAKL++ TA N+D AVRELPDAN+ PEDL
Sbjct  143  GELQYFIGVQLDGSEYVEPVRHRLSENTEKASAKLVRETARNIDGAVRELPDANLTPEDL  202

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IAVFPIAVEAAKLGMQRSK  81
            WA HS  V P+PH   S  W AI K       I     KLG++  K
Sbjct  203  WANHSKFVSPKPHMGNSPEWKAIMK-------IRNSGQKLGLKNFK  241



>ref|XP_004505926.1| PREDICTED: phototropin-1-like isoform X1 [Cicer arietinum]
 ref|XP_004505927.1| PREDICTED: phototropin-1-like isoform X2 [Cicer arietinum]
 ref|XP_004505928.1| PREDICTED: phototropin-1-like isoform X3 [Cicer arietinum]
Length=953

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGSQHVEPL NR+++ T +E   ++K TAENVD+A+RELPDAN+ PEDL
Sbjct  528  GEVQYFIGVQLDGSQHVEPLHNRIAEDTAKEGEHVVKKTAENVDDALRELPDANLKPEDL  587

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL  141
            W  HS  V P+PH++  A+W AIQK+
Sbjct  588  WINHSKVVHPKPHRRDEAAWRAIQKI  613



>ref|XP_007208378.1| hypothetical protein PRUPE_ppa000777mg [Prunus persica]
 gb|EMJ09577.1| hypothetical protein PRUPE_ppa000777mg [Prunus persica]
Length=1007

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -1

Query  398  GELQYFIGVQLDGSQHVEPLRNRLSDKTEQESAKLLKATAENVDEAVRELPDANMIPEDL  219
            GE+QYFIGVQLDGS+H+EP+ N + + T +ES KL++ATAENVD+A RELPDANM PEDL
Sbjct  578  GEVQYFIGVQLDGSEHIEPVNNSIPEDTVKESEKLVRATAENVDDAARELPDANMKPEDL  637

Query  218  WALHSLPVFPRPHKKGSASWGAIQKL*IA  132
            W  HS  V P+PH+K S SW AI+K+ ++
Sbjct  638  WMNHSKVVHPKPHRKNSPSWRAIEKILVS  666



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060