BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028G17

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629368.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    191   6e-53   Nicotiana tomentosiformis
ref|XP_009629366.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    191   1e-52   Nicotiana tomentosiformis
ref|XP_009782254.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    189   2e-52   Nicotiana sylvestris
ref|XP_009782253.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    189   3e-52   Nicotiana sylvestris
ref|XP_007012227.1|  Hydroxyproline-rich glycoprotein family prot...    188   1e-51   
ref|XP_009594922.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    172   3e-46   Nicotiana tomentosiformis
ref|XP_009594920.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    172   3e-46   Nicotiana tomentosiformis
ref|XP_006355312.1|  PREDICTED: protein EARLY FLOWERING 3-like          172   4e-46   
gb|KDP34132.1|  hypothetical protein JCGZ_07703                         171   1e-45   Jatropha curcas
emb|CBI20609.3|  unnamed protein product                                169   7e-45   Vitis vinifera
ref|XP_002278577.1|  PREDICTED: protein EARLY FLOWERING 3               169   1e-44   
ref|XP_004253100.1|  PREDICTED: protein EARLY FLOWERING 3               167   3e-44   Solanum lycopersicum
ref|XP_006342510.1|  PREDICTED: protein EARLY FLOWERING 3-like          166   9e-44   Solanum tuberosum [potatoes]
emb|CAN70608.1|  hypothetical protein VITISV_040198                     168   1e-43   Vitis vinifera
ref|XP_008220435.1|  PREDICTED: protein EARLY FLOWERING 3               162   2e-42   Prunus mume [ume]
ref|XP_004245125.1|  PREDICTED: protein EARLY FLOWERING 3-like          162   2e-42   Solanum lycopersicum
ref|XP_007221988.1|  hypothetical protein PRUPE_ppa002858mg             160   9e-42   
ref|XP_006340248.1|  PREDICTED: protein EARLY FLOWERING 3-like          156   1e-40   Solanum tuberosum [potatoes]
gb|AIN75607.1|  EARLY FLOWERING 3                                       156   3e-40   Dimocarpus longan [longan]
gb|KJB07440.1|  hypothetical protein B456_001G024100                    154   8e-40   Gossypium raimondii
gb|KJB07439.1|  hypothetical protein B456_001G024100                    154   1e-39   Gossypium raimondii
ref|XP_008377913.1|  PREDICTED: protein EARLY FLOWERING 3-like          151   3e-39   
ref|XP_009784952.1|  PREDICTED: protein EARLY FLOWERING 3-like          152   4e-39   Nicotiana sylvestris
ref|XP_010049159.1|  PREDICTED: protein EARLY FLOWERING 3               152   1e-38   Eucalyptus grandis [rose gum]
ref|XP_006450775.1|  hypothetical protein CICLE_v10007592mg             152   1e-38   Citrus clementina [clementine]
ref|XP_008357349.1|  PREDICTED: protein EARLY FLOWERING 3-like          151   2e-38   
gb|KDO79979.1|  hypothetical protein CISIN_1g004928mg                   150   4e-38   Citrus sinensis [apfelsine]
ref|XP_006475975.1|  PREDICTED: protein EARLY FLOWERING 3-like          150   4e-38   Citrus sinensis [apfelsine]
ref|XP_009337143.1|  PREDICTED: protein EARLY FLOWERING 3-like          149   9e-38   Pyrus x bretschneideri [bai li]
ref|XP_002516480.1|  conserved hypothetical protein                     149   1e-37   Ricinus communis
emb|CDP08210.1|  unnamed protein product                                149   1e-37   Coffea canephora [robusta coffee]
ref|XP_010097101.1|  hypothetical protein L484_019540                   147   4e-37   Morus notabilis
ref|XP_008351957.1|  PREDICTED: protein EARLY FLOWERING 3-like          146   1e-36   
ref|XP_008393666.1|  PREDICTED: protein EARLY FLOWERING 3               146   2e-36   
ref|XP_004251173.1|  PREDICTED: protein EARLY FLOWERING 3-like          144   2e-36   Solanum lycopersicum
ref|XP_009361544.1|  PREDICTED: protein EARLY FLOWERING 3-like          144   6e-36   Pyrus x bretschneideri [bai li]
gb|KJB07438.1|  hypothetical protein B456_001G024000                    144   8e-36   Gossypium raimondii
gb|KHN29734.1|  Protein EARLY FLOWERING 3                               144   1e-35   Glycine soja [wild soybean]
ref|XP_003523640.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    143   1e-35   Glycine max [soybeans]
ref|XP_004501482.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    139   7e-34   Cicer arietinum [garbanzo]
ref|XP_010097102.1|  hypothetical protein L484_019541                   135   1e-33   
ref|XP_007024385.1|  Hydroxyproline-rich glycoprotein family prot...    137   4e-33   
ref|XP_010244364.1|  PREDICTED: protein EARLY FLOWERING 3               135   1e-32   Nelumbo nucifera [Indian lotus]
gb|AFZ78447.1|  early flowering 3                                       134   3e-32   Lens culinaris
ref|XP_004291013.1|  PREDICTED: protein EARLY FLOWERING 3               134   4e-32   Fragaria vesca subsp. vesca
ref|XP_003603108.1|  Protein EARLY FLOWERING                            131   3e-31   Medicago truncatula
ref|XP_004143036.1|  PREDICTED: protein EARLY FLOWERING 3-like          130   5e-31   Cucumis sativus [cucumbers]
ref|XP_004168028.1|  PREDICTED: protein EARLY FLOWERING 3-like          130   6e-31   
gb|KHF99548.1|  Protein EARLY FLOWERING 3 -like protein                 130   9e-31   Gossypium arboreum [tree cotton]
ref|XP_011081715.1|  PREDICTED: LOW QUALITY PROTEIN: protein EARL...    129   1e-30   Sesamum indicum [beniseed]
gb|KJB56855.1|  hypothetical protein B456_009G138600                    129   1e-30   Gossypium raimondii
gb|AFR60580.1|  early flowering 3/high response                         128   4e-30   Pisum sativum subsp. sativum
ref|XP_011095302.1|  PREDICTED: protein EARLY FLOWERING 3-like          126   2e-29   Sesamum indicum [beniseed]
ref|XP_010669115.1|  PREDICTED: protein EARLY FLOWERING 3               124   1e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007216534.1|  hypothetical protein PRUPE_ppa026719mg             124   2e-28   Prunus persica
gb|KDO58687.1|  hypothetical protein CISIN_1g004483mg                   123   2e-28   Citrus sinensis [apfelsine]
ref|XP_006426449.1|  hypothetical protein CICLE_v10024969mg             123   3e-28   Citrus clementina [clementine]
gb|KDO58686.1|  hypothetical protein CISIN_1g004483mg                   123   3e-28   Citrus sinensis [apfelsine]
ref|XP_006466166.1|  PREDICTED: protein EARLY FLOWERING 3-like          122   6e-28   Citrus sinensis [apfelsine]
ref|XP_008244744.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X3    120   2e-27   
ref|XP_008244742.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X1    120   2e-27   Prunus mume [ume]
ref|XP_008244743.1|  PREDICTED: protein EARLY FLOWERING 3 isoform X2    120   2e-27   Prunus mume [ume]
ref|XP_008444497.1|  PREDICTED: protein EARLY FLOWERING 3               117   3e-26   Cucumis melo [Oriental melon]
ref|XP_003550290.1|  PREDICTED: protein EARLY FLOWERING 3-like          116   5e-26   Glycine max [soybeans]
gb|KDP40820.1|  hypothetical protein JCGZ_24819                         116   8e-26   Jatropha curcas
gb|AEA50867.1|  elf3a                                                   112   1e-25   Populus tremula [European aspen]
gb|KHN17209.1|  Protein EARLY FLOWERING 3                               114   3e-25   Glycine soja [wild soybean]
ref|XP_008462380.1|  PREDICTED: protein EARLY FLOWERING 3               114   3e-25   
ref|XP_011019541.1|  PREDICTED: protein EARLY FLOWERING 3               113   6e-25   Populus euphratica
ref|XP_007160975.1|  hypothetical protein PHAVU_001G032900g             112   1e-24   Phaseolus vulgaris [French bean]
ref|XP_004141800.1|  PREDICTED: uncharacterized protein LOC101208149    112   2e-24   Cucumis sativus [cucumbers]
ref|XP_007160974.1|  hypothetical protein PHAVU_001G032900g             112   2e-24   Phaseolus vulgaris [French bean]
ref|XP_008797900.1|  PREDICTED: protein EARLY FLOWERING 3               112   2e-24   Phoenix dactylifera
ref|XP_006385404.1|  hypothetical protein POPTR_0003s04030g             107   9e-24   
ref|XP_002276544.3|  PREDICTED: protein EARLY FLOWERING 3 isoform X1    108   3e-23   Vitis vinifera
emb|CBI35994.3|  unnamed protein product                                108   3e-23   Vitis vinifera
emb|CAN65004.1|  hypothetical protein VITISV_023490                     108   4e-23   Vitis vinifera
gb|AEA50868.1|  elf3b                                                   103   2e-22   Populus tremula [European aspen]
ref|XP_010267079.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    105   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010267078.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    105   4e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002309522.1|  EARLY FLOWERING 3 family protein                   104   6e-22   
ref|XP_010915306.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    103   1e-21   Elaeis guineensis
ref|XP_010915307.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    103   1e-21   Elaeis guineensis
ref|XP_004498925.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    102   2e-21   
ref|XP_010062565.1|  PREDICTED: protein EARLY FLOWERING 3-like          100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_011011712.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    100   2e-20   Populus euphratica
ref|XP_011011714.1|  PREDICTED: protein EARLY FLOWERING 3-like is...    100   2e-20   Populus euphratica
ref|XP_009401962.1|  PREDICTED: protein EARLY FLOWERING 3-like          100   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB35029.1|  hypothetical protein B456_006G096400                  99.8    3e-20   Gossypium raimondii
gb|KHG06245.1|  Protein EARLY FLOWERING 3 -like protein               99.8    3e-20   Gossypium arboreum [tree cotton]
ref|XP_010322857.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  98.6    5e-20   
ref|XP_010322854.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  98.6    8e-20   Solanum lycopersicum
ref|XP_002515898.1|  hypothetical protein RCOM_1486170                98.6    8e-20   Ricinus communis
ref|XP_004242270.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  98.6    1e-19   Solanum lycopersicum
ref|XP_002440379.1|  hypothetical protein SORBIDRAFT_09g030700        97.8    1e-19   Sorghum bicolor [broomcorn]
dbj|BAL45488.1|  early flowering 3                                    96.3    4e-19   Fagopyrum esculentum
ref|XP_004969004.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  95.9    5e-19   
ref|XP_004969003.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  95.9    6e-19   Setaria italica
ref|XP_010106119.1|  hypothetical protein L484_003122                 95.9    7e-19   
ref|XP_004969002.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  95.9    7e-19   
ref|XP_006357460.1|  PREDICTED: protein EARLY FLOWERING 3-like        95.9    7e-19   
ref|XP_009400544.1|  PREDICTED: protein EARLY FLOWERING 3-like        95.1    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004960992.1|  PREDICTED: protein EARLY FLOWERING 3-like        94.7    2e-18   Setaria italica
ref|XP_009625227.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  94.0    3e-18   
ref|XP_008806826.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  94.0    4e-18   Phoenix dactylifera
ref|XP_008806834.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  93.6    4e-18   Phoenix dactylifera
ref|XP_009625226.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  93.6    4e-18   Nicotiana tomentosiformis
ref|XP_010910484.1|  PREDICTED: protein EARLY FLOWERING 3             90.9    3e-17   Elaeis guineensis
ref|XP_003567779.1|  PREDICTED: protein EARLY FLOWERING 3-like        89.7    8e-17   Brachypodium distachyon [annual false brome]
ref|XP_011080316.1|  PREDICTED: protein EARLY FLOWERING 3-like        89.0    1e-16   
ref|XP_010924961.1|  PREDICTED: protein EARLY FLOWERING 3-like        89.0    1e-16   Elaeis guineensis
gb|ABL11477.1|  ELF3 protein                                          88.6    2e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009407571.1|  PREDICTED: protein EARLY FLOWERING 3-like        88.2    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009778080.1|  PREDICTED: protein EARLY FLOWERING 3-like        88.2    3e-16   Nicotiana sylvestris
gb|AAQ73529.1|  early flowering 3                                     87.0    6e-16   Mesembryanthemum crystallinum
gb|KEH39955.1|  EARLY flowering protein, putative                     85.9    8e-16   Medicago truncatula
gb|KEH39956.1|  EARLY flowering protein, putative                     85.9    1e-15   Medicago truncatula
gb|EYU20385.1|  hypothetical protein MIMGU_mgv1a014747mg              81.6    2e-15   Erythranthe guttata [common monkey flower]
gb|EYU29309.1|  hypothetical protein MIMGU_mgv1a022839mg              85.5    2e-15   Erythranthe guttata [common monkey flower]
gb|AGT17012.1|  hydroxyproline-rich glycoprotein family protein       84.7    4e-15   Saccharum hybrid cultivar R570
gb|AGT16064.1|  hydroxyproline-rich glycoprotein family protein       84.3    4e-15   Saccharum hybrid cultivar R570
ref|XP_009384215.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  83.2    1e-14   
ref|XP_011463349.1|  PREDICTED: protein EARLY FLOWERING 3             83.2    1e-14   Fragaria vesca subsp. vesca
gb|AGT16850.1|  hydroxyproline-rich glycoprotein family protein       82.8    1e-14   Saccharum hybrid cultivar R570
ref|XP_008673213.1|  PREDICTED: uncharacterized protein LOC100383...  81.6    4e-14   Zea mays [maize]
ref|NP_001169653.1|  uncharacterized protein LOC100383534             81.6    4e-14   Zea mays [maize]
gb|KHN11326.1|  Protein FAR1-RELATED SEQUENCE 11                      80.1    2e-13   Glycine soja [wild soybean]
ref|XP_006585544.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  77.8    6e-13   Glycine max [soybeans]
dbj|BAJ94845.1|  predicted protein                                    77.0    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96537.1|  predicted protein                                    76.6    1e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004498928.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  75.5    3e-12   
gb|EEE54823.1|  hypothetical protein OsJ_02258                        73.9    1e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99610.1|  hypothetical protein OsI_21588                        73.6    1e-11   Oryza sativa Indica Group [Indian rice]
gb|AGW16337.1|  Hd-q                                                  73.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAL63009.1|  Hd17                                                 73.6    2e-11   Oryza sativa Indica Group [Indian rice]
gb|EEC70910.1|  hypothetical protein OsI_02465                        73.6    2e-11   Oryza sativa Indica Group [Indian rice]
gb|AEZ53982.1|  early flowering protein 3                             73.2    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH18269.1|  early flowering protein, putative                     73.2    2e-11   Medicago truncatula
gb|KHN39274.1|  Protein EARLY FLOWERING 3                             73.2    2e-11   Glycine soja [wild soybean]
dbj|BAL63008.1|  Hd17                                                 72.4    4e-11   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA83571.1|  putative early flowering 3                           72.4    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007135598.1|  hypothetical protein PHAVU_010G142900g           71.6    5e-11   Phaseolus vulgaris [French bean]
ref|XP_007135599.1|  hypothetical protein PHAVU_010G142900g           71.6    5e-11   Phaseolus vulgaris [French bean]
ref|XP_004510333.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  71.6    6e-11   
gb|AEW48248.1|  early flowering 3                                     70.9    1e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006583036.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  68.9    4e-10   Glycine max [soybeans]
ref|XP_006583035.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  68.9    4e-10   Glycine max [soybeans]
ref|XP_006583033.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  68.9    4e-10   Glycine max [soybeans]
ref|XP_006646013.1|  PREDICTED: protein EARLY FLOWERING 3-like        68.9    5e-10   
emb|CDO97951.1|  unnamed protein product                              67.4    1e-09   Coffea canephora [robusta coffee]
ref|XP_006646014.1|  PREDICTED: protein EARLY FLOWERING 3-like        66.2    3e-09   
ref|NP_180164.1|  protein EARLY FLOWERING 3                           65.9    4e-09   Arabidopsis thaliana [mouse-ear cress]
gb|AEK05758.1|  early flowering 3                                     62.0    3e-08   Populus balsamifera [balsam poplar]
gb|AEK05757.1|  early flowering 3                                     62.0    3e-08   Populus balsamifera [balsam poplar]
ref|XP_002458017.1|  hypothetical protein SORBIDRAFT_03g025560        62.4    6e-08   Sorghum bicolor [broomcorn]
ref|XP_010429612.1|  PREDICTED: protein EARLY FLOWERING 3-like        62.0    8e-08   Camelina sativa [gold-of-pleasure]
gb|AEK05763.1|  early flowering 3                                     60.1    1e-07   Populus balsamifera [balsam poplar]
ref|XP_006853900.1|  hypothetical protein AMTR_s00036p00168840        61.2    2e-07   Amborella trichopoda
ref|XP_002878908.1|  hypothetical protein ARALYDRAFT_481449           60.5    2e-07   
ref|XP_010466369.1|  PREDICTED: protein EARLY FLOWERING 3-like        59.3    5e-07   
ref|XP_006297383.1|  hypothetical protein CARUB_v10013409mg           59.3    6e-07   Capsella rubella
ref|XP_009109631.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  58.9    8e-07   Brassica rapa
emb|CDY51450.1|  BnaA05g36670D                                        58.9    8e-07   Brassica napus [oilseed rape]
ref|XP_009109647.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  58.9    8e-07   Brassica rapa
ref|XP_009145486.1|  PREDICTED: protein EARLY FLOWERING 3             58.9    9e-07   Brassica rapa
emb|CDY62750.1|  BnaC01g43670D                                        58.9    9e-07   Brassica napus [oilseed rape]
gb|AAX23847.1|  hypothetical protein At3g21320                        58.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188769.1|  uncharacterized protein                             58.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526158.1|  PREDICTED: protein EARLY FLOWERING 3-like        58.5    1e-06   Tarenaya hassleriana [spider flower]
emb|CAA72719.1|  nematode responsive protein                          58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01726.1|  unnamed protein product                              58.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510094.1|  PREDICTED: protein EARLY FLOWERING 3-like        57.8    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010526070.1|  PREDICTED: protein EARLY FLOWERING 3             57.4    3e-06   Tarenaya hassleriana [spider flower]
ref|XP_006406284.1|  hypothetical protein EUTSA_v10020453mg           57.0    4e-06   Eutrema salsugineum [saltwater cress]
gb|AEK26570.1|  early flowering 3                                     56.2    4e-06   Populus tremula [European aspen]
gb|KEH39953.1|  EARLY flowering protein, putative                     57.0    4e-06   Medicago truncatula
ref|XP_010417373.1|  PREDICTED: protein EARLY FLOWERING 3-like        56.6    5e-06   Camelina sativa [gold-of-pleasure]
emb|CDY32422.1|  BnaC03g42060D                                        56.6    5e-06   Brassica napus [oilseed rape]
gb|KEH39954.1|  EARLY flowering protein, putative                     56.6    5e-06   Medicago truncatula
emb|CDY35321.1|  BnaA04g15260D                                        56.6    5e-06   Brassica napus [oilseed rape]
ref|XP_009140718.1|  PREDICTED: protein EARLY FLOWERING 3             56.6    5e-06   Brassica rapa
ref|XP_010545644.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  56.2    7e-06   Tarenaya hassleriana [spider flower]
gb|AFK35699.1|  unknown                                               54.3    7e-06   Medicago truncatula
ref|XP_010545643.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  55.8    8e-06   Tarenaya hassleriana [spider flower]
emb|CDY56915.1|  BnaCnng31360D                                        55.8    9e-06   Brassica napus [oilseed rape]
ref|XP_002885435.1|  hypothetical protein ARALYDRAFT_342282           55.8    1e-05   
gb|KFK29903.1|  early flowering 3                                     55.8    1e-05   Arabis alpina [alpine rockcress]
emb|CDY48882.1|  BnaA03g36210D                                        55.1    2e-05   Brassica napus [oilseed rape]
ref|XP_008650078.1|  PREDICTED: protein EARLY FLOWERING 3-like        55.1    2e-05   Zea mays [maize]
ref|XP_010488142.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  54.3    3e-05   
ref|XP_010488144.1|  PREDICTED: protein EARLY FLOWERING 3-like is...  54.3    3e-05   Camelina sativa [gold-of-pleasure]
emb|CDY66493.1|  BnaCnng51090D                                        52.4    1e-04   Brassica napus [oilseed rape]
dbj|BAD97872.1|  ELF3 homologue                                       52.0    2e-04   Lemna gibba
ref|XP_009135744.1|  PREDICTED: protein EARLY FLOWERING 3-like        51.6    2e-04   Brassica rapa
emb|CDY11505.1|  BnaA09g40710D                                        51.6    3e-04   Brassica napus [oilseed rape]
ref|XP_009117036.1|  PREDICTED: protein EARLY FLOWERING 3             51.6    3e-04   
ref|NP_001288828.1|  protein EARLY FLOWERING 3                        51.2    3e-04   Brassica rapa
ref|XP_006293368.1|  hypothetical protein CARUB_v10022728mg           50.8    5e-04   Capsella rubella



>ref|XP_009629368.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=608

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 121/171 (71%), Gaps = 13/171 (8%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQGMG PFAPP GHGYFP Y MPVMN  +S+S VE+ N FT  G Q Q+SGG  N N+QH
Sbjct  443  YQGMGVPFAPPTGHGYFPHYSMPVMNPPISSSTVEESNQFTSPGFQRQLSGGVDNFNIQH  502

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            Q+S N PS+KNG  +V D  R  A +DNE+QAS ASSPS RA    VS   +GR++L LF
Sbjct  503  QDSSNGPSEKNG--NVPDVLRFQATRDNELQASTASSPSERA---AVSNATQGRNMLSLF  557

Query  333  PTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP  +  D        H ARVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  558  PTSPATDNPD--------HSARVIKVVPHNPRSATESAARIFQSIQEERKQ  600



>ref|XP_009629366.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009629367.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=650

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 123/171 (72%), Gaps = 13/171 (8%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQGMG PFAPP GHGYFP Y MPVMN  +S+S VE+ N FT  G Q Q+SGG  N N+QH
Sbjct  485  YQGMGVPFAPPTGHGYFPHYSMPVMNPPISSSTVEESNQFTSPGFQRQLSGGVDNFNIQH  544

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            Q+S N PS+KNG  +V D  R  A +DNE+QAS ASSPS RA    VS   +GR++L LF
Sbjct  545  QDSSNGPSEKNG--NVPDVLRFQATRDNELQASTASSPSERA---AVSNATQGRNMLSLF  599

Query  333  PTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP      A+  PD  H ARVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  600  PTSP------ATDNPD--HSARVIKVVPHNPRSATESAARIFQSIQEERKQ  642



>ref|XP_009782254.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
sylvestris]
Length=598

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 121/171 (71%), Gaps = 15/171 (9%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQG G PFAPP GHGYFP YGMPVMN  +S+S VE+ N FT  G Q Q+SGG  N N+QH
Sbjct  435  YQGTGVPFAPPTGHGYFPHYGMPVMNLPISSSTVEESNQFTSPGFQRQLSGGIDNFNIQH  494

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            Q+S N+PS+KNG  +V D  R  A +DNE+QAS ASSPS RA   T     +GR++L LF
Sbjct  495  QDSSNVPSEKNG--NVPDVLRFQATRDNELQASTASSPSERAADTT-----QGRNMLSLF  547

Query  333  PTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP  +        +T H ARVI+VVPHN RSA+ SAARIFQSIQ+ERKQ
Sbjct  548  PTSPATD--------NTDHSARVIKVVPHNPRSATASAARIFQSIQEERKQ  590



>ref|XP_009782253.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
sylvestris]
Length=640

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 121/171 (71%), Gaps = 15/171 (9%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQG G PFAPP GHGYFP YGMPVMN  +S+S VE+ N FT  G Q Q+SGG  N N+QH
Sbjct  477  YQGTGVPFAPPTGHGYFPHYGMPVMNLPISSSTVEESNQFTSPGFQRQLSGGIDNFNIQH  536

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            Q+S N+PS+KNG  +V D  R  A +DNE+QAS ASSPS RA   T     +GR++L LF
Sbjct  537  QDSSNVPSEKNG--NVPDVLRFQATRDNELQASTASSPSERAADTT-----QGRNMLSLF  589

Query  333  PTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP  +        +T H ARVI+VVPHN RSA+ SAARIFQSIQ+ERKQ
Sbjct  590  PTSPATD--------NTDHSARVIKVVPHNPRSATASAARIFQSIQEERKQ  632



>ref|XP_007012227.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
 gb|EOY29846.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
Length=714

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 121/175 (69%), Gaps = 7/175 (4%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNL  526
            +QG+G  P APP+GH YFPPYGMPVMN AVS SAVEQMN F   GS A   Q SGGG N 
Sbjct  539  HQGIGVLPGAPPVGHSYFPPYGMPVMNPAVSGSAVEQMNQFAGPGSYAHNGQFSGGGANF  598

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            N+QHQNSCN+PS+KNG   +S   +  A KD E+Q S ASSP  R          EG++ 
Sbjct  599  NMQHQNSCNLPSEKNG--AISHVMKFQASKDTELQGSTASSPGERVQRDGTRSAAEGKNA  656

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LPLF T+P + +  A QP D+    RVIRVVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  657  LPLFRTAPTI-LEGAPQPHDSEQTTRVIRVVPHNPRSATESAARIFQSIQEERKQ  710



>ref|XP_009594922.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=639

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 113/171 (66%), Gaps = 3/171 (2%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQ MG PFAPP GHGYFPP+GM VMN  + + A++Q +    T SQ Q S G  N N+QH
Sbjct  471  YQRMGAPFAPPTGHGYFPPFGMSVMNPVIPSPAIDQPDQIAETSSQGQFSEGRANFNIQH  530

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            QNS N+ S+ N    + D  RL+  +D+E+QAS ASSPS R+  V V     GR V PLF
Sbjct  531  QNSSNVASENN--VTMPDV-RLYLSRDSELQASTASSPSERSRRVDVVNSTGGRIVFPLF  587

Query  333  PTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP  N     Q      P +VI+VVPHNARSA+ESAARIFQSIQ+ERKQ
Sbjct  588  PTSPASNPDLKRQQHFPSSPTKVIKVVPHNARSATESAARIFQSIQEERKQ  638



>ref|XP_009594920.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=654

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 113/171 (66%), Gaps = 3/171 (2%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQ MG PFAPP GHGYFPP+GM VMN  + + A++Q +    T SQ Q S G  N N+QH
Sbjct  486  YQRMGAPFAPPTGHGYFPPFGMSVMNPVIPSPAIDQPDQIAETSSQGQFSEGRANFNIQH  545

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            QNS N+ S+ N    + D  RL+  +D+E+QAS ASSPS R+  V V     GR V PLF
Sbjct  546  QNSSNVASENN--VTMPDV-RLYLSRDSELQASTASSPSERSRRVDVVNSTGGRIVFPLF  602

Query  333  PTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP  N     Q      P +VI+VVPHNARSA+ESAARIFQSIQ+ERKQ
Sbjct  603  PTSPASNPDLKRQQHFPSSPTKVIKVVPHNARSATESAARIFQSIQEERKQ  653



>ref|XP_006355312.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=656

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 116/172 (67%), Gaps = 7/172 (4%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQGMG PFAPP GHGYF  YGMPVMN  +S+ A E+ N FT  G Q Q+SG   N N+QH
Sbjct  483  YQGMGVPFAPPTGHGYFRQYGMPVMNPPISSPATEESNQFTLPGLQQQLSGVVDNFNIQH  542

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            Q+S N+ ++KN   +  D  R    KDNE+QAS ASSP  R    +      GR++L LF
Sbjct  543  QDSSNVLNEKND--NFPDVVRFQTTKDNELQASTASSPIERTHETSTG----GRNMLSLF  596

Query  333  PTSPVVNIVDAS-QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSPV +  D S Q     +PARVI+VVPHNARSA+ES ARIFQSIQ+ERKQ
Sbjct  597  PTSPVTDNRDGSPQACVPDNPARVIKVVPHNARSATESVARIFQSIQQERKQ  648



>gb|KDP34132.1| hypothetical protein JCGZ_07703 [Jatropha curcas]
Length=718

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 115/173 (66%), Gaps = 9/173 (5%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGGGVNLN  523
            +QG G  F P + HGYFPPYGMPVM+ A+S SAVEQMN F     TG   QVSGGG N N
Sbjct  547  HQGTG--FIPGV-HGYFPPYGMPVMHPAMSGSAVEQMNYFAGAGSTGQTGQVSGGGANFN  603

Query  522  VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
            VQHQ+SCN+P+QK+G   V    +  A KD E++ S ASSP  R  GV      EGR  L
Sbjct  604  VQHQSSCNLPNQKSGS--VPQVPKFRASKDTELRGSTASSPGERVQGVGTVEAAEGRDAL  661

Query  342  PLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
             LFP +P      ASQP +T  P RVI+VVPHN RSA+ESAARIF+SIQ ERK
Sbjct  662  LLFPVAPAT-PEGASQPQETDMPTRVIKVVPHNPRSATESAARIFKSIQAERK  713



>emb|CBI20609.3| unnamed protein product [Vitis vinifera]
Length=671

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 111/176 (63%), Gaps = 8/176 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNS-AVSTSAVEQMNSFTRTGS---QAQVSGGGVN  529
            +QG+G  P  PPIGHGYFPPYGM VMN   +S SAVEQMN F   GS     Q+SGGG +
Sbjct  495  HQGIGVHPGTPPIGHGYFPPYGMSVMNHPTISGSAVEQMNRFAGHGSLSQSGQLSGGGAS  554

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
             N+QHQNSCN+P+ K     +    +    KD+E Q S ASSPS R   V      EGR 
Sbjct  555  FNMQHQNSCNVPTPKRA---IPQGVKFPMSKDSEFQGSTASSPSEREQQVGTGDTAEGRD  611

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             LPLFP +P        QP  T  P RVIRVVPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  612  PLPLFPMAPAAIPAGDPQPNGTDQPTRVIRVVPHNPRSATESAARIFQSIQDERKQ  667



>ref|XP_002278577.1| PREDICTED: protein EARLY FLOWERING 3 [Vitis vinifera]
 ref|XP_010648311.1| PREDICTED: protein EARLY FLOWERING 3 [Vitis vinifera]
Length=725

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 111/176 (63%), Gaps = 8/176 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNS-AVSTSAVEQMNSFTRTGS---QAQVSGGGVN  529
            +QG+G  P  PPIGHGYFPPYGM VMN   +S SAVEQMN F   GS     Q+SGGG +
Sbjct  549  HQGIGVHPGTPPIGHGYFPPYGMSVMNHPTISGSAVEQMNRFAGHGSLSQSGQLSGGGAS  608

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
             N+QHQNSCN+P+ K     +    +    KD+E Q S ASSPS R   V      EGR 
Sbjct  609  FNMQHQNSCNVPTPKRA---IPQGVKFPMSKDSEFQGSTASSPSEREQQVGTGDTAEGRD  665

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             LPLFP +P        QP  T  P RVIRVVPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  666  PLPLFPMAPAAIPAGDPQPNGTDQPTRVIRVVPHNPRSATESAARIFQSIQDERKQ  721



>ref|XP_004253100.1| PREDICTED: protein EARLY FLOWERING 3 [Solanum lycopersicum]
Length=722

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 120/172 (70%), Gaps = 4/172 (2%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQG+  PF PP GH YFP YG+P +N A+S+SAV+Q + F   G Q Q+SGGG N +VQ 
Sbjct  548  YQGVRMPFTPPAGHNYFPSYGIPAINPAISSSAVDQSSLFVAQGLQGQLSGGGANFSVQR  607

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            QNS NMPS KNG        +  +C+D E+QAS ASSPS  A  +TV    E R+VLPLF
Sbjct  608  QNSSNMPSNKNG---TFPEVKSRSCRDAEMQASTASSPSGTANKITVDNATERRNVLPLF  664

Query  333  PTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP    +D +SQP    H ARVI+VVP NARSA+ESAARIFQSIQ+ERKQ
Sbjct  665  PTSPATKNLDISSQPQLPSHHARVIKVVPRNARSATESAARIFQSIQEERKQ  716



>ref|XP_006342510.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=719

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 120/172 (70%), Gaps = 6/172 (3%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQG+  PFAPP GH YFP YGMP +N A+S+S V+Q + F   G Q Q+SGGG N +VQ 
Sbjct  547  YQGVRMPFAPPAGHNYFPSYGMPAINPAISSSPVDQSSQFVAQGLQGQLSGGGANFSVQR  606

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            QNS NMPS KNG  DV    + H+ +D E+QAS ASSPS  A  + V    E R+VLPLF
Sbjct  607  QNSSNMPSNKNG-TDV----KSHSYRDAEMQASTASSPSGTANKIIVDNATERRNVLPLF  661

Query  333  PTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PTSP     D +SQP    H ARVI+VVP NARSA+ESAARIFQSIQ+ERKQ
Sbjct  662  PTSPATKNPDISSQPQVPSHHARVIKVVPRNARSATESAARIFQSIQEERKQ  713



>emb|CAN70608.1| hypothetical protein VITISV_040198 [Vitis vinifera]
Length=1138

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 112/176 (64%), Gaps = 8/176 (5%)
 Frame = -2

Query  693   YQGMG-DPFAPPIGHGYFPPYGMPVMNS-AVSTSAVEQMNSFTRTGSQAQ---VSGGGVN  529
             +QG+G  P  PPIGHGYFPPYGM VMN   +S SAVEQMN F   GS +Q   +SGGG +
Sbjct  962   HQGIGVHPGTPPIGHGYFPPYGMSVMNHPTISGSAVEQMNRFAGHGSLSQSGQLSGGGAS  1021

Query  528   LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
              N+QHQNSCN+P+ K     +    +    KD+E Q S ASSPS R   V      EGR 
Sbjct  1022  FNMQHQNSCNVPTPKRA---IPQGVKFPMSKDSEFQGSTASSPSEREQQVGTGDTAEGRD  1078

Query  348   VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
              LPLFP +P        QP  T  P RVIRVVPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  1079  PLPLFPMAPAAIPAGDPQPNGTDQPTRVIRVVPHNPRSATESAARIFQSIQDERKQ  1134



>ref|XP_008220435.1| PREDICTED: protein EARLY FLOWERING 3 [Prunus mume]
Length=731

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV---SGGGVNL  526
            +QG G  P  PP+GH YFPPYGM VMN A+ +S VEQM+ F   GS  Q+   SGGG N 
Sbjct  557  HQGTGVLPVPPPLGHTYFPPYGMSVMNPAMPSSGVEQMHWFAGPGSHGQIDQLSGGGTNS  616

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            NVQHQ+SCNMPSQK+G   +  A    A  D+E+Q S  +SP  RA  +      EG   
Sbjct  617  NVQHQSSCNMPSQKSGA--IPHAMMFQASNDSELQGSTTNSPGDRA-RLGTDRNAEGSDA  673

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            L LFP SPV+     +QP D+G P R IRVVPHN R+A+ SAARIFQSIQ+ERKQ
Sbjct  674  LQLFPMSPVIP-GGVAQPHDSGQPTRAIRVVPHNPRTATASAARIFQSIQEERKQ  727



>ref|XP_004245125.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum lycopersicum]
Length=644

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 114/170 (67%), Gaps = 13/170 (8%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            YQGMG PFAPP GHGYF  YGMP MN  +S++A E+ N +T  G Q Q SG   ++N+QH
Sbjct  483  YQGMGVPFAPPTGHGYFRQYGMPAMNPPISSTASEESNQYTMPGLQHQFSGVVDDVNIQH  542

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            Q+S N+ +QK    +V D  R  + KDNE+QAS ASSP   A          GR++L LF
Sbjct  543  QDSSNVLNQKK--ENVPDVVRYQSTKDNEVQASSASSPIETA----------GRNMLSLF  590

Query  333  PTSPVVNIVDAS-QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  187
            PTSPV +  D S Q     +PARVI+VVPHNARSA+ES ARIFQSIQ+ER
Sbjct  591  PTSPVTDNRDGSPQACVPDNPARVIKVVPHNARSATESVARIFQSIQQER  640



>ref|XP_007221988.1| hypothetical protein PRUPE_ppa002858mg [Prunus persica]
 gb|EMJ23187.1| hypothetical protein PRUPE_ppa002858mg [Prunus persica]
Length=626

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV---SGGGVNL  526
            +QG G  P  PP+GH YFPPYGM VMN A+ +S +EQM+ F   GS  Q+   SGGG N 
Sbjct  452  HQGTGVLPAPPPLGHTYFPPYGMSVMNPAMPSSGIEQMHWFAGPGSHGQIDQLSGGGTNS  511

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            NVQHQ+SCNMPSQK+G   +  A    A  D+E+Q S A+SP   A  +      EG   
Sbjct  512  NVQHQSSCNMPSQKSGA--IPHAMMFQASNDSELQGSTANSPGDTA-RLGTDQNAEGSDA  568

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            L LFP +PV+     +QP D+G P R IRVVPHN R+A+ SAARIFQSIQ+ERKQ
Sbjct  569  LQLFPMAPVIP-EGVAQPHDSGQPTRAIRVVPHNPRTATASAARIFQSIQEERKQ  622



>ref|XP_006340248.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=609

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 108/168 (64%), Gaps = 3/168 (2%)
 Frame = -2

Query  681  GDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSC  502
            G PFAPP GHGYF P+GMPVMN A+ + A  Q N    + S+ Q+SGG  + N+QHQNS 
Sbjct  443  GLPFAPPTGHGYFRPFGMPVMNPAIPSPAQYQSNQVAASHSKGQLSGGRASFNIQHQNSS  502

Query  501  NMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  322
            N  S+ +G   + +  RL+  +D+E+QAS ASSPS R   V +     GRS    FPTSP
Sbjct  503  NAGSENDG--TMPEGVRLYPSRDSELQASTASSPSERIRAVDMGNSTRGRSAFHHFPTSP  560

Query  321  VV-NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             V N V   QP     PAR I+V PHNARSA+ES ARIFQSIQ ERKQ
Sbjct  561  AVDNPVLRPQPHFPLRPARAIKVTPHNARSATESVARIFQSIQDERKQ  608



>gb|AIN75607.1| EARLY FLOWERING 3 [Dimocarpus longan]
Length=726

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 111/175 (63%), Gaps = 7/175 (4%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNL  526
            +QG+G  P A P+GHGYFPPYGMP+MN +VS+SA EQ N     GS  Q   +SGGG N 
Sbjct  551  HQGIGAMPGAHPVGHGYFPPYGMPIMNQSVSSSAAEQKNQSAGPGSLLQNGLLSGGGANF  610

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            NVQH++SCN+P+QK G   +  A +  A KD ++Q S ASS   R          EG+  
Sbjct  611  NVQHESSCNVPTQKKGA--IPQAMQFQASKDMDVQGSTASSTGERMQHDETGATAEGQEA  668

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             P F  +  V    A QP DT  P RVIRVVPHN RSA+ES ARIFQSIQ+ERKQ
Sbjct  669  QPHFSMA-SVPPQGAPQPQDTEQPTRVIRVVPHNPRSATESVARIFQSIQEERKQ  722



>gb|KJB07440.1| hypothetical protein B456_001G024100 [Gossypium raimondii]
Length=594

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 110/175 (63%), Gaps = 7/175 (4%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNL  526
            +QG+G  P  P  GH YFPPYGMPVMN A S SA+EQM  F   GS AQ   +SG G N 
Sbjct  421  HQGLGALPGTPLGGHSYFPPYGMPVMNPAFSGSAMEQMTQFAGVGSHAQSVQLSGSGANF  480

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            N+Q Q+S N+P++KNG   +    +  A KD E Q   ASSPS R          EG++ 
Sbjct  481  NMQQQSSSNLPNEKNGA--IPPVTKYQASKDAEQQRCNASSPSERTEKDGTRSTSEGKNT  538

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
              L PT+P  N+  A +P +T    RVIRVVPHN RSA+ESAARIFQSIQKERKQ
Sbjct  539  PSLLPTAPA-NLEGALKPRETDQRTRVIRVVPHNPRSATESAARIFQSIQKERKQ  592



>gb|KJB07439.1| hypothetical protein B456_001G024100 [Gossypium raimondii]
Length=704

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 110/175 (63%), Gaps = 7/175 (4%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNL  526
            +QG+G  P  P  GH YFPPYGMPVMN A S SA+EQM  F   GS AQ   +SG G N 
Sbjct  531  HQGLGALPGTPLGGHSYFPPYGMPVMNPAFSGSAMEQMTQFAGVGSHAQSVQLSGSGANF  590

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            N+Q Q+S N+P++KNG   +    +  A KD E Q   ASSPS R          EG++ 
Sbjct  591  NMQQQSSSNLPNEKNGA--IPPVTKYQASKDAEQQRCNASSPSERTEKDGTRSTSEGKNT  648

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
              L PT+P  N+  A +P +T    RVIRVVPHN RSA+ESAARIFQSIQKERKQ
Sbjct  649  PSLLPTAPA-NLEGALKPRETDQRTRVIRVVPHNPRSATESAARIFQSIQKERKQ  702



>ref|XP_008377913.1| PREDICTED: protein EARLY FLOWERING 3-like, partial [Malus domestica]
Length=435

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNL  526
            +QGMG  P  P +GH YFPPYGM VMN A+STSAVEQM+ F   GS     Q SGGG N 
Sbjct  261  HQGMGVLPVPPSLGHTYFPPYGMSVMNPAMSTSAVEQMHWFAGPGSHGHTDQSSGGGTNS  320

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            N+QHQ+SCNMPS+KN    +  A +     D+ +Q S A+S   RAP V  +   EG   
Sbjct  321  NLQHQSSCNMPSRKN--VTIPHAKKFQPSNDSGLQGSTANSTGDRAP-VRTNQNAEGSDA  377

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            L L P  PV+      Q  DT  P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  378  LQLLPMVPVIPD-GVPQSHDTDQPTRAIKVVPHNPRTATASAARIFQSIQAERKQ  431



>ref|XP_009784952.1| PREDICTED: protein EARLY FLOWERING 3-like [Nicotiana sylvestris]
Length=650

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 110/173 (64%), Gaps = 4/173 (2%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS-GGGVNLNVQ  517
            YQG G PFAP   HGYFPP+ MPVMN  + + A++Q +    TG Q  +S    VN ++Q
Sbjct  479  YQGTGAPFAPQPSHGYFPPFDMPVMNPVIPSPAIDQPDQVAATGFQGLLSRDQEVNFHIQ  538

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
             QNS N+  + N  A      RL+  +D+E+QAS ASSP  R  G+ V     GRSV PL
Sbjct  539  QQNSSNVARENNVAA--PKVVRLYPSRDSELQASTASSPRERGHGLDVGNSTGGRSVFPL  596

Query  336  FPTSPVV-NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            FPT P + N   +SQP    H ARVI+VVP NA +A+ESAARIFQSIQ+ERKQ
Sbjct  597  FPTFPAISNPASSSQPHFPSHTARVIKVVPRNASAATESAARIFQSIQEERKQ  649



>ref|XP_010049159.1| PREDICTED: protein EARLY FLOWERING 3 [Eucalyptus grandis]
 gb|KCW81636.1| hypothetical protein EUGRSUZ_C02997 [Eucalyptus grandis]
Length=698

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 115/177 (65%), Gaps = 12/177 (7%)
 Frame = -2

Query  693  YQGMGDPFA-PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR---TGSQAQVSGGGVNL  526
            +QG G P   PP GH YFP YGMPVM+  VS S+VEQ N F+R    G   Q+SGG VN 
Sbjct  524  HQGFGFPSGVPPPGHSYFPTYGMPVMSFNVSGSSVEQTNRFSRPVQYGQTGQLSGGEVN-  582

Query  525  NVQHQNSCNMPSQKNGD-ADVSDAHRLHACKDNEIQASCASSPSVRAP-GVTVSGPMEGR  352
            N+QHQNS N+P Q+ G  A +    +  A KD+E+Q S ASSPS + P G+      +G+
Sbjct  583  NLQHQNSSNLPKQRKGSVAQI----KFQANKDSELQVSTASSPSEKPPEGLGNVQSSDGK  638

Query  351  SVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
              LPLFP +P V+    SQ  +   P RVIR VPHNARSA+ES ARIF+SIQ+ERKQ
Sbjct  639  EALPLFPVAPAVS-EGGSQLREAEQPTRVIRSVPHNARSATESVARIFRSIQEERKQ  694



>ref|XP_006450775.1| hypothetical protein CICLE_v10007592mg [Citrus clementina]
 gb|ESR64015.1| hypothetical protein CICLE_v10007592mg [Citrus clementina]
Length=723

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 103/165 (62%), Gaps = 3/165 (2%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P A  +GHGYFPPYGMPVMN +VS SA EQ N F   GS+ Q S G  N  +  ++SCN+
Sbjct  558  PGAHLVGHGYFPPYGMPVMNPSVSGSAAEQKNQFAVPGSRDQFSQGDANFYMPQESSCNV  617

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
            P+QKNG   V    +  A KD E+Q S ASSP  R  G  +    EG   L L   SPVV
Sbjct  618  PAQKNG--AVPPVRQFQASKDTELQGSTASSPGERVRGDGMGHAAEGTDALQLSTVSPVV  675

Query  315  NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                A QP D   P +VI+VVPHN RSA+ES ARIFQSIQ+ERKQ
Sbjct  676  QEA-APQPHDADQPTKVIKVVPHNPRSATESVARIFQSIQEERKQ  719



>ref|XP_008357349.1| PREDICTED: protein EARLY FLOWERING 3-like [Malus domestica]
Length=674

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNL  526
            +QGMG  P  P +GH YFPPYGM VMN A+STSAVEQM+ F   GS     Q SGGG N 
Sbjct  500  HQGMGVLPVPPSLGHTYFPPYGMSVMNPAMSTSAVEQMHWFAGPGSHGHTDQSSGGGTNS  559

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            N+QHQ+SCNMPS+KN    +  A +     D+ +Q S A+S   RAP V  +   EG   
Sbjct  560  NLQHQSSCNMPSRKN--VTIPHAKKFQPSNDSGLQGSTANSTGDRAP-VRTNQNAEGSDA  616

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            L L P  PV+      Q  DT  P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  617  LQLLPMVPVIPD-GVPQSHDTDQPTRAIKVVPHNPRTATASAARIFQSIQAERKQ  670



>gb|KDO79979.1| hypothetical protein CISIN_1g004928mg [Citrus sinensis]
Length=723

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 103/165 (62%), Gaps = 3/165 (2%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P A  +GHGYFPPYGMPVMN +VS SA EQ N F   GS+ Q S G  N  +  ++SCN+
Sbjct  558  PGAHLVGHGYFPPYGMPVMNPSVSGSAAEQKNQFAVPGSRDQFSQGDANFYMPQESSCNV  617

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
            P+QKNG   V    +  A KD E+Q S ASSP  R  G  +    EG   L +   SPVV
Sbjct  618  PAQKNG--AVPPVRQFQASKDTELQGSTASSPGERVRGDGMGHAAEGTDALQVSTVSPVV  675

Query  315  NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                A QP D   P +VI+VVPHN RSA+ES ARIFQSIQ+ERKQ
Sbjct  676  QEA-APQPHDADQPTKVIKVVPHNPRSATESVARIFQSIQEERKQ  719



>ref|XP_006475975.1| PREDICTED: protein EARLY FLOWERING 3-like [Citrus sinensis]
Length=723

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 103/165 (62%), Gaps = 3/165 (2%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P A  +GHGYFPPYGMPVMN +VS SA EQ N F   GS+ Q S G  N  +  ++SCN+
Sbjct  558  PGAHLVGHGYFPPYGMPVMNPSVSGSAAEQKNQFAVPGSRDQFSQGDANFYMPQESSCNV  617

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
            P+QKNG   V    +  A KD E+Q S ASSP  R  G  +    EG   L +   SPVV
Sbjct  618  PAQKNG--AVPPVRQFQASKDTELQGSTASSPGERVRGDGMGHAAEGTDALQVSTVSPVV  675

Query  315  NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                A QP D   P +VI+VVPHN RSA+ES ARIFQSIQ+ERKQ
Sbjct  676  QEA-APQPHDADQPTKVIKVVPHNPRSATESVARIFQSIQEERKQ  719



>ref|XP_009337143.1| PREDICTED: protein EARLY FLOWERING 3-like [Pyrus x bretschneideri]
Length=674

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 108/175 (62%), Gaps = 8/175 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNL  526
            +QGMG  P  P +GH YFPPYGM VMN A+STS VEQM+ F   GS     Q SGGG N 
Sbjct  500  HQGMGVLPVPPSLGHTYFPPYGMSVMNPAMSTSPVEQMHWFAGPGSHGHTDQSSGGGTNS  559

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            N+QHQ+SCNMPS+KN    +  A +     D+ +Q S A+S   RAP V  +   EG   
Sbjct  560  NLQHQSSCNMPSRKN--VTIPHAKKFQPSNDSGLQGSTANSTGDRAP-VRTNQNAEGSDA  616

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            L L P  PV+      Q  DT  P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  617  LQLLPMVPVIPD-GVPQSHDTDQPTRAIKVVPHNPRTATASAARIFQSIQAERKQ  670



>ref|XP_002516480.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45821.1| conserved hypothetical protein [Ricinus communis]
Length=720

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 114/172 (66%), Gaps = 10/172 (6%)
 Frame = -2

Query  693  YQG-MGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  517
            +QG M  P  P +GHGYFPPYGMP+M+S +  SAVEQMN + + G   Q+SGGG N+ VQ
Sbjct  554  HQGTMPMPGVPALGHGYFPPYGMPIMSSTMPGSAVEQMNYYGQAG---QLSGGGANIVVQ  610

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
            H    ++  QK+G   +   ++  A KD E++ S ASSPS R  G   +   E R  LPL
Sbjct  611  H---PSLQLQKSGS--IPRVNKPRASKDTELRGSTASSPSERVQGAGNAQAAETRDPLPL  665

Query  336  FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            FPT+P+  +  A+QP  T  P  VI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  666  FPTAPIA-LEGATQPQLTNQPRGVIKVVPHNRRSATESAARIFQSIQEERKQ  716



>emb|CDP08210.1| unnamed protein product [Coffea canephora]
Length=713

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 110/177 (62%), Gaps = 8/177 (5%)
 Frame = -2

Query  693  YQGMGD--PFAPPIG-HGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLN  523
            YQ MG   PFA P G  GYFPPYGM V+N  ++ SA EQMN     G   Q    G N +
Sbjct  535  YQAMGGVPPFAAPAGPQGYFPPYGMAVLNQGITGSAGEQMNHLAVPGPYGQSPRLGPNYD  594

Query  522  VQHQNSCNMPSQKNGDADVSDA-HRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            +Q QNS N+P+QK+G   + DA  +LHA +++E+Q S ASSPS R  G       E   V
Sbjct  595  IQRQNSGNVPNQKSG--AIPDAVQQLHASRESELQISTASSPSERVQGSGRGNAAERGDV  652

Query  345  LPLFPTSPVVNIVDA--SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LPLFPT+PVV        QP +    ARVI+VVPHN R A+ES ARIFQSIQ+ERKQ
Sbjct  653  LPLFPTTPVVEAPSGHVQQPQEVSSSARVIKVVPHNGRLATESVARIFQSIQEERKQ  709



>ref|XP_010097101.1| hypothetical protein L484_019540 [Morus notabilis]
 gb|EXB66902.1| hypothetical protein L484_019540 [Morus notabilis]
Length=727

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 111/175 (63%), Gaps = 8/175 (5%)
 Frame = -2

Query  690  QGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS---GGGVNLN  523
            QG G  P   P+ H YF PYGMPV+N A S S VEQ N F R   Q+Q     GGGVNL+
Sbjct  552  QGFGVHPGTSPVCHTYFHPYGMPVINPATSGSTVEQANPFVRPDPQSQTGPALGGGVNLS  611

Query  522  VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
            ++ Q+ C++P+QKNG   VS A +L A + N++  S  SSP  RA GV +    E R  L
Sbjct  612  MEQQSFCHVPTQKNGS--VSQATKLQASERNDLHGSTGSSPGERANGVGILHNAEERDPL  669

Query  342  PL-FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PL FP +PVV    A+   D   P RVI+VVPHN RSA+ESAARIF+ IQ+ERKQ
Sbjct  670  PLLFPMAPVV-PEGATDSQDANQPTRVIKVVPHNPRSATESAARIFRFIQEERKQ  723



>ref|XP_008351957.1| PREDICTED: protein EARLY FLOWERING 3-like [Malus domestica]
Length=713

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 106/176 (60%), Gaps = 9/176 (5%)
 Frame = -2

Query  693  YQGMGDPFAPPI--GHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVSGGGVN  529
             QGMG    PP   GH YFPPYGM VMN  + +SAVEQM+ F      G   Q  GGG N
Sbjct  538  LQGMGVLPVPPSLSGHTYFPPYGMSVMNPGMPSSAVEQMHWFAGPVSHGHTNQSXGGGAN  597

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
             N+QHQ+SCNMPSQKN    +  A RL    D+ +Q S A++   RAP  T   P EG  
Sbjct  598  SNLQHQSSCNMPSQKN--VTIPHAKRLQPSNDSGLQGSTANNTGDRAPMRTDQNP-EGSD  654

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             L LFP + V+      Q  DTG P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  655  ALQLFPMAXVIPD-GVPQSSDTGQPTRAIKVVPHNPRTATASAARIFQSIQAERKQ  709



>ref|XP_008393666.1| PREDICTED: protein EARLY FLOWERING 3 [Malus domestica]
Length=713

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 106/176 (60%), Gaps = 9/176 (5%)
 Frame = -2

Query  693  YQGMGDPFAPPI--GHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVSGGGVN  529
             QGMG    PP   GH YFPPYGM VMN  + +SAVEQM+ F      G   Q  GGG N
Sbjct  538  LQGMGVLPVPPSLSGHTYFPPYGMSVMNPGMPSSAVEQMHWFAGPVSHGHTNQSXGGGAN  597

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
             N+QHQ+SCNMPSQKN    +  A RL    D+ +Q S A++   RAP  T   P EG  
Sbjct  598  SNLQHQSSCNMPSQKN--VTIPHAKRLQPSNDSGLQGSTANNTGDRAPMRTDQNP-EGSD  654

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             L LFP + V+      Q  DTG P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  655  ALQLFPMAXVIPD-GVPQSSDTGQPTRAIKVVPHNPRTATASAARIFQSIQAERKQ  709



>ref|XP_004251173.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum lycopersicum]
Length=603

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 104/168 (62%), Gaps = 3/168 (2%)
 Frame = -2

Query  681  GDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSC  502
            G PFAPP GHGYF P+GMPV N A+ +    Q N    + S+ Q+SGG  + N+QH NS 
Sbjct  437  GLPFAPPTGHGYFRPFGMPVTNPAIPSPTQNQSNQVVASHSKGQLSGGRASFNIQHPNSS  496

Query  501  NMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP  322
            N+ S+ +G   + +  RL+  +D+E+ AS A SPS     V +     GRS    FPTSP
Sbjct  497  NVGSESDG--TLPEVVRLYPSRDSELHASTAGSPSEITRAVDMGNSTRGRSAFHHFPTSP  554

Query  321  VV-NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             V N +   QP     PAR I+ +PHNARSA+ES ARIFQSIQ+ERKQ
Sbjct  555  AVDNPILRPQPHFPERPARAIKAIPHNARSATESVARIFQSIQEERKQ  602



>ref|XP_009361544.1| PREDICTED: protein EARLY FLOWERING 3-like [Pyrus x bretschneideri]
Length=701

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 108/176 (61%), Gaps = 10/176 (6%)
 Frame = -2

Query  693  YQGMGDPFAPPI--GHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVSGGGVN  529
             QGMG    PP   GH YFPPYGM VMN A+ +SAVEQM+ F      G   Q SGGG N
Sbjct  527  LQGMGVLPVPPSLNGHTYFPPYGMSVMNPAMPSSAVEQMHWFAGPVSHGHTDQSSGGGAN  586

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
             N+QHQ+SCNMP QKN    + +A RL    D+ +Q S A++   RAP  T   P EG  
Sbjct  587  SNLQHQSSCNMP-QKN--VTIPNAKRLQPSNDSGLQGSTANNTGDRAPMRTDQNP-EGSD  642

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             L LFP +PV+      Q  D G P R I+VVPHN R+A+ SAARIFQSIQ ERKQ
Sbjct  643  ALQLFPMAPVIPD-GVPQSHDIGQPMRAIKVVPHNPRTATASAARIFQSIQAERKQ  697



>gb|KJB07438.1| hypothetical protein B456_001G024000 [Gossypium raimondii]
Length=705

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNL  526
            +QG+G  P  P +GH YFP +GMPVMN A S S++EQMN F   GS AQ   +SG G N 
Sbjct  533  HQGLGVLPGTPLVGHSYFPHHGMPVMNPAFSGSSMEQMNQFAGAGSHAQSGQLSGNGANF  592

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
            N+Q Q+S N+PS+KN    +    +  A KD E Q   ASSP  RA         EG++ 
Sbjct  593  NMQQQSSSNLPSKKN--VAIPPVVKFQASKDTEQQRCTASSPGERAEKNRTCNTAEGKNT  650

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             PL  T+P  N   A +P +T    RVIRVVPHN RSA+ESAARIFQSIQKERK+
Sbjct  651  -PLILTAPA-NPQGALKPNETDQRTRVIRVVPHNPRSATESAARIFQSIQKERKR  703



>gb|KHN29734.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=714

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 107/176 (61%), Gaps = 8/176 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS----GGGVN  529
            +QG+G  P   P  HGY PPYGMPVMNS++S S VEQ N F+  GS         GG  N
Sbjct  538  HQGVGVPPDTHPGSHGYLPPYGMPVMNSSMSESVVEQGNQFSALGSHGHNGHLPGGGKAN  597

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
             N  +++SCN+P Q+NG   +S   +    KD E+Q + ASSPS  A G++     EGR 
Sbjct  598  HNTNNKSSCNLPVQRNGA--ISHVLKHQTSKDFELQETSASSPSEMAQGLSTGQVAEGRD  655

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            VLPLFP  P        Q  +TG   RVI+VVPHN RSA+ SAARIFQSIQ+ RKQ
Sbjct  656  VLPLFPMVPA-EPESVPQSLETGQHTRVIKVVPHNRRSATASAARIFQSIQEGRKQ  710



>ref|XP_003523640.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006578075.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
 gb|ACJ61495.1| early flowering 3 [Glycine max]
Length=714

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 107/176 (61%), Gaps = 8/176 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVS----GGGVN  529
            +QG+G  P   P  HGY PPYGMPVMNS++S S VEQ N F+  GS         GG  N
Sbjct  538  HQGVGVPPDTHPGSHGYLPPYGMPVMNSSMSESVVEQGNQFSALGSHGHNGHLPGGGKAN  597

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
             N  +++SCN+P Q+NG   +S   +    KD E+Q + ASSPS  A G++     EGR 
Sbjct  598  HNTNNKSSCNLPVQRNGA--ISHVLKHQTSKDFELQETSASSPSEMAQGLSTGQVAEGRD  655

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            VLPLFP  P        Q  +TG   RVI+VVPHN RSA+ SAARIFQSIQ+ RKQ
Sbjct  656  VLPLFPMVPA-EPESVPQSLETGQHTRVIKVVPHNRRSATASAARIFQSIQEGRKQ  710



>ref|XP_004501482.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
Length=699

 Score =   139 bits (349),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 104/166 (63%), Gaps = 4/166 (2%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYG-MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCN  499
            P  PP  H YFPPYG MPV  +AV+ SAV  +N F+  G    +S    N N  +Q  CN
Sbjct  533  PETPPGSHAYFPPYGGMPVTKAAVAESAVGHVNQFSAHGQNDHLSEVEANHNKHNQIPCN  592

Query  498  MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  319
            +P+Q+NG        + H  K+ E+Q S ASSPS  A G+++    EGR VLPLFP  P+
Sbjct  593  LPAQRNGATSHVMNRQRH--KEFELQGSTASSPSEMAQGMSIGQVSEGRDVLPLFPMVPL  650

Query  318  VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
               V   Q P+T   +RVI+VVPHN R+A+ESAARIFQSIQ+ERKQ
Sbjct  651  EPEV-VPQSPETRQQSRVIKVVPHNRRTATESAARIFQSIQEERKQ  695



>ref|XP_010097102.1| hypothetical protein L484_019541 [Morus notabilis]
 gb|EXB66903.1| hypothetical protein L484_019541 [Morus notabilis]
Length=376

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 109/164 (66%), Gaps = 9/164 (5%)
 Frame = -2

Query  663  PIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGV-NLNVQHQNSCNMPSQ  487
            P+GH Y PPYGMPV+N A+S SAVEQ+N F  T   + V G  V NLN + Q+SC++P++
Sbjct  215  PVGHTYIPPYGMPVINPAMSCSAVEQVNQFAGT---SPVPGEMVANLNTEQQSSCSVPAR  271

Query  486  KNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIV  307
            +NG    S   +  A K +E+Q S ASSP  RA GV +    + R  L LFP +PVV   
Sbjct  272  ENGSE--SQPRKFQASKGSELQGSTASSPGDRAQGVEIGHNAKVRDPLLLFPRAPVVP-E  328

Query  306  DASQPPD--TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            DASQP +     P +VI+VVPHN RSA+ESAARIF+ IQ+ERKQ
Sbjct  329  DASQPHEAAAPPPPQVIKVVPHNPRSATESAARIFRFIQEERKQ  372



>ref|XP_007024385.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
 gb|EOY27007.1| Hydroxyproline-rich glycoprotein family protein, putative [Theobroma 
cacao]
Length=774

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 106/172 (62%), Gaps = 14/172 (8%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQ  517
            QG+G  P    IG  YFP YGMPVMN +VS SAVEQM+ F     +  Q+S G VN  + 
Sbjct  613  QGIGILPGNSAIGQTYFPHYGMPVMNPSVSDSAVEQMSPFIGVQLKGNQLSTGDVNFTIA  672

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
            HQ+SCNM SQ +  A      +L A K++EIQ S ASSPS RA G            LPL
Sbjct  673  HQSSCNMSSQVS-QAISYCVGKLPASKESEIQGSTASSPSERARG----------DALPL  721

Query  336  FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            FPT P +   D +    +G   RVI+VVPHN+R A+ESAARIFQSIQ+ERKQ
Sbjct  722  FPTEPTIQASDHNAR-SSGQQTRVIKVVPHNSRLATESAARIFQSIQEERKQ  772



>ref|XP_010244364.1| PREDICTED: protein EARLY FLOWERING 3 [Nelumbo nucifera]
Length=786

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 106/175 (61%), Gaps = 6/175 (3%)
 Frame = -2

Query  690  QGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT---GSQAQVSGGGVNLN  523
            QG+G  P APP+G  YFPPYG+PV++  +S SAVEQ N    +   G   ++S G  N  
Sbjct  609  QGIGVIPGAPPVGQTYFPPYGVPVLSPGISASAVEQRNPMAGSHPNGHSERLSTGDANFK  668

Query  522  VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
            + +Q+S N  +QK+ +       +    KD+E+Q S ASSP  R+ G       EGR  L
Sbjct  669  MHYQSSYNNSNQKS-ETISCHIWKFQTSKDSELQGSTASSPCERSQGSGSGNVAEGRDAL  727

Query  342  PLFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PLFP +P V + D   +   +G   RVI+VVPHN RSA+ESA RIFQSIQKER+Q
Sbjct  728  PLFPMAPAVQVQDQVPKSHSSGQQTRVIKVVPHNRRSATESAVRIFQSIQKERQQ  782



>gb|AFZ78447.1| early flowering 3 [Lens culinaris]
Length=702

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 103/161 (64%), Gaps = 8/161 (5%)
 Frame = -2

Query  654  HGYFPPYG-MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNG  478
            H YFPPYG MPVM +A S SAVE +N F+  G   ++S    N N  +Q+SCN+P+Q+N 
Sbjct  543  HAYFPPYGGMPVMKAAASESAVEHVNQFSAHGQNHRLSEDEDNCNKHNQSSCNLPAQRNE  602

Query  477  DADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS  298
            D      H+    K+ ++Q S ASSPS  A  ++     EGR VLPLFP   +V+    S
Sbjct  603  DTSHVMYHQ--RSKEFDLQMSTASSPSEMAQEMSTGQVAEGRDVLPLFP---MVSAEPES  657

Query  297  QP--PDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             P   +TG   RVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  658  VPHSLETGQQTRVIKVVPHNRRSATESAARIFQSIQEERKQ  698



>ref|XP_004291013.1| PREDICTED: protein EARLY FLOWERING 3 [Fragaria vesca subsp. vesca]
Length=704

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 106/174 (61%), Gaps = 12/174 (7%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGGGVNLN  523
            +QGMG    P     YFPPYGM VMN  +S+SAVEQMN F      GS  Q+SG   N N
Sbjct  538  HQGMG--VLPAPHPTYFPPYGMSVMNPTMSSSAVEQMNWFAGPGLHGSTDQLSG---NSN  592

Query  522  VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
            +QHQ+SCNMP+ KN  A +  A +  A   +E+Q S A+SP  RAP VT     E    L
Sbjct  593  LQHQSSCNMPTPKN--AAIPRAMKSRASNPSELQGSTANSPGDRAPVVTDQTAGES-DAL  649

Query  342  PLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             LFPT P V      QP  T    RVIRVVPHN RSA+ SAARIFQSIQ+ERKQ
Sbjct  650  QLFPTVPAV-PERVPQPHVTNQATRVIRVVPHNPRSATASAARIFQSIQEERKQ  702



>ref|XP_003603108.1| Protein EARLY FLOWERING [Medicago truncatula]
 gb|AES73359.1| early flowering protein [Medicago truncatula]
Length=688

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 98/161 (61%), Gaps = 8/161 (5%)
 Frame = -2

Query  654  HGYFPPYG-MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNG  478
            H Y+PPYG MP M +A S S VE +N F+       +S G  + N  +Q+SCN+P Q+NG
Sbjct  529  HAYYPPYGSMPFMKAAASESVVEHVNQFSARVQSRHLSEGEADCNKHNQSSCNLPVQRNG  588

Query  477  DADVSDAHRLH--ACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVD  304
                +  H +H    K+ E+Q S ASSPS    G++     E R  LPLFP  PV     
Sbjct  589  ----ATTHVMHHQRSKEFELQMSTASSPSEMTQGMSTGQVAEERDALPLFPMVPV-EPEG  643

Query  303  ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             +Q  +TG   RVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  644  VAQSIETGQQTRVIKVVPHNRRSATESAARIFQSIQEERKQ  684



>ref|XP_004143036.1| PREDICTED: protein EARLY FLOWERING 3-like [Cucumis sativus]
 gb|KGN62407.1| hypothetical protein Csa_2G352370 [Cucumis sativus]
Length=716

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 13/179 (7%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  517
            +QG+G  P  P +G  +FPPYGMPVMN  +S  AV+Q+N +  TG   Q+SGG    N+Q
Sbjct  539  HQGIGALPTTPMVGGSFFPPYGMPVMNPGMSGFAVDQVNWY--TGDPNQLSGGVAASNIQ  596

Query  516  HQNSCNMPSQKNGDAD--VSDAHRLHACKDNEIQASCAS----SPSVRAPGVTVSGPMEG  355
            HQ S ++ +Q++ D +  VS   +  A K +E+Q S AS    SP+ +  G  V+   E 
Sbjct  597  HQTSYDVSTQRDRDENQTVSRTAKSQAPKRSEVQVSTASSPVCSPTSKVQGNKVNRTAES  656

Query  354  RSVLPLFPTS-PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             +VL LFP + P+V   +  QP D+    RVIRVVPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  657  HNVLSLFPVAQPLVE--EGPQPSDSDQ-TRVIRVVPHNRRSANESAARIFQSIQNERKQ  712



>ref|XP_004168028.1| PREDICTED: protein EARLY FLOWERING 3-like [Cucumis sativus]
Length=715

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 113/179 (63%), Gaps = 13/179 (7%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  517
            +QG+G  P  P +G  +FPPYGMPVMN  +S  AV+Q+N +  TG   Q+SGG    N+Q
Sbjct  538  HQGIGALPTTPMVGGSFFPPYGMPVMNPGMSGFAVDQVNWY--TGDPNQLSGGVAASNIQ  595

Query  516  HQNSCNMPSQKNGDAD--VSDAHRLHACKDNEIQASCAS----SPSVRAPGVTVSGPMEG  355
            HQ S ++ +Q++ D +  VS   +  A K +E+Q S AS    SP+ +  G  V+   E 
Sbjct  596  HQTSYDVSTQRDRDENQTVSRTAKSQAPKRSEVQVSTASSPVCSPTSKVQGNKVNRTAES  655

Query  354  RSVLPLFPTS-PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             +VL LFP + P+V   +  QP D+    RVIRVVPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  656  HNVLSLFPVAQPLVE--EGPQPSDSDQ-TRVIRVVPHNRRSANESAARIFQSIQNERKQ  711



>gb|KHF99548.1| Protein EARLY FLOWERING 3 -like protein [Gossypium arboreum]
Length=733

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 101/173 (58%), Gaps = 16/173 (9%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQ  517
            QG G  P  PPIG  YFP YG PV N +VS S VEQM+ FT   S   ++S G VN  + 
Sbjct  572  QGFGILPGNPPIGQTYFPHYGTPVRNPSVSGSVVEQMSPFTGVKSMGNRLSTGDVNFTIA  631

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
             Q+SCN+ SQ +         +L A K++EIQAS ASSPS R  G            LPL
Sbjct  632  QQSSCNISSQMSQAISFC-VTKLPASKESEIQASTASSPSERTKG----------DALPL  680

Query  336  FPTSPVVNIVDASQPPDT-GHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            FPT P       +   DT G   RVI+VVPHN + A+ESAARIFQSIQ+ERKQ
Sbjct  681  FPTKPTTQA--CTHKADTSGQQTRVIKVVPHNRKLATESAARIFQSIQEERKQ  731



>ref|XP_011081715.1| PREDICTED: LOW QUALITY PROTEIN: protein EARLY FLOWERING 3 [Sesamum 
indicum]
Length=694

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 105/171 (61%), Gaps = 9/171 (5%)
 Frame = -2

Query  675  PFAPPIG-HGYFPP-YGMPVMNSA-VSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNS  505
            P  PP+G HGY PP YGMP+MN+A  S S+VEQMN     G  +       N   QH N 
Sbjct  523  PSFPPVGPHGYLPPPYGMPIMNTAAFSGSSVEQMNPPATLGRFSGGEENETNFINQHHNL  582

Query  504  CNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS  325
               PSQKNG A   D +   A KD ++QAS  SSP  R  G   S  +EGR++LPLFPTS
Sbjct  583  FTSPSQKNG-AVPDDINLRRASKDIDMQASTGSSPIERRSGSQASNNLEGRNMLPLFPTS  641

Query  324  PVVNIVDASQPPDTGHP---ARVIRVVPHNARSASESAARIFQSIQKERKQ  181
              ++   ++  P    P   +RVI+V+PHNA SASESAARIF+SIQ+ERKQ
Sbjct  642  GAISASKST--PQVATPERQSRVIKVIPHNALSASESAARIFRSIQEERKQ  690



>gb|KJB56855.1| hypothetical protein B456_009G138600 [Gossypium raimondii]
Length=731

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 99/172 (58%), Gaps = 14/172 (8%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQ  517
            QG G  P  PPIG  YFP YG PV N +VS S VEQM+ FT   S   ++S G VN  + 
Sbjct  572  QGFGILPGNPPIGQTYFPHYGTPVRNPSVSGSVVEQMSPFTGVKSMGNRLSTGDVNFTIA  631

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
             Q+SCNM SQ +         +L A K++EIQAS ASSPS R  G            LPL
Sbjct  632  QQSSCNMSSQMSQAISFC-VTKLPASKESEIQASTASSPSERTKG----------DALPL  680

Query  336  FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            FPT P        +   +G   RVI+VVPHN + A+ESAARIFQSIQ+ERK 
Sbjct  681  FPTKPTTQAC-THKAETSGQQTRVIKVVPHNRKLATESAARIFQSIQEERKH  731



>gb|AFR60580.1| early flowering 3/high response [Pisum sativum subsp. sativum]
Length=702

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = -2

Query  648  YFPPYG-MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDA  472
            YFPPYG MPVM +A S SAVE +N F+  G   ++S    + N  +Q+S ++P Q+NG  
Sbjct  545  YFPPYGGMPVMKAAASESAVEHVNQFSARGQSRRLSEDEADCNKHNQSSYDLPVQRNGAT  604

Query  471  DVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP  292
                 H+    K+ E+Q S ASSPS  A  ++     EGR VLPLFP  PV         
Sbjct  605  SHVMYHQ--RSKEFEVQMSTASSPSEMAQEMSTGQVAEGRDVLPLFPMVPV-EPESVPHS  661

Query  291  PDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             +TG   RVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  662  LETGQKTRVIKVVPHNRRSATESAARIFQSIQEERKQ  698



>ref|XP_011095302.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=678

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 103/167 (62%), Gaps = 10/167 (6%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P A P  HGYFPPY MP+M   +S S+V+QMN  +  G   Q S G  N+NVQ   S  M
Sbjct  516  PLAGP--HGYFPPYSMPMM--TLSGSSVDQMNIPSIRG---QASTGEANVNVQLHKSYAM  568

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
            PS  N  A     + +H  KD E+QAS  SSP         S  +EGR++LPLFPTSP +
Sbjct  569  PS-NNNQASPEALNNVHVSKDMEVQASTESSPIDVLHDGRASSIVEGRNILPLFPTSPAI  627

Query  315  NIVDASQ--PPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +   + Q   P+     +VI+VVPHNARSA+ESAARIF+SIQ+ER+Q
Sbjct  628  DTNSSPQLPQPEPEQTTQVIKVVPHNARSATESAARIFRSIQEERRQ  674



>ref|XP_010669115.1| PREDICTED: protein EARLY FLOWERING 3 [Beta vulgaris subsp. vulgaris]
Length=709

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 106/179 (59%), Gaps = 20/179 (11%)
 Frame = -2

Query  690  QGMGDP----FAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTR---TGSQAQVSGGGV  532
            QGMG P    F    G GYFPPYGMP+M+ +VS S VEQ+N F+     G   Q  G  V
Sbjct  538  QGMGMPPGMHFG---GQGYFPPYGMPIMSPSVSGSTVEQLNQFSGPNPYGQTGQPVGTSV  594

Query  531  NL-NVQHQNSCNM-PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPME  358
            N  ++QHQ+S ++ PSQKNG   ++ A R    K+ E+Q S ASSPS R    T +  M 
Sbjct  595  NFGSMQHQSSLHIHPSQKNG--TIASAARPQPPKERELQGSTASSPSQRT-RETGTALMG  651

Query  357  GRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            GR  LPLF  +P   I        T  P RVIRVVPH  +S  ESAARIFQSIQ+ER+Q
Sbjct  652  GRDALPLFLAAPTTQISGGF---PTEKPTRVIRVVPH--KSTRESAARIFQSIQEERRQ  705



>ref|XP_007216534.1| hypothetical protein PRUPE_ppa026719mg [Prunus persica]
 gb|EMJ17733.1| hypothetical protein PRUPE_ppa026719mg [Prunus persica]
Length=756

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 103/174 (59%), Gaps = 24/174 (14%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGGGVNLNV  520
            QGMG    PP+   YFPPYGMP++N ++S+SAVE M  F+       + Q+S G +N  +
Sbjct  602  QGMGI-GTPPLLQTYFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQLSFGEINFTL  660

Query  519  QHQNSCNMPSQKNGDADVSDAH--RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
             HQ+SCNM SQ    + V   +   + A K +EIQ + ASSPS R  G          + 
Sbjct  661  PHQSSCNMASQM---SQVMPCYVGNIQASKGSEIQGTTASSPSDRTLG----------NA  707

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            LPLFP +P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+ERK
Sbjct  708  LPLFPMAP-----QSQEPCQSEHQTRAIKVVPHNTKSASESAARIFLSIQEERK  756



>gb|KDO58687.1| hypothetical protein CISIN_1g004483mg [Citrus sinensis]
Length=693

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 103/174 (59%), Gaps = 17/174 (10%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGVNLNV  520
            +G+G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +N  +
Sbjct  531  EGIGILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDINFMI  590

Query  519  QHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
             HQ+S NM SQ N     S   +  A K++E+QAS ASSPS RA G            LP
Sbjct  591  PHQSSRNMSSQMNR-VITSCLEKFQASKESEVQASTASSPSERAKG----------DALP  639

Query  339  LFPTSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LFP +P+V   D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  640  LFPMAPIVQASD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  691



>ref|XP_006426449.1| hypothetical protein CICLE_v10024969mg [Citrus clementina]
 gb|ESR39689.1| hypothetical protein CICLE_v10024969mg [Citrus clementina]
Length=750

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 103/174 (59%), Gaps = 17/174 (10%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGVNLNV  520
            +G+G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +N  +
Sbjct  588  EGIGILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDINFMI  647

Query  519  QHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
             HQ+S NM SQ N     S   +  A K++E+QAS ASSPS RA G            LP
Sbjct  648  PHQSSRNMSSQMNR-VITSCLEKFQASKESEVQASTASSPSERAKG----------DALP  696

Query  339  LFPTSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LFP +P+V   D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  697  LFPMAPIVQASD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  748



>gb|KDO58686.1| hypothetical protein CISIN_1g004483mg [Citrus sinensis]
Length=750

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 103/174 (59%), Gaps = 17/174 (10%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGVNLNV  520
            +G+G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +N  +
Sbjct  588  EGIGILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDINFMI  647

Query  519  QHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
             HQ+S NM SQ N     S   +  A K++E+QAS ASSPS RA G            LP
Sbjct  648  PHQSSRNMSSQMNR-VITSCLEKFQASKESEVQASTASSPSERAKG----------DALP  696

Query  339  LFPTSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LFP +P+V   D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  697  LFPMAPIVQASD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  748



>ref|XP_006466166.1| PREDICTED: protein EARLY FLOWERING 3-like [Citrus sinensis]
Length=750

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 103/174 (59%), Gaps = 17/174 (10%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF--TRTGSQAQVSGGGVNLNV  520
            +G+G  P  PP+G   FPPYGMPVMN ++S +AV+QM  F          +S   +N  +
Sbjct  588  EGIGILPTTPPLGQTGFPPYGMPVMNQSISGTAVDQMIPFPPKDQSKDNHLSMVDINFMI  647

Query  519  QHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
             HQ+S NM SQ       S   +  A K++E+QAS ASSPS RA G            LP
Sbjct  648  PHQSSRNMSSQM-SRVITSCLEKFQASKESEVQASTASSPSERAKG----------DALP  696

Query  339  LFPTSPVVNIVDASQPPDTG-HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LFP +P+V + D  Q   TG   ARVI+VVP N R A+ESAARIF+SIQ+ERKQ
Sbjct  697  LFPMAPIVQVSD--QNDQTGEQQARVIKVVPCNPRLATESAARIFRSIQEERKQ  748



>ref|XP_008244744.1| PREDICTED: protein EARLY FLOWERING 3 isoform X3 [Prunus mume]
Length=735

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 102/174 (59%), Gaps = 24/174 (14%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGGGVNLNV  520
            QGMG    PP+    FPPYGMP++N ++S+SAVE M  F+       + Q+S G +N  +
Sbjct  581  QGMGI-GTPPLLQTCFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQLSFGEINFTL  639

Query  519  QHQNSCNMPSQKNGDADVSDAH--RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
             HQ+SCNM  Q    + V   +   + A K +EIQ + ASSPS R  G          + 
Sbjct  640  PHQSSCNMSGQM---SQVMPCYVGNIQASKGSEIQGTTASSPSDRTLG----------NA  686

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            LPLFPT+P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+ERK
Sbjct  687  LPLFPTAP-----QSQEPCKSEHQTRAIKVVPHNTKSASESAARIFLSIQEERK  735



>ref|XP_008244742.1| PREDICTED: protein EARLY FLOWERING 3 isoform X1 [Prunus mume]
Length=750

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 102/174 (59%), Gaps = 24/174 (14%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGGGVNLNV  520
            QGMG    PP+    FPPYGMP++N ++S+SAVE M  F+       + Q+S G +N  +
Sbjct  596  QGMGI-GTPPLLQTCFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQLSFGEINFTL  654

Query  519  QHQNSCNMPSQKNGDADVSDAH--RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
             HQ+SCNM  Q    + V   +   + A K +EIQ + ASSPS R  G          + 
Sbjct  655  PHQSSCNMSGQM---SQVMPCYVGNIQASKGSEIQGTTASSPSDRTLG----------NA  701

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            LPLFPT+P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+ERK
Sbjct  702  LPLFPTAP-----QSQEPCKSEHQTRAIKVVPHNTKSASESAARIFLSIQEERK  750



>ref|XP_008244743.1| PREDICTED: protein EARLY FLOWERING 3 isoform X2 [Prunus mume]
Length=748

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 102/174 (59%), Gaps = 24/174 (14%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFT---RTGSQAQVSGGGVNLNV  520
            QGMG    PP+    FPPYGMP++N ++S+SAVE M  F+       + Q+S G +N  +
Sbjct  594  QGMGI-GTPPLLQTCFPPYGMPIINPSLSSSAVENMTPFSGGHSNWHENQLSFGEINFTL  652

Query  519  QHQNSCNMPSQKNGDADVSDAH--RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
             HQ+SCNM  Q    + V   +   + A K +EIQ + ASSPS R  G          + 
Sbjct  653  PHQSSCNMSGQM---SQVMPCYVGNIQASKGSEIQGTTASSPSDRTLG----------NA  699

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            LPLFPT+P      + +P  + H  R I+VVPHN +SASESAARIF SIQ+ERK
Sbjct  700  LPLFPTAP-----QSQEPCKSEHQTRAIKVVPHNTKSASESAARIFLSIQEERK  748



>ref|XP_008444497.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008444498.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
Length=717

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 105/178 (59%), Gaps = 11/178 (6%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  517
            +QG+G  P  P +G  +FPPYGMPVMN  +S  AV+Q+N +   G   Q+SGG    N+Q
Sbjct  540  HQGIGALPSTPMVGGSFFPPYGMPVMNPGMSGFAVDQVNWY--AGDPNQLSGGVAASNIQ  597

Query  516  HQNSCNMPSQKNGDAD--VSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV-  346
            HQ S ++ +Q++ D +  VS   +  A K +E+Q S ASSP V +P   V G    R+  
Sbjct  598  HQTSYDVSTQRDRDENQTVSRTAKSQAPKRSEVQVSTASSP-VCSPPSKVQGNKANRTAE  656

Query  345  ---LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
               +          + +  QP D+    RVIRVVPHN RSA+ESAARIFQSIQ ERKQ
Sbjct  657  SHNVLPLFPLAPPLVEEGPQPSDSDQ-TRVIRVVPHNRRSANESAARIFQSIQNERKQ  713



>ref|XP_003550290.1| PREDICTED: protein EARLY FLOWERING 3-like [Glycine max]
 gb|KHN37008.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=713

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 93/174 (53%), Gaps = 27/174 (16%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNLNVQH-QN  508
            PF PP  H YF P+GMPVMN A S SAVEQ+N F   GS  Q    S  G + N  H Q+
Sbjct  554  PFVPPASHTYFAPFGMPVMNQATSGSAVEQVNQFAAQGSHGQNGHSSVEGADFNTHHNQS  613

Query  507  SCNMPSQKNGDADVSDAHRLH-----ACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
            S N+P QKNG        RLH     A K+  +Q S  SSPS  A G+      +G    
Sbjct  614  SSNLPVQKNGA-------RLHVKKSQALKERGLQGSTRSSPSEMAQGIRAGKIADGSDAQ  666

Query  342  PLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             L           +    +T    + I+VVPHN +SA+ESAARIFQSIQ+ERKQ
Sbjct  667  SL-----------SLHAVETRQQTQAIKVVPHNRKSATESAARIFQSIQEERKQ  709



>gb|KDP40820.1| hypothetical protein JCGZ_24819 [Jatropha curcas]
Length=766

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 97/171 (57%), Gaps = 15/171 (9%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQ  517
            QG+G  P  PP+G  YFPP+ MPVM+ ++S SAVE +  F    S+  Q S G +     
Sbjct  606  QGIGILPMIPPLGQTYFPPHAMPVMSPSISVSAVELVTPFIAPPSKDNQSSAGDIKFAFP  665

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
            HQ+SCNM SQ +    +    +  A K++E+Q S ASSP  R  G            LP 
Sbjct  666  HQSSCNMLSQMS--RVILCGGKFQASKESEVQESTASSPFKRPKG----------DALPF  713

Query  336  FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            FPT P   + D +   +      VI+VVPHN +SA+ESAARIFQSIQ+ERK
Sbjct  714  FPTEPTTQVSDPNVQLNELR-THVIKVVPHNPKSATESAARIFQSIQEERK  763



>gb|AEA50867.1| elf3a [Populus tremula]
Length=350

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 103/173 (60%), Gaps = 11/173 (6%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  517
            +QG+   P APP+G+  FPPYGMP MN A+S SA       T     AQ  GG ++ N+ 
Sbjct  183  HQGIEVSPGAPPVGNACFPPYGMPGMNPAISGSAGSGSCGQT-----AQFPGGILSSNMP  237

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
            HQ+SCN  +QK+    +    +L A K+  +Q S  SSPS R  GV      +GR+ LP 
Sbjct  238  HQSSCNERTQKS--EALLQGMKLQASKNTSVQGSTGSSPSGRVQGVGTVQAADGRAALPP  295

Query  336  FP-TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            FP T+P      A Q  +T   ++VI+VVPHN  SA+ESAARIFQSIQ+ RKQ
Sbjct  296  FPVTTPCPE--GAPQHQETDQLSKVIKVVPHNGISATESAARIFQSIQEGRKQ  346



>gb|KHN17209.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=697

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 90/169 (53%), Gaps = 17/169 (10%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGG---GVNLNVQH-QN  508
            PF PP  H YFP +GMPV+N A S S VEQ+N F   GS  Q       G + N  H Q+
Sbjct  538  PFVPPASHAYFPSFGMPVVNQATSGSTVEQVNQFAAQGSHGQNGHSYIEGTDFNTHHNQS  597

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  328
            S N+P  KNG        +  A K+  +Q S  SSPS  A G+      EG     L   
Sbjct  598  SSNLPVLKNG--ATLHVKKSQASKERGLQGSTISSPSEMAQGIRAGKIAEGNDAHSL---  652

Query  327  SPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                    + Q  +T    +VI+VVPHN +SA+ESAARIFQSIQ+ERKQ
Sbjct  653  --------SLQAVETRQQTQVIKVVPHNRKSATESAARIFQSIQEERKQ  693



>ref|XP_008462380.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008462381.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
 ref|XP_008462382.1| PREDICTED: protein EARLY FLOWERING 3 [Cucumis melo]
Length=694

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 99/175 (57%), Gaps = 15/175 (9%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNL  526
            +QG G  P + P+   YF PYG+PV N ++S S  +Q++ +++  S+ Q   +S G VN 
Sbjct  530  HQGFGYFPGSIPMNQAYFSPYGIPVTNKSMSGSVPDQVSLYSKFKSKEQENQISTGDVNC  589

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
                +NSC MPSQ +      +  ++H  K++E+  S ASSPS R  G           V
Sbjct  590  LTHQENSCEMPSQTSHSMPF-NVQKVHGSKESELLGSTASSPSERGNG----------DV  638

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LPLFPT P         P    + +R I+VVPH+ RSA+ESAARIFQ IQ+ER Q
Sbjct  639  LPLFPTEPPAVEESNPNPEMNENKSRAIKVVPHHPRSATESAARIFQLIQEERNQ  693



>ref|XP_011019541.1| PREDICTED: protein EARLY FLOWERING 3 [Populus euphratica]
Length=713

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 99/166 (60%), Gaps = 10/166 (6%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P APP+ +  FPPYGMP MN A+S SA       T     AQ  GG ++ N+ HQ+SCN 
Sbjct  553  PGAPPVDNACFPPYGMPGMNPAISGSAGSGSCGQT-----AQFPGGILSSNMPHQSSCNE  607

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP-TSPV  319
             +QK+    V    +L A K+  +Q S  SSPS R  GV      +GR+ LP FP T+P 
Sbjct  608  RTQKS--EAVLQGKKLQASKNTSVQGSTGSSPSGRVQGVGTVQAADGRAALPPFPVTTPC  665

Query  318  VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                 + Q  +T   ++VI+VVPHN RSA+ESAARIFQSIQ+ RKQ
Sbjct  666  PE--GSPQHQETDQLSKVIKVVPHNGRSATESAARIFQSIQEGRKQ  709



>ref|XP_007160975.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
 gb|ESW32969.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
Length=651

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 93/169 (55%), Gaps = 17/169 (10%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNLNVQH-QN  508
            PF  P  H YF PYGMPV+N A S SA E +N F   GS  Q    S  G N N  H Q+
Sbjct  492  PFVSPANHTYFSPYGMPVVNQAASGSAAEHVNQFATQGSHGQNGHSSVEGANFNTHHNQS  551

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  328
            S N+P Q++G   +S   +L   K+ ++Q S AS+ S     +      EG     L   
Sbjct  552  SSNLPVQRSGA--MSHVKKLQVSKERQLQGSTASTASETPQRIKARNITEGSDAHSL---  606

Query  327  SPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
               ++ VDA Q        +VI+VVPHN +SA+ESAARIFQSIQ+ERKQ
Sbjct  607  --SLHSVDARQQ------TQVIKVVPHNGKSATESAARIFQSIQEERKQ  647



>ref|XP_004141800.1| PREDICTED: uncharacterized protein LOC101208149 [Cucumis sativus]
 ref|XP_004155977.1| PREDICTED: uncharacterized LOC101208149 [Cucumis sativus]
 gb|KGN45548.1| hypothetical protein Csa_7G452030 [Cucumis sativus]
Length=694

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 97/175 (55%), Gaps = 15/175 (9%)
 Frame = -2

Query  693  YQGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNL  526
            +QG G  P + P+   YF PYG+PV N ++S S  +Q++  ++  S+ Q   +S G VN 
Sbjct  530  HQGFGYFPGSIPLNQPYFSPYGIPVTNKSMSGSVPDQVSLSSKVKSKEQENQISTGDVNC  589

Query  525  NVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSV  346
                +NSC MPSQ +      +  + H  K +E+  S ASSPS R  G           V
Sbjct  590  LTHQENSCEMPSQTSHSMPF-NVEKFHGSKGSELLGSTASSPSERGNG----------DV  638

Query  345  LPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LPLFPT P      +  P    + +R IRVVPH+ RSA+ESAARIFQ IQ+ER Q
Sbjct  639  LPLFPTEPPAVEESSPNPEMNENKSRAIRVVPHHPRSATESAARIFQLIQEERNQ  693



>ref|XP_007160974.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
 gb|ESW32968.1| hypothetical protein PHAVU_001G032900g [Phaseolus vulgaris]
Length=713

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 93/169 (55%), Gaps = 17/169 (10%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQ---VSGGGVNLNVQH-QN  508
            PF  P  H YF PYGMPV+N A S SA E +N F   GS  Q    S  G N N  H Q+
Sbjct  554  PFVSPANHTYFSPYGMPVVNQAASGSAAEHVNQFATQGSHGQNGHSSVEGANFNTHHNQS  613

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  328
            S N+P Q++G   +S   +L   K+ ++Q S AS+ S     +      EG     L   
Sbjct  614  SSNLPVQRSGA--MSHVKKLQVSKERQLQGSTASTASETPQRIKARNITEGSDAHSL---  668

Query  327  SPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
               ++ VDA Q        +VI+VVPHN +SA+ESAARIFQSIQ+ERKQ
Sbjct  669  --SLHSVDARQQ------TQVIKVVPHNGKSATESAARIFQSIQEERKQ  709



>ref|XP_008797900.1| PREDICTED: protein EARLY FLOWERING 3 [Phoenix dactylifera]
Length=757

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 99/172 (58%), Gaps = 22/172 (13%)
 Frame = -2

Query  690  QGMGDPF-APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  517
            Q MG P  APP+   YFP PYG+PV+N  +S+SAVEQ+N +   G   Q+         Q
Sbjct  602  QNMGVPSGAPPVAPNYFPAPYGLPVVNPVISSSAVEQVNPWPGLGPHGQID--------Q  653

Query  516  H-QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
            H + SCNM   K+     S   +  A KD+E+Q S ASSP  +A         E    LP
Sbjct  654  HSRGSCNMSHPKS--EAFSCFWKFQASKDSELQGSTASSPCKKA--------QEESDALP  703

Query  339  LFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  187
            LFP +P  +  +  SQ     +  RVI+VVPHNARSA+ESAARIF+SIQKER
Sbjct  704  LFPMAPATDGPNRPSQSSGRENQTRVIKVVPHNARSATESAARIFRSIQKER  755



>ref|XP_006385404.1| hypothetical protein POPTR_0003s04030g [Populus trichocarpa]
 gb|ERP63201.1| hypothetical protein POPTR_0003s04030g [Populus trichocarpa]
Length=384

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 94/170 (55%), Gaps = 21/170 (12%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNLNVQHQNS  505
            P  P  G  +F P+GMPVMN ++  SAVEQ+    R G Q+   Q++ G VN N+  Q+S
Sbjct  139  PGNPHFGQTFFQPFGMPVMNPSICDSAVEQIR--PRIGPQSKDNQLAVGDVNFNIPLQSS  196

Query  504  CNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS  325
            CNM +Q +              K++EIQ S A S S           M   + LPLFP  
Sbjct  197  CNMSNQMSRVISCC-VENFQGLKESEIQGSSAGSLSK----------MPKANALPLFPME  245

Query  324  PVVNIVDASQP--PDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            P +    AS P        ARVI+VVPHN RSA+ESAARIFQSIQ+ERKQ
Sbjct  246  PTL---QASYPNAQTNEQQARVIKVVPHNRRSATESAARIFQSIQEERKQ  292



>ref|XP_002276544.3| PREDICTED: protein EARLY FLOWERING 3 isoform X1 [Vitis vinifera]
Length=740

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 96/174 (55%), Gaps = 22/174 (13%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVNLNVQ--  517
            P  P +G  YFPPYG P++N + S SAVEQMN     G Q+      VS G +N  VQ  
Sbjct  572  PSNPFLGQTYFPPYGKPLVNPSTSGSAVEQMN--LSVGDQSSRPNNHVSVGDINATVQSV  629

Query  516  -HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
             +Q+  NMPSQK+G   +    +  A K +E+Q S AS+PS RA              LP
Sbjct  630  HYQSLGNMPSQKSGGI-LGCFGKFQASKSSELQVSTASTPSKRAQA----------DALP  678

Query  339  LFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LFP +P +   D   Q        R I+VVPH  +SASESAARIF+SIQ+ER Q
Sbjct  679  LFPVAPKIQESDQLDQIHGNEKQTRAIKVVPHKHKSASESAARIFRSIQEERNQ  732



>emb|CBI35994.3| unnamed protein product [Vitis vinifera]
Length=730

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 96/174 (55%), Gaps = 22/174 (13%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVNLNVQ--  517
            P  P +G  YFPPYG P++N + S SAVEQMN     G Q+      VS G +N  VQ  
Sbjct  562  PSNPFLGQTYFPPYGKPLVNPSTSGSAVEQMN--LSVGDQSSRPNNHVSVGDINATVQSV  619

Query  516  -HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
             +Q+  NMPSQK+G   +    +  A K +E+Q S AS+PS RA              LP
Sbjct  620  HYQSLGNMPSQKSGGI-LGCFGKFQASKSSELQVSTASTPSKRAQA----------DALP  668

Query  339  LFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            LFP +P +   D   Q        R I+VVPH  +SASESAARIF+SIQ+ER Q
Sbjct  669  LFPVAPKIQESDQLDQIHGNEKQTRAIKVVPHKHKSASESAARIFRSIQEERNQ  722



>emb|CAN65004.1| hypothetical protein VITISV_023490 [Vitis vinifera]
Length=1255

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 96/174 (55%), Gaps = 22/174 (13%)
 Frame = -2

Query  675   PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVNLNVQ--  517
             P  P +G  YFPPYG P++N + S SAVEQMN     G Q+      VS G +N  VQ  
Sbjct  1093  PSNPFLGQTYFPPYGKPLVNPSTSGSAVEQMN--LSVGDQSSRPNNHVSVGDINATVQSV  1150

Query  516   -HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
              +Q+  NMPSQK+G   +    +  A K +E+Q S AS+PS RA              LP
Sbjct  1151  HYQSLGNMPSQKSGGI-LGCFGKFQASKSSELQVSTASTPSKRAQA----------DALP  1199

Query  339   LFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             LFP +P +   D   Q        R I+VVPH  +SASESAARIF+SIQ+ER Q
Sbjct  1200  LFPVAPKIQESDQLDQIHGNEKQTRAIKVVPHKHKSASESAARIFRSIQEERNQ  1253



>gb|AEA50868.1| elf3b [Populus tremula]
Length=348

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 97/170 (57%), Gaps = 21/170 (12%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNLNVQHQNS  505
            P  P  G  +F P+GMPVMN ++  SAV Q++     G Q+   Q++ G +N N+  Q+S
Sbjct  193  PGNPHFGQTFFQPFGMPVMNPSIRDSAVGQIS--PPIGPQSKDNQLAVGDINSNIPLQSS  250

Query  504  CNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS  325
            CNM +Q +       A      K++EIQ S A S S           M   + LPLFP  
Sbjct  251  CNMSNQMSRVISCC-AENFQGLKESEIQGSSAGSLSK----------MPKANALPLFPME  299

Query  324  PVVNIVDASQP-PDTGHP-ARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            P +    AS P   T  P ARVI+VVPHN+RSA+ESAARIFQSIQ+ERKQ
Sbjct  300  PTL---QASYPIAQTNEPQARVIKVVPHNSRSATESAARIFQSIQEERKQ  346



>ref|XP_010267079.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nelumbo 
nucifera]
Length=682

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 94/175 (54%), Gaps = 6/175 (3%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT---GSQAQVSGGGVNLN  523
            QG+G  P A P+G  YFP YG+PV+N  +  S+V+Q N        G     S G    N
Sbjct  505  QGIGIFPGALPVGQTYFPSYGVPVLNPGIFASSVDQTNPLVGVWPHGHAESFSSGDAYFN  564

Query  522  VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
            + H +S N  +  +         +    KD+E Q S ASSP  R      +   EGR  L
Sbjct  565  LHHHSSYNNSNHNSESISCC-TWKFQMSKDSEPQGSTASSPCERTRSTGANNIAEGRDPL  623

Query  342  PLFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PLFP +P V + +   Q   +    RVIRVVPHN RSA+ESAARIFQSIQKER++
Sbjct  624  PLFPMAPAVQVQNPVLQSRSSDQQTRVIRVVPHNRRSATESAARIFQSIQKERQK  678



>ref|XP_010267078.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nelumbo 
nucifera]
Length=796

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 94/175 (54%), Gaps = 6/175 (3%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT---GSQAQVSGGGVNLN  523
            QG+G  P A P+G  YFP YG+PV+N  +  S+V+Q N        G     S G    N
Sbjct  619  QGIGIFPGALPVGQTYFPSYGVPVLNPGIFASSVDQTNPLVGVWPHGHAESFSSGDAYFN  678

Query  522  VQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
            + H +S N  +  +         +    KD+E Q S ASSP  R      +   EGR  L
Sbjct  679  LHHHSSYNNSNHNSESISCC-TWKFQMSKDSEPQGSTASSPCERTRSTGANNIAEGRDPL  737

Query  342  PLFPTSPVVNIVD-ASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            PLFP +P V + +   Q   +    RVIRVVPHN RSA+ESAARIFQSIQKER++
Sbjct  738  PLFPMAPAVQVQNPVLQSRSSDQQTRVIRVVPHNRRSATESAARIFQSIQKERQK  792



>ref|XP_002309522.1| EARLY FLOWERING 3 family protein [Populus trichocarpa]
 gb|EEE93045.1| EARLY FLOWERING 3 family protein [Populus trichocarpa]
Length=663

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 101/172 (59%), Gaps = 9/172 (5%)
 Frame = -2

Query  693  YQGMG-DPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQ  517
            +QG+G  P APP+G+  F PYGMP MN A+S SA       T     AQ  GG ++ N+ 
Sbjct  496  HQGIGVSPGAPPVGNACFAPYGMPGMNPAISGSAGSGSCGQT-----AQFPGGILSSNMP  550

Query  516  HQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
            HQ+SCN  +QK+    V +  +L A K+  +Q S  SSPS R  GV      +GR+  P 
Sbjct  551  HQSSCNERTQKS--EAVLEGMKLRASKNTSVQGSTGSSPSGRVQGVGTVQAADGRAAFPP  608

Query  336  FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            FP +       A Q  +T   ++VI+VVPHN RSA+ES ARIFQSIQ+ RKQ
Sbjct  609  FPVT-PPCPEGAPQHQETDQLSKVIKVVPHNGRSATESVARIFQSIQEGRKQ  659



>ref|XP_010915306.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Elaeis 
guineensis]
Length=779

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 100/173 (58%), Gaps = 25/173 (14%)
 Frame = -2

Query  684  MGDPF-APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-  514
            MG PF +P +   YFP PYG+PV+N  + TS VEQ++  TR   Q +          QH 
Sbjct  624  MGTPFRSPGVALNYFPAPYGLPVVNPVIPTSVVEQVSPLTRPMEQTE----------QHS  673

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL--P  340
            Q+SCNM + KN +A    + +L+A KD E+Q S ASSP  R  G       EGR  L  P
Sbjct  674  QSSCNMLNLKN-EAFGGCSWKLNASKDCELQGSTASSPCERVQG-------EGRDALDHP  725

Query  339  LFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            + P +     +  S   D  +   VI+VVPHNA SA+ESAARIF+SIQ+ER+Q
Sbjct  726  VAPLTKRSRQLLRSNESD--YQTHVIKVVPHNASSATESAARIFRSIQEERRQ  776



>ref|XP_010915307.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Elaeis 
guineensis]
Length=752

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 100/173 (58%), Gaps = 25/173 (14%)
 Frame = -2

Query  684  MGDPF-APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-  514
            MG PF +P +   YFP PYG+PV+N  + TS VEQ++  TR   Q +          QH 
Sbjct  597  MGTPFRSPGVALNYFPAPYGLPVVNPVIPTSVVEQVSPLTRPMEQTE----------QHS  646

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL--P  340
            Q+SCNM + KN +A    + +L+A KD E+Q S ASSP  R  G       EGR  L  P
Sbjct  647  QSSCNMLNLKN-EAFGGCSWKLNASKDCELQGSTASSPCERVQG-------EGRDALDHP  698

Query  339  LFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            + P +     +  S   D  +   VI+VVPHNA SA+ESAARIF+SIQ+ER+Q
Sbjct  699  VAPLTKRSRQLLRSNESD--YQTHVIKVVPHNASSATESAARIFRSIQEERRQ  749



>ref|XP_004498925.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498926.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Cicer arietinum]
 ref|XP_004498927.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Cicer arietinum]
Length=662

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 93/173 (54%), Gaps = 18/173 (10%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSF---TRTGSQAQVSGGGVNLNVQHQNS  505
            PF PP  + +FPP+ +P MN + S S VEQ N F       S    S  G + N  +Q+S
Sbjct  496  PFIPPGSYAHFPPHCVPAMNQSASGSVVEQANRFAAQVSHDSNGNSSLVGASFNTHNQSS  555

Query  504  CNMPSQKNGDADVSDAHRLHACK-----DNEIQASCASSPSVRAPGVTVSGPMEGRSVLP  340
            CN+ +QKNG         LH  K     + E+Q    S P+ +   + +    EGR  L 
Sbjct  556  CNLTNQKNGAT-------LHITKFQPSIERELQGIPTSRPNEKE--IRIEKSAEGRDALS  606

Query  339  LFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
               T+P V+  +  Q  +T    +VIRVVPHN RSAS SAARIFQSIQ+ERKQ
Sbjct  607  PSFTAPSVS-EEVFQSLETKQKPQVIRVVPHNPRSASVSAARIFQSIQEERKQ  658



>ref|XP_010062565.1| PREDICTED: protein EARLY FLOWERING 3-like [Eucalyptus grandis]
 ref|XP_010062566.1| PREDICTED: protein EARLY FLOWERING 3-like [Eucalyptus grandis]
 gb|KCW69700.1| hypothetical protein EUGRSUZ_F03094 [Eucalyptus grandis]
Length=717

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 100/176 (57%), Gaps = 18/176 (10%)
 Frame = -2

Query  690  QGMGD-PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-----QVSGGGVN  529
            Q MG  P     G  +F P+G+P+ N +V++SA+E M++    GSQ+     Q S G VN
Sbjct  552  QAMGILPRTSVAGQTFFLPWGIPLTNPSVASSAIEPMSNPFILGSQSNPQVNQRSTGEVN  611

Query  528  LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS  349
            ++  HQ+SCN+ +Q +      D  +    K+NE+Q S  S+PS +  G          +
Sbjct  612  ISRTHQSSCNVSTQVSRVISC-DGLKSPTLKENELQGSTGSNPSEKLGG----------A  660

Query  348  VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             LPLFP  P  +     Q   +    +VI+VVPHN RSA+ESAARIFQSIQ+ERK+
Sbjct  661  ALPLFPIDPTKSDQKV-QVHSSNRLEKVIKVVPHNPRSAAESAARIFQSIQEERKR  715



>ref|XP_011011712.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011011713.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Populus 
euphratica]
Length=780

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 94/168 (56%), Gaps = 17/168 (10%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQHQNSCN  499
            P  P  G  +F P+GMPVMN ++  SAVEQ++      S+  Q++ G  N N+  Q+SCN
Sbjct  625  PGNPHFGQTFFQPFGMPVMNPSICDSAVEQISPHNGPQSKDNQLAVGDTNFNIPLQSSCN  684

Query  498  MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  319
            M +Q +              K++EIQ S A +     P ++ S      + LPLFP  P 
Sbjct  685  MSNQMSRVISCC-VENFQGSKESEIQGSSAGN----LPKMSKS------NALPLFPMEPT  733

Query  318  VNIVDASQPPD--TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +    AS P        ARVI+VVPHN RSA+ESAARIFQSIQ+ER+Q
Sbjct  734  L---QASYPNAQINEQQARVIKVVPHNPRSATESAARIFQSIQEERRQ  778



>ref|XP_011011714.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Populus 
euphratica]
Length=764

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 94/168 (56%), Gaps = 17/168 (10%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQHQNSCN  499
            P  P  G  +F P+GMPVMN ++  SAVEQ++      S+  Q++ G  N N+  Q+SCN
Sbjct  609  PGNPHFGQTFFQPFGMPVMNPSICDSAVEQISPHNGPQSKDNQLAVGDTNFNIPLQSSCN  668

Query  498  MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  319
            M +Q +              K++EIQ S A +     P ++ S      + LPLFP  P 
Sbjct  669  MSNQMSRVISCC-VENFQGSKESEIQGSSAGN----LPKMSKS------NALPLFPMEPT  717

Query  318  VNIVDASQPPD--TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +    AS P        ARVI+VVPHN RSA+ESAARIFQSIQ+ER+Q
Sbjct  718  L---QASYPNAQINEQQARVIKVVPHNPRSATESAARIFQSIQEERRQ  762



>ref|XP_009401962.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=736

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 88/165 (53%), Gaps = 18/165 (11%)
 Frame = -2

Query  669  APPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQN-SCNMP  493
            A  +   YFP YG+P MN  VSTSAVEQ+ +   +     +         QH   SCNM 
Sbjct  586  ASAVATNYFPAYGIPSMNPIVSTSAVEQVTNLACSRPNGHID--------QHSMISCNM-  636

Query  492  SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV-  316
            S    +A      +  A KD E+QAS ASSP  +A         E   VLPLFP +P   
Sbjct  637  SHSRSEAISGCFLKFQASKDTELQASSASSPCEKAQ-------TEASDVLPLFPMAPKKE  689

Query  315  NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            N+V  S+       A+ I+VVPHNARSA ES ARIFQSIQ+ER Q
Sbjct  690  NLVCPSRSSGRDSQAQAIKVVPHNARSAIESVARIFQSIQEERLQ  734



>gb|KJB35029.1| hypothetical protein B456_006G096400 [Gossypium raimondii]
 gb|KJB35030.1| hypothetical protein B456_006G096400 [Gossypium raimondii]
Length=694

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 86/162 (53%), Gaps = 19/162 (12%)
 Frame = -2

Query  666  PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQ  487
            PPI    FP YGMPVMN +V+ SA+EQM+      S+A       N  +   +SCN  SQ
Sbjct  550  PPISQTNFPHYGMPVMNPSVTGSALEQMSRVIAVQSKA-------NFTMAQPSSCNTSSQ  602

Query  486  KNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIV  307
             +     S   +L A  + EIQ + ASSPS RA              LPLFPT P     
Sbjct  603  LSQAISYS-TQKLPAPNETEIQGTTASSPSDRA----------KVDALPLFPTEPPTTAA  651

Query  306  DASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +           +VI+V+PHN  SA+ESAARIFQSIQ+ERKQ
Sbjct  652  NCDARTHQQR-TKVIKVIPHNRVSATESAARIFQSIQEERKQ  692



>gb|KHG06245.1| Protein EARLY FLOWERING 3 -like protein [Gossypium arboreum]
Length=701

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 86/162 (53%), Gaps = 19/162 (12%)
 Frame = -2

Query  666  PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQ  487
            PPI    FP YGMPVMN +V+ SA+EQM+      S+A       N  +   +SCN  SQ
Sbjct  557  PPISQTTFPHYGMPVMNPSVTGSALEQMSLVIAVQSKA-------NFTMAQPSSCNTSSQ  609

Query  486  KNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIV  307
             +     S   +L A  + EIQ + ASSPS RA              LPLFPT P     
Sbjct  610  PSQAISYS-TQKLPAPNETEIQGTTASSPSERA----------KVDALPLFPTEPPTTAA  658

Query  306  DASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +           +VI+V+PHN  SA+ESAARIFQSIQ+ERKQ
Sbjct  659  NCDARTHQQR-TKVIKVIPHNHVSATESAARIFQSIQEERKQ  699



>ref|XP_010322857.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Solanum 
lycopersicum]
Length=602

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 98/184 (53%), Gaps = 32/184 (17%)
 Frame = -2

Query  675  PFAPPIGH----GYFP-----------PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSG  541
            P++ P  H    G FP           PY MPV+  + S+SA+EQMN  +R  S  + + 
Sbjct  428  PYSVPTSHKQGAGIFPGPALFDPSCIQPYSMPVIKPSASSSAIEQMNPLSRIRSSEKENS  487

Query  540  ---GGVNLNVQHQNSCNMPSQKNGDADVSDAHRL-HACKDNEIQASCASSPSVRAPGVTV  373
                 VNL   HQ SCN+  QK+  A +SD  R+  A + +++Q S ASSP  R      
Sbjct  488  PLMHEVNLVRPHQKSCNISCQKS--AVMSDCDRIIQADRGSDMQGSTASSPPERV-----  540

Query  372  SGPMEGRSVLPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  196
                  +  L LFP +P     D   Q  DT    +VI+VVPHN +SASESAARIF+SIQ
Sbjct  541  -----QKGALSLFPVTPTAKGSDQPVQDNDTEQQIQVIKVVPHNPKSASESAARIFRSIQ  595

Query  195  KERK  184
            +ERK
Sbjct  596  EERK  599



>ref|XP_010322854.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322855.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322856.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Solanum 
lycopersicum]
Length=657

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 98/184 (53%), Gaps = 32/184 (17%)
 Frame = -2

Query  675  PFAPPIGH----GYFP-----------PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSG  541
            P++ P  H    G FP           PY MPV+  + S+SA+EQMN  +R  S  + + 
Sbjct  483  PYSVPTSHKQGAGIFPGPALFDPSCIQPYSMPVIKPSASSSAIEQMNPLSRIRSSEKENS  542

Query  540  ---GGVNLNVQHQNSCNMPSQKNGDADVSDAHRL-HACKDNEIQASCASSPSVRAPGVTV  373
                 VNL   HQ SCN+  QK+  A +SD  R+  A + +++Q S ASSP  R      
Sbjct  543  PLMHEVNLVRPHQKSCNISCQKS--AVMSDCDRIIQADRGSDMQGSTASSPPERV-----  595

Query  372  SGPMEGRSVLPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  196
                  +  L LFP +P     D   Q  DT    +VI+VVPHN +SASESAARIF+SIQ
Sbjct  596  -----QKGALSLFPVTPTAKGSDQPVQDNDTEQQIQVIKVVPHNPKSASESAARIFRSIQ  650

Query  195  KERK  184
            +ERK
Sbjct  651  EERK  654



>ref|XP_002515898.1| hypothetical protein RCOM_1486170 [Ricinus communis]
 gb|EEF46318.1| hypothetical protein RCOM_1486170 [Ricinus communis]
Length=783

 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 90/166 (54%), Gaps = 13/166 (8%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQHQNSCN  499
            P  PP+G  YFPPYGMPVM  ++S     Q++ F    S+  Q+S G +N     Q+SC+
Sbjct  628  PSDPPLGQNYFPPYGMPVMTPSISGLLFGQVSPFNGPQSKGNQLSLGDMNFTFPQQSSCH  687

Query  498  MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  319
            + S  +       A      K++++Q S ASSPS    G            LPLFP  P 
Sbjct  688  ISSSMSRVISCC-AENFQPSKESKVQGSTASSPSESLKG----------DALPLFPIEPT  736

Query  318  VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                D +   D     RVI+VVPHNARSA+ESAARIF+ IQ+ERKQ
Sbjct  737  AQASDQNGQTD-AQWTRVIKVVPHNARSATESAARIFRFIQEERKQ  781



>ref|XP_004242270.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Solanum 
lycopersicum]
Length=766

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 98/184 (53%), Gaps = 32/184 (17%)
 Frame = -2

Query  675  PFAPPIGH----GYFP-----------PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSG  541
            P++ P  H    G FP           PY MPV+  + S+SA+EQMN  +R  S  + + 
Sbjct  592  PYSVPTSHKQGAGIFPGPALFDPSCIQPYSMPVIKPSASSSAIEQMNPLSRIRSSEKENS  651

Query  540  ---GGVNLNVQHQNSCNMPSQKNGDADVSDAHRL-HACKDNEIQASCASSPSVRAPGVTV  373
                 VNL   HQ SCN+  QK+  A +SD  R+  A + +++Q S ASSP  R      
Sbjct  652  PLMHEVNLVRPHQKSCNISCQKS--AVMSDCDRIIQADRGSDMQGSTASSPPERV-----  704

Query  372  SGPMEGRSVLPLFPTSPVVNIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  196
                  +  L LFP +P     D   Q  DT    +VI+VVPHN +SASESAARIF+SIQ
Sbjct  705  -----QKGALSLFPVTPTAKGSDQPVQDNDTEQQIQVIKVVPHNPKSASESAARIFRSIQ  759

Query  195  KERK  184
            +ERK
Sbjct  760  EERK  763



>ref|XP_002440379.1| hypothetical protein SORBIDRAFT_09g030700 [Sorghum bicolor]
 gb|EES18809.1| hypothetical protein SORBIDRAFT_09g030700 [Sorghum bicolor]
Length=745

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 88/155 (57%), Gaps = 21/155 (14%)
 Frame = -2

Query  630  MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-QNSCNMPSQKNGDADVSDAH  454
            MPVMN AVS SAVEQ++    +     +         QH +NSCN  S    +A  +   
Sbjct  604  MPVMNPAVSASAVEQVSHVAASQRNGHIE--------QHTRNSCNA-SHLRSEAVSAGVW  654

Query  453  RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTG--  280
            R+HA +D+E+Q S ASSP  R  G       EGR   P FP S V N    +Q   +   
Sbjct  655  RVHASRDSELQGSSASSPFDRQQG-------EGRGPAPPFPASSVGNRQAQAQAQASSGS  707

Query  279  --HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
              +P+RVIRVVPH AR+ASESAARIFQSIQ ERKQ
Sbjct  708  RENPSRVIRVVPHTARTASESAARIFQSIQMERKQ  742



>dbj|BAL45488.1| early flowering 3 [Fagopyrum esculentum]
Length=691

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 90/182 (49%), Gaps = 45/182 (25%)
 Frame = -2

Query  651  GYFPPYGMPVMNSAVSTSAVEQM------NSFTRTGSQAQVSGGGVNLNVQHQNSCNMPS  490
            GYFPPYGM +MNSA+S S+V+Q+      N    T    Q      N + Q Q SCN+PS
Sbjct  524  GYFPPYGMSMMNSAMSGSSVDQIKLRSISNPNEETAQTTQTVIRMPNFSGQQQGSCNIPS  583

Query  489  QKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPME-GRSVLPLFPTSPVVN  313
            Q++                +EI  S  SSPS RA  +    P    +  L  FP +PV  
Sbjct  584  QRH----------------SEILGSTGSSPSERAQDIIRPRPTTTDKDALTFFPAAPVSG  627

Query  312  IVDASQPPDTGHPARVIR-------------------VVPHNARSASESAARIFQSIQKE  190
               ASQP  T  P  VI+                   VVPHNAR+A+ESAARIF+SIQ+E
Sbjct  628  ---ASQPRKTNQPTTVIKAVPHNARTAGDHQPTTLIKVVPHNARTATESAARIFRSIQEE  684

Query  189  RK  184
            R+
Sbjct  685  RR  686



>ref|XP_004969004.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Setaria 
italica]
 ref|XP_004969005.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Setaria 
italica]
Length=611

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 94/174 (54%), Gaps = 27/174 (16%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ +PVMN     SAVEQ       GS A V         Q  
Sbjct  458  QHMAPPGAPAMHMNYFPPFSVPVMNPGAPASAVEQ-------GSHAAVPQPHGRAEQQSL  510

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R   + V G  +G   + +FP
Sbjct  511  ISCNM-------SHPSGIWRFHASRDSEPQASSASSPFDR---IQVQG--DGSGPVSVFP  558

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            ++P  N    +QP P +G       VIRVVPHNA++ASESAARIF+SIQ ER+Q
Sbjct  559  SAPAQN----AQPQPSSGSRDQQNHVIRVVPHNAQTASESAARIFRSIQMERRQ  608



>ref|XP_004969003.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Setaria 
italica]
Length=735

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 94/174 (54%), Gaps = 27/174 (16%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ +PVMN     SAVEQ       GS A V         Q  
Sbjct  582  QHMAPPGAPAMHMNYFPPFSVPVMNPGAPASAVEQ-------GSHAAVPQPHGRAEQQSL  634

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R   + V G  +G   + +FP
Sbjct  635  ISCNM-------SHPSGIWRFHASRDSEPQASSASSPFDR---IQVQG--DGSGPVSVFP  682

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            ++P  N    +QP P +G       VIRVVPHNA++ASESAARIF+SIQ ER+Q
Sbjct  683  SAPAQN----AQPQPSSGSRDQQNHVIRVVPHNAQTASESAARIFRSIQMERRQ  732



>ref|XP_010106119.1| hypothetical protein L484_003122 [Morus notabilis]
 gb|EXC07678.1| hypothetical protein L484_003122 [Morus notabilis]
Length=789

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 96/172 (56%), Gaps = 29/172 (17%)
 Frame = -2

Query  666  PPIGHGYF-PPYGMPVMNSAVSTSAVEQMNSFT--RTGSQA-QVSGGGVNLNVQHQNSCN  499
            PP G  YF PPYG+PVM+S V  SAVEQM+ F   R   Q  Q S   +N     Q+SCN
Sbjct  629  PPFGQAYFAPPYGLPVMSSFVPNSAVEQMSPFGIGRANDQEHQSSFEEMNFPKPRQSSCN  688

Query  498  MPSQKNGDADVSDAH-RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGR--SVLPLFPT  328
            + SQ    + V  +H  + A K +E   S AS+          + P E R    LPLFP 
Sbjct  689  ISSQT---SRVKSSHGAVQASKRSEFYRSTAST----------NTPPERRRGDELPLFPV  735

Query  327  SPVVNIVDASQPPD----TGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            +P      A +P +    + +  RVI+VVPHN R+A+ESAARIFQSIQ+E+K
Sbjct  736  APT-----AEEPDENVQISKNQTRVIKVVPHNPRTATESAARIFQSIQEEKK  782



>ref|XP_004969002.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Setaria 
italica]
Length=749

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 94/174 (54%), Gaps = 27/174 (16%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ +PVMN     SAVEQ       GS A V         Q  
Sbjct  596  QHMAPPGAPAMHMNYFPPFSVPVMNPGAPASAVEQ-------GSHAAVPQPHGRAEQQSL  648

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R   + V G  +G   + +FP
Sbjct  649  ISCNM-------SHPSGIWRFHASRDSEPQASSASSPFDR---IQVQG--DGSGPVSVFP  696

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            ++P  N    +QP P +G       VIRVVPHNA++ASESAARIF+SIQ ER+Q
Sbjct  697  SAPAQN----AQPQPSSGSRDQQNHVIRVVPHNAQTASESAARIFRSIQMERRQ  746



>ref|XP_006357460.1| PREDICTED: protein EARLY FLOWERING 3-like [Solanum tuberosum]
Length=762

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 97/184 (53%), Gaps = 32/184 (17%)
 Frame = -2

Query  675  PFAPPIGH----GYFP-----------PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSG  541
            P++ P  H    G FP           PY MPV+  + S+SA+EQMN  +R  S  + + 
Sbjct  588  PYSVPTSHKQGAGIFPGPALFDPSCIQPYSMPVIKPSASSSAIEQMNPISRIRSSEKENS  647

Query  540  G---GVNLNVQHQNSCNMPSQKNGDADVSDAHRL-HACKDNEIQASCASSPSVRAPGVTV  373
                 VNL   HQ SCN+   K+  A +SD  R+  A + +++Q S ASSP  R      
Sbjct  648  QFMHDVNLVRPHQKSCNISCLKS--AAMSDCDRIIQADRGSDMQGSTASSPPERV-----  700

Query  372  SGPMEGRSVLPLFPTSPVVNIVDAS-QPPDTGHPARVIRVVPHNARSASESAARIFQSIQ  196
                  +  L LFP +P     D   Q  DT    +VI+VVPHN +SASESAARIF+SIQ
Sbjct  701  -----QKGALSLFPVTPTAKGSDQPVQDNDTEQQIQVIKVVPHNPKSASESAARIFRSIQ  755

Query  195  KERK  184
            +ERK
Sbjct  756  EERK  759



>ref|XP_009400544.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=754

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 93/164 (57%), Gaps = 17/164 (10%)
 Frame = -2

Query  666  PPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPS  490
            P I   YFP PYG+  +N  +STSAVEQ+N+    GSQ  V  G  +     ++SCNM S
Sbjct  603  PAIVPHYFPTPYGIQALNPLISTSAVEQVNNLA--GSQPNVQTGQCS-----RSSCNM-S  654

Query  489  QKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNI  310
                +A      +    K++E+Q S ASSP+ +A          GRS  PL  T+   N 
Sbjct  655  HHPKEAFSGHRGKFRESKNSELQGSTASSPAEKAQP-------NGRSTSPLLSTALAANN  707

Query  309  VDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             +  SQ        RVI+VVPHNARSA+ESAARIF+SIQKER+Q
Sbjct  708  HNCPSQSSGRDSCTRVIKVVPHNARSATESAARIFRSIQKERQQ  751



>ref|XP_004960992.1| PREDICTED: protein EARLY FLOWERING 3-like [Setaria italica]
Length=748

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 89/154 (58%), Gaps = 23/154 (15%)
 Frame = -2

Query  630  MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHR  451
            MPVMN+AVS SAVEQ+       S    S    ++    ++SCNM S    +A  +D  R
Sbjct  612  MPVMNTAVSASAVEQV-------SHVAASRPNGHIEQHSRSSCNM-SNLRSEALSADIWR  663

Query  450  LHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP-PDTG--  280
             HA KD+E+Q S ASS   R  G       EGR     FP+S V N     QP P +G  
Sbjct  664  FHASKDSELQGSSASSTFDRQQG-------EGRGPAQPFPSSSVGN----GQPQPSSGSR  712

Query  279  -HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             +P RVIRVVPH +R+ASESAARIF+SI+ ER+Q
Sbjct  713  ENPGRVIRVVPHTSRTASESAARIFESIKMERQQ  746



>ref|XP_009625227.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=649

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 96/185 (52%), Gaps = 34/185 (18%)
 Frame = -2

Query  675  PFAPPIGH----GYFP-----------PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV--  547
            P++ P  H    G FP           PY MPV+  + S+SAVE+MN F    S  +   
Sbjct  475  PYSVPTSHKQGVGIFPGTAILDQSCIQPYPMPVIKPSASSSAVEKMNPFPGIRSSERENS  534

Query  546  -SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVS  370
             S   VN+   H+ SCN+  QK+      D     A + +++Q S ASSPS R       
Sbjct  535  PSMHDVNVVRPHKKSCNVSCQKSSGMSECDG-TFQADRGSDMQGSSASSPSERV------  587

Query  369  GPMEGRSVLPLFPTSPVVNIVDASQP---PDTGHPARVIRVVPHNARSASESAARIFQSI  199
                 R  L LFP +P  N +D  QP    +T    +VI+VVPHN +SASESAARIF+SI
Sbjct  588  ----QRDALSLFPITPTANCLD--QPVKDNNTEQRIQVIKVVPHNPKSASESAARIFRSI  641

Query  198  QKERK  184
            Q+ERK
Sbjct  642  QEERK  646



>ref|XP_008806826.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Phoenix 
dactylifera]
Length=762

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 95/165 (58%), Gaps = 18/165 (11%)
 Frame = -2

Query  669  APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP  493
            AP I   YFP PYG+PV N  +S+SA +Q++     GS+  V      ++ Q  +S +M 
Sbjct  611  APAIAPNYFPTPYGLPVANPDISSSADKQVSPLP--GSKPNVQ-----IDRQSWSSNDML  663

Query  492  SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  313
              K+ +A      R  A KD+E+Q S ASSP  +          EG   LPLF  +P  +
Sbjct  664  HPKS-EAFSGCLLRFQASKDSELQGSTASSPCEKE--------QEGTDALPLFHMAPATD  714

Query  312  -IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                 SQ    G+ ARVI+VVPHNARSA+E+AARIF+SIQ+ER+Q
Sbjct  715  GPTRPSQFRGRGNQARVIKVVPHNARSATETAARIFKSIQEERQQ  759



>ref|XP_008806834.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Phoenix 
dactylifera]
Length=759

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 95/165 (58%), Gaps = 18/165 (11%)
 Frame = -2

Query  669  APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP  493
            AP I   YFP PYG+PV N  +S+SA +Q++     GS+  V      ++ Q  +S +M 
Sbjct  608  APAIAPNYFPTPYGLPVANPDISSSADKQVSPLP--GSKPNVQ-----IDRQSWSSNDML  660

Query  492  SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  313
              K+ +A      R  A KD+E+Q S ASSP  +          EG   LPLF  +P  +
Sbjct  661  HPKS-EAFSGCLLRFQASKDSELQGSTASSPCEKE--------QEGTDALPLFHMAPATD  711

Query  312  -IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                 SQ    G+ ARVI+VVPHNARSA+E+AARIF+SIQ+ER+Q
Sbjct  712  GPTRPSQFRGRGNQARVIKVVPHNARSATETAARIFKSIQEERQQ  756



>ref|XP_009625226.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=769

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 96/185 (52%), Gaps = 34/185 (18%)
 Frame = -2

Query  675  PFAPPIGH----GYFP-----------PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV--  547
            P++ P  H    G FP           PY MPV+  + S+SAVE+MN F    S  +   
Sbjct  595  PYSVPTSHKQGVGIFPGTAILDQSCIQPYPMPVIKPSASSSAVEKMNPFPGIRSSERENS  654

Query  546  -SGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVS  370
             S   VN+   H+ SCN+  QK+      D     A + +++Q S ASSPS R       
Sbjct  655  PSMHDVNVVRPHKKSCNVSCQKSSGMSECDG-TFQADRGSDMQGSSASSPSERV------  707

Query  369  GPMEGRSVLPLFPTSPVVNIVDASQP---PDTGHPARVIRVVPHNARSASESAARIFQSI  199
                 R  L LFP +P  N +D  QP    +T    +VI+VVPHN +SASESAARIF+SI
Sbjct  708  ----QRDALSLFPITPTANCLD--QPVKDNNTEQRIQVIKVVPHNPKSASESAARIFRSI  761

Query  198  QKERK  184
            Q+ERK
Sbjct  762  QEERK  766



>ref|XP_010910484.1| PREDICTED: protein EARLY FLOWERING 3 [Elaeis guineensis]
Length=755

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 90/164 (55%), Gaps = 20/164 (12%)
 Frame = -2

Query  669  APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-QNSCNM  496
            AP +   YFP P G+PV N  V++SAVEQ++    +G   Q+         QH ++SCNM
Sbjct  607  APAVAPNYFPAPCGLPVENPIVTSSAVEQISPLPGSGPHGQID--------QHSRSSCNM  658

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
             S    +A      +  + KD E+Q S ASSP  +          E R  LPLFP +   
Sbjct  659  -SHPKSEAFSCCFWKFQSSKDTELQGSTASSPCDKV--------REERDALPLFPMALAT  709

Query  315  NIVDA-SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  187
            +  +  SQ     +  RVI+VVPHNARSA+ESAARIF+SIQ+ R
Sbjct  710  DGPNRPSQSSGRENHTRVIKVVPHNARSATESAARIFRSIQEGR  753



>ref|XP_003567779.1| PREDICTED: protein EARLY FLOWERING 3-like [Brachypodium distachyon]
Length=734

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 90/156 (58%), Gaps = 27/156 (17%)
 Frame = -2

Query  630  MPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QNSCNMPSQKNGDADVSDA  457
            MPVMN  VS SAVEQ+         ++++    N +V+H  +NSCNM      +A  +  
Sbjct  597  MPVMNPVVSASAVEQV---------SRIAPARPNAHVEHYSRNSCNM----RNEAMSAGI  643

Query  456  HRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP-PDTG  280
             R HA +D+E+QAS A+S    +P     G   G +  P  PTS   N     QP P TG
Sbjct  644  WRFHASRDSELQASSAAS----SPFDRQQGEARGPAAPPPIPTSSAGN----GQPQPSTG  695

Query  279  ---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
               +PA VIRVVPH AR+ASESAARIF+SIQ ER+Q
Sbjct  696  SKENPAGVIRVVPHTARTASESAARIFRSIQMERQQ  731



>ref|XP_011080316.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080323.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080331.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080336.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
 ref|XP_011080344.1| PREDICTED: protein EARLY FLOWERING 3-like [Sesamum indicum]
Length=756

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 93/174 (53%), Gaps = 22/174 (13%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRT---GSQAQVSGGGVNLNV  520
            QG+G  +   +G  YF PY MP++N++ S   VEQM S  R          S    N  V
Sbjct  599  QGIGHFYGTSLGQSYFQPYPMPLINASGSNPEVEQMISSARVQLAEPDKDSSTSNANFVV  658

Query  519  QHQNSCNMPSQKNGDADVSDAH-RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVL  343
              Q+ C   SQ++  A VS     LH  K ++ Q S A+SP+ R         +EG + L
Sbjct  659  PCQSPCKASSQQS--AVVSGCGGNLHLHKGSDGQCSSATSPAER---------LEGEA-L  706

Query  342  PLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             LFPT+P      +SQ        +VI+VVPHN +SA ESAARIFQSIQ+ERK+
Sbjct  707  SLFPTTP------SSQALRDQSKVKVIKVVPHNRKSAPESAARIFQSIQEERKK  754



>ref|XP_010924961.1| PREDICTED: protein EARLY FLOWERING 3-like [Elaeis guineensis]
 ref|XP_010924963.1| PREDICTED: protein EARLY FLOWERING 3-like [Elaeis guineensis]
Length=754

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 86/165 (52%), Gaps = 18/165 (11%)
 Frame = -2

Query  669  APPIGHGYFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP  493
            AP     YFP PYG+ V N  +S+SA EQ++    +    Q+         +H  S    
Sbjct  603  APATAPNYFPTPYGLHVANPIISSSADEQVSPLPGSKPNIQID--------RHSWSSGNM  654

Query  492  SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  313
                 +A      R  A KD+E+Q S ASSP  +A         EG   LPLFP +P  +
Sbjct  655  LHPRSEAFSGGLLRFQASKDSELQGSTASSPCEKA--------QEGTDALPLFPMAPATD  706

Query  312  -IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                +SQ     +   VI+VVPHNARSA+ESAARIF+SIQ+ER+Q
Sbjct  707  GPTRSSQFSGRDNQNLVIKVVPHNARSATESAARIFRSIQEERQQ  751



>gb|ABL11477.1| ELF3 protein [Triticum aestivum]
Length=769

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 95/178 (53%), Gaps = 26/178 (15%)
 Frame = -2

Query  681  GDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QN  508
            G P  PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +V+H  ++
Sbjct  604  GPPAMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVATARPNTHVEHHSRS  651

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
            SCNM   +N         R H+ + +E+Q +S ASSP  R  G   +      +     P
Sbjct  652  SCNM---RNEAVSAGGVWRFHSSRGSELQGSSAASSPFDRQQGQGEARGPAAAAPAAPLP  708

Query  330  TSPVVNIVDASQPPD--------TGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            TS   N   A QP              ARVIRVVPH AR+ASESAARIF+SIQ ER+Q
Sbjct  709  TSSAGNGNAAQQPQVSSSSQENPVAAAARVIRVVPHTARTASESAARIFRSIQMERQQ  766



>ref|XP_009407571.1| PREDICTED: protein EARLY FLOWERING 3-like [Musa acuminata subsp. 
malaccensis]
Length=685

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 88/159 (55%), Gaps = 18/159 (11%)
 Frame = -2

Query  648  YFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-QNSCNMPSQKNGD  475
            Y+P PYG    N  +STSAVEQ+++    GSQ     G      QH + SCNM      +
Sbjct  539  YYPTPYGHQAWNPIISTSAVEQVSNLA--GSQPNGQTG------QHSRRSCNMSPIPRKE  590

Query  474  ADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS-  298
            A      +    K++E Q S  +SPS +A        +E R    LFPT+P  + ++ S 
Sbjct  591  AFPGHVGKFQVSKNSEFQGSTVNSPSEKAQ-------LEERDQFLLFPTAPGASSLNCSL  643

Query  297  QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            Q   T    RVI+VVPHN+RSA+ESAARIF+SIQ+ R+Q
Sbjct  644  QSNGTDSQTRVIKVVPHNSRSATESAARIFRSIQEGRQQ  682



>ref|XP_009778080.1| PREDICTED: protein EARLY FLOWERING 3-like [Nicotiana sylvestris]
Length=767

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 89/159 (56%), Gaps = 21/159 (13%)
 Frame = -2

Query  639  PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQV---SGGGVNLNVQHQNSCNMPSQKNGDAD  469
            PY MPV+  + S+SA+EQMN F    S  +    S   VNL   H+  CN+  QK+  A 
Sbjct  620  PYPMPVIKPSGSSSAIEQMNPFPGIRSSERENSPSMHDVNLVRPHKKPCNISCQKS--AA  677

Query  468  VSDAHR-LHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQP  292
            +S+  R   A + +++Q S ASSPS +            R  L LFP +P     D  QP
Sbjct  678  MSECDRTFQAGRGSDMQGSSASSPSEKM----------QRDALSLFPITPTTKCSD--QP  725

Query  291  ---PDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
                +T    +VI+VVPHN +SASESAARIF+SIQ+ERK
Sbjct  726  VKDNNTEQRIQVIKVVPHNPKSASESAARIFRSIQEERK  764



>gb|AAQ73529.1| early flowering 3 [Mesembryanthemum crystallinum]
Length=705

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 100/169 (59%), Gaps = 13/169 (8%)
 Frame = -2

Query  657  GHGYFPPYGMPVMNSAVSTSAVEQMNSFTR----TGSQAQVSGGGVNLNVQHQNSCNMPS  490
            G GYFPPY MP+M+  +S SAV+QMN F+      G   Q + G VN  +QHQNSCN P 
Sbjct  534  GQGYFPPYPMPMMSPVMSGSAVDQMNQFSGGPNPFGQMNQPAAGSVNQTLQHQNSCNKPG  593

Query  489  QKNGDADVSDAHRLHACKDNEIQASC-ASSPSVR-APGVTVSGPMEGRSVLPLFP----T  328
            Q+   A  +    L + ++ E+Q S  +SSPS R A G   S P + R  LPL      T
Sbjct  594  QRRETAAPAAMAPL-SRREGELQGSTGSSSPSKRGAQGTGTSPPTKERDALPLPLPLFPT  652

Query  327  SPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +PV    + + P +    +RVI+VVPHN +S  ESAARIFQSIQ ER+Q
Sbjct  653  APVAEKSEGAPPVEKA--SRVIKVVPHNPKSTKESAARIFQSIQAERRQ  699



>gb|KEH39955.1| EARLY flowering protein, putative [Medicago truncatula]
Length=515

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 94/169 (56%), Gaps = 12/169 (7%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGV---NLNVQHQNS  505
            PF PP G+ YFPP+G+P M  + S SAVEQ+N F+  GS+ Q     +   N    +Q+S
Sbjct  351  PFIPPGGYPYFPPHGVPAMYQSASVSAVEQVNQFSAHGSRNQNGTSSLEEANFYTHNQSS  410

Query  504  CNMPSQKNGDADVSDAHRLHACKDN-EIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  328
            CN+ +QKNG         LH  K     +    SSP  +A  +      E R  L    T
Sbjct  411  CNLTNQKNGAT-------LHVRKPQPSRERELESSPGEKAQEIIKEKSAEERDTLSSSFT  463

Query  327  SPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             P+V+  +  +  +T    +VIRVVPHN RSA+ SAARIFQSIQ+ERK+
Sbjct  464  VPIVS-KEVLKSLETRQKPQVIRVVPHNPRSATVSAARIFQSIQEERKR  511



>gb|KEH39956.1| EARLY flowering protein, putative [Medicago truncatula]
Length=654

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 94/169 (56%), Gaps = 12/169 (7%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGV---NLNVQHQNS  505
            PF PP G+ YFPP+G+P M  + S SAVEQ+N F+  GS+ Q     +   N    +Q+S
Sbjct  490  PFIPPGGYPYFPPHGVPAMYQSASVSAVEQVNQFSAHGSRNQNGTSSLEEANFYTHNQSS  549

Query  504  CNMPSQKNGDADVSDAHRLHACKDN-EIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  328
            CN+ +QKNG         LH  K     +    SSP  +A  +      E R  L    T
Sbjct  550  CNLTNQKNGAT-------LHVRKPQPSRERELESSPGEKAQEIIKEKSAEERDTLSSSFT  602

Query  327  SPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             P+V+  +  +  +T    +VIRVVPHN RSA+ SAARIFQSIQ+ERK+
Sbjct  603  VPIVS-KEVLKSLETRQKPQVIRVVPHNPRSATVSAARIFQSIQEERKR  650



>gb|EYU20385.1| hypothetical protein MIMGU_mgv1a014747mg [Erythranthe guttata]
Length=179

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 82/159 (52%), Gaps = 39/159 (25%)
 Frame = -2

Query  654  HGYFPPYGMPVMN-SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNG  478
            HGYFPPY +P+M+ SA S    EQ      T      +G  V              QK+G
Sbjct  55   HGYFPPYCVPIMDTSAFSGPPPEQ------TIRAPAAAGPAV--------------QKSG  94

Query  477  DADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS  298
             A            D E+Q S ASSPS R    +     E R++LPLFPT+P    VDA 
Sbjct  95   PA----------LWDVEMQGSTASSPSGRRKRGSNGVEFERRNMLPLFPTTPAA--VDAL  142

Query  297  QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +P       RVI+VVP N  SASESAARIF++IQ+ER+Q
Sbjct  143  KP------TRVIKVVPRNGLSASESAARIFRTIQEEREQ  175



>gb|EYU29309.1| hypothetical protein MIMGU_mgv1a022839mg [Erythranthe guttata]
Length=621

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 86/163 (53%), Gaps = 41/163 (25%)
 Frame = -2

Query  663  PIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQK  484
            P  H YFPPYGMP+MN                +G  A      V++   + N  ++P   
Sbjct  494  PAHHPYFPPYGMPIMNPP------------PFSGPDAD----DVSIQCPNLNDSHVPE--  535

Query  483  NGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVD  304
              D +V+            +Q S  SS  V+  GV V      RSVL LFPTSP V+   
Sbjct  536  --DVEVA------------VQVSDVSSSPVQDSGVEV------RSVLQLFPTSPAVDDAA  575

Query  303  AS--QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
             S  +PP +G   +VI+VVPHNARSA+ESAARIFQSIQ+ERK+
Sbjct  576  WSSQRPPKSGQ-QQVIKVVPHNARSATESAARIFQSIQEERKR  617



>gb|AGT17012.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 93/201 (46%), Gaps = 50/201 (25%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ MPVMN     SAVEQ       GS A       ++  Q  
Sbjct  567  QHMVPPGAPAMHMNYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMEQQSL  619

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R  A +D+E QAS ASSP  R     +    +G   +  FP
Sbjct  620  ISCNM-------SHPSGIWRFLASRDSEPQASSASSPFDR-----LQAQGDGSGPVSFFP  667

Query  330  TSPVVNI---------------------------VDASQP-PDTG---HPARVIRVVPHN  244
            T+ V+N                            V  +QP P +G       VIRVVPHN
Sbjct  668  TASVLNAQPQPSSGGRDQQNHVIRVVPRNAQTASVPNAQPQPSSGGQDQQNHVIRVVPHN  727

Query  243  ARSASESAARIFQSIQKERKQ  181
            A++ASESAARIF+SIQ ERKQ
Sbjct  728  AQTASESAARIFRSIQMERKQ  748



>gb|AGT16064.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 93/201 (46%), Gaps = 50/201 (25%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ MPVMN     SAVEQ       GS A       ++  Q  
Sbjct  567  QHMVPPGAPAMHMNYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMEQQSL  619

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R  A +D+E QAS ASSP  R     +    +G   +  FP
Sbjct  620  ISCNM-------SHPSGIWRFLASRDSEPQASSASSPFDR-----LQAQGDGSGPVSFFP  667

Query  330  TSPVVNI---------------------------VDASQP-PDTG---HPARVIRVVPHN  244
            T+ V+N                            V  +QP P +G       VIRVVPHN
Sbjct  668  TASVLNAQPQPSSGGRDQQNHVIRVVPRNAQTASVPNAQPQPSSGGQDQQNHVIRVVPHN  727

Query  243  ARSASESAARIFQSIQKERKQ  181
            A++ASESAARIF+SIQ ERKQ
Sbjct  728  AQTASESAARIFRSIQMERKQ  748



>ref|XP_009384215.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384291.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384371.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384449.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 86/159 (54%), Gaps = 18/159 (11%)
 Frame = -2

Query  648  YFP-PYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-QNSCNMPSQKNGD  475
            Y+P PYG+   N  +STSAV+Q+++    GSQ     G      QH + SCNM      +
Sbjct  540  YYPTPYGLQAWNPIISTSAVKQVSNLA--GSQPSGQTG------QHSRRSCNMSPIPRKE  591

Query  474  ADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS-  298
            A    A +    K +E Q S  + PS +         +E R    LFPT+P  + ++   
Sbjct  592  AFPGHAGKFQVSKKSEFQGSTVNIPSEKTQ-------LEERDQFLLFPTAPGASSLNCPL  644

Query  297  QPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            Q   T    RVI+VVPHN+RSA+ESAARIF+SIQ+ R+Q
Sbjct  645  QSNGTDSQTRVIKVVPHNSRSATESAARIFRSIQEGRQQ  683



>ref|XP_011463349.1| PREDICTED: protein EARLY FLOWERING 3 [Fragaria vesca subsp. vesca]
Length=634

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 87/175 (50%), Gaps = 40/175 (23%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            QGMG    PP+   YFP Y  PV+N                +  +  +S G  N  + HQ
Sbjct  494  QGMGIG-TPPLLQTYFPTYTPPVIN---------------HSSHENPLSFGETNFTLPHQ  537

Query  510  NSCNMPSQKNGDADVSDAH--RLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPL  337
             SCNM +Q     +V   +   + A   NE+Q S  +SPS +  G          +VLPL
Sbjct  538  RSCNMSNQMR---EVMSYYMGNIPAPIVNELQGSTPNSPSDKTKG----------NVLPL  584

Query  336  FPTSP----VVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            FPT+P       I   S+     H +R I+V+PH+ RSA+ESAARIF SIQ+ERK
Sbjct  585  FPTAPQGEEFAEIEQMSE-----HQSRAIKVIPHSFRSATESAARIFLSIQEERK  634



>gb|AGT16850.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
 gb|AGT16896.1| hydroxyproline-rich glycoprotein family protein [Saccharum hybrid 
cultivar R570]
Length=751

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 93/201 (46%), Gaps = 50/201 (25%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ MPV+N     SAVEQ       GS A       ++  Q  
Sbjct  567  QHMVPPGAPAMHMNYFPPFSMPVINPGTPASAVEQ-------GSHAAAPQPHGHMEQQSL  619

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R  A +D+E QAS ASSP  R     +    +G   +  FP
Sbjct  620  ISCNM-------SHPSGIWRFLASRDSEPQASSASSPFDR-----LQAQGDGSGPVSFFP  667

Query  330  TSPVVNI---------------------------VDASQP-PDTG---HPARVIRVVPHN  244
            T+ V+N                            V  +QP P +G       VIRVVPHN
Sbjct  668  TASVLNAQPQPSSGGRDQQNHVIRVVPRNAQTASVPNAQPQPSSGGQDQQNHVIRVVPHN  727

Query  243  ARSASESAARIFQSIQKERKQ  181
            A++ASESAARIF+SIQ ERKQ
Sbjct  728  AQTASESAARIFRSIQMERKQ  748



>ref|XP_008673213.1| PREDICTED: uncharacterized protein LOC100383534 isoform X1 [Zea 
mays]
Length=633

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 94/203 (46%), Gaps = 52/203 (26%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ MPVMN     SAVEQ       GS A       +++ Q  
Sbjct  447  QHMVPPGAPAMHMNYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMDQQSL  499

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R  A +D+E QAS A+SP  R   + V G  +G + L  FP
Sbjct  500  ISCNM-------SHPSGVWRFLASRDSEPQASSATSPFDR---LQVQG--DGSAPLSFFP  547

Query  330  TSPVVNI-----------------------------VDASQP-PDTG---HPARVIRVVP  250
            T+   N+                             V  +QP P +G       VIRVVP
Sbjct  548  TASAPNVQPPPSSGGRDRDQQNHVIRVVPRNAQTASVPKAQPQPSSGGRDQKNHVIRVVP  607

Query  249  HNARSASESAARIFQSIQKERKQ  181
            HNA++ASESAA IF+SIQ ER Q
Sbjct  608  HNAQTASESAAWIFRSIQMERNQ  630



>ref|NP_001169653.1| uncharacterized protein LOC100383534 [Zea mays]
 gb|ACN34402.1| unknown [Zea mays]
 tpg|DAA58596.1| TPA: hypothetical protein ZEAMMB73_752966 [Zea mays]
Length=756

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 94/203 (46%), Gaps = 52/203 (26%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ MPVMN     SAVEQ       GS A       +++ Q  
Sbjct  570  QHMVPPGAPAMHMNYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPHGHMDQQSL  622

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R  A +D+E QAS A+SP  R   + V G  +G + L  FP
Sbjct  623  ISCNM-------SHPSGVWRFLASRDSEPQASSATSPFDR---LQVQG--DGSAPLSFFP  670

Query  330  TSPVVNI-----------------------------VDASQP-PDTG---HPARVIRVVP  250
            T+   N+                             V  +QP P +G       VIRVVP
Sbjct  671  TASAPNVQPPPSSGGRDRDQQNHVIRVVPRNAQTASVPKAQPQPSSGGRDQKNHVIRVVP  730

Query  249  HNARSASESAARIFQSIQKERKQ  181
            HNA++ASESAA IF+SIQ ER Q
Sbjct  731  HNAQTASESAAWIFRSIQMERNQ  753



>gb|KHN11326.1| Protein FAR1-RELATED SEQUENCE 11 [Glycine soja]
Length=1393

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 59/145 (41%), Positives = 78/145 (54%), Gaps = 13/145 (9%)
 Frame = -2

Query  615   SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACK  436
             S++S SA+EQM      G +   S G VN  + HQ+S NM S  +     + +   H+ K
Sbjct  1261  SSLSASAIEQMGQ--SNGPENHHSCGEVNSAILHQSSSNMSSPTSQMMSRNISTYHHSLK  1318

Query  435   DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRV  256
             D E+Q S ASSPS R  G            LPLFP +P        +     H  RVI+ 
Sbjct  1319  DKELQRSTASSPSKRMSG----------EALPLFPLAPTF-WQSEDRNTQVEHRPRVIKA  1367

Query  255   VPHNARSASESAARIFQSIQKERKQ  181
             +PHN ++ASESAARIF+SIQ+ERK 
Sbjct  1368  MPHNPKTASESAARIFRSIQEERKH  1392



>ref|XP_006585544.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006585545.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
 ref|XP_006585546.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Glycine 
max]
Length=707

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 80/146 (55%), Gaps = 17/146 (12%)
 Frame = -2

Query  615  SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNG--DADVSDAHRLHA  442
            S++S SA+EQM      G +   S G VN  + HQ+S NM S  +     ++S  H  H+
Sbjct  575  SSLSASAIEQMGQ--SNGPENHHSCGEVNSAILHQSSSNMSSPTSQMMSRNISTYH--HS  630

Query  441  CKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVI  262
             KD E+Q S ASSPS R  G            LPLFP +P        +     H  RVI
Sbjct  631  LKDKELQRSTASSPSKRMSG----------EALPLFPLAPTF-WQSEDRNTQVEHRPRVI  679

Query  261  RVVPHNARSASESAARIFQSIQKERK  184
            + +PHN ++ASESAARIF+SIQ+ERK
Sbjct  680  KAMPHNPKTASESAARIFRSIQEERK  705



>dbj|BAJ94845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=765

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 96/183 (52%), Gaps = 31/183 (17%)
 Frame = -2

Query  681  GDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QN  508
            G P  PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +++H  ++
Sbjct  595  GPPAMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHLEHHSRS  642

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
            SCNM   +N    V    R H+ + +E+Q +S ASSP  R  G   +      +     P
Sbjct  643  SCNM---RNEAVSVGGVWRFHSSRGSELQWSSAASSPFDRQQGQGEARGHAAAAPAAPLP  699

Query  330  TS-------------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  190
            TS             P V+      P      ARVIRVVPH AR+ASESAARIF+SIQ E
Sbjct  700  TSSSAGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSIQME  759

Query  189  RKQ  181
            R+Q
Sbjct  760  RQQ  762



>dbj|BAJ96537.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEW48247.1| early flowering 3 [Hordeum vulgare subsp. vulgare]
 gb|AEW48249.1| early flowering 3 [Hordeum vulgare]
Length=765

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 96/183 (52%), Gaps = 31/183 (17%)
 Frame = -2

Query  681  GDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QN  508
            G P  PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +++H  ++
Sbjct  595  GPPAMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHLEHHSRS  642

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
            SCNM   +N    V    R H+ + +E+Q +S ASSP  R  G   +      +     P
Sbjct  643  SCNM---RNEAVSVGGVWRFHSSRGSELQWSSAASSPFDRQQGQGEARGHAAAAPAAPLP  699

Query  330  TS-------------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKE  190
            TS             P V+      P      ARVIRVVPH AR+ASESAARIF+SIQ E
Sbjct  700  TSSSAGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSIQME  759

Query  189  RKQ  181
            R+Q
Sbjct  760  RQQ  762



>ref|XP_004498928.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Cicer arietinum]
Length=626

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 77/165 (47%), Gaps = 38/165 (23%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            PF PP  + +FPP+ +P MN + S S VEQ N              G  L++        
Sbjct  496  PFIPPGSYAHFPPHCVPAMNQSASGSVVEQKN--------------GATLHIT-------  534

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
                          +     + E+Q    S P+ +   + +    EGR  L    T+P V
Sbjct  535  --------------KFQPSIERELQGIPTSRPNEKE--IRIEKSAEGRDALSPSFTAPSV  578

Query  315  NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +  +  Q  +T    +VIRVVPHN RSAS SAARIFQSIQ+ERKQ
Sbjct  579  S-EEVFQSLETKQKPQVIRVVPHNPRSASVSAARIFQSIQEERKQ  622



>gb|EEE54823.1| hypothetical protein OsJ_02258 [Oryza sativa Japonica Group]
Length=742

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 93/175 (53%), Gaps = 30/175 (17%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN     SAVEQ     R  S  Q  G   NL    +
Sbjct  590  QHMGAPGTPTMPMNYFPPFSVPVMNPVALASAVEQ----GRHPSMPQPYG---NLEQHSR  642

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R      SGP+        FP
Sbjct  643  MSCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRL-QCGGSGPVSA------FP  688

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPH-NARSASESAARIFQSIQKERKQ  181
            T+   N    +QP P +G   +   VIRV+PH N+++ASESAARIF+SIQ ER+Q
Sbjct  689  TASAQN----TQPQPSSGSRDNQTNVIRVIPHNNSQTASESAARIFRSIQMERQQ  739



>gb|EAY99610.1| hypothetical protein OsI_21588 [Oryza sativa Indica Group]
 gb|AGW16339.1| Hd-q [Oryza sativa Indica Group]
 gb|AGW16340.1| Hd-q [Oryza sativa Indica Group]
 gb|AGW16341.1| Hd-q [Oryza sativa Indica Group]
Length=760

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 90/174 (52%), Gaps = 29/174 (17%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN       VEQ     R  S  Q  G   N   Q  
Sbjct  610  QHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHPSMPQPYG---NFEQQSW  662

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R    + SGP+        FP
Sbjct  663  ISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-QCSGSGPVSA------FP  708

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            T+   N    +QP P  G   +   VI+VVPHN+R+ASESAARIF+SIQ ER++
Sbjct  709  TASAQN----NQPQPSYGSRDNQTNVIKVVPHNSRTASESAARIFRSIQMERQR  758



>gb|AGW16337.1| Hd-q [Oryza sativa Japonica Group]
 gb|AGW16343.1| Hd-q [Oryza sativa Japonica Group]
Length=760

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 90/174 (52%), Gaps = 29/174 (17%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN       VEQ     R  S  Q  G   N   Q  
Sbjct  610  QHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHPSMPQPYG---NFEQQSW  662

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R    + SGP+        FP
Sbjct  663  ISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-QCSGSGPVSA------FP  708

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            T+   N    +QP P  G   +   VI+VVPHN+R+ASESAARIF+SIQ ER++
Sbjct  709  TASAQN----NQPQPSYGSRDNQTNVIKVVPHNSRTASESAARIFRSIQMERQR  758



>dbj|BAL63009.1| Hd17 [Oryza sativa Indica Group]
Length=760

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 90/174 (52%), Gaps = 29/174 (17%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN       VEQ     R  S  Q  G   N   Q  
Sbjct  610  QHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHPSMPQPYG---NFEQQSW  662

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R    + SGP+        FP
Sbjct  663  ISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-QCSGSGPVSA------FP  708

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            T+   N    +QP P  G   +   VI+VVPHN+R+ASESAARIF+SIQ ER++
Sbjct  709  TASAQN----NQPQPSYGSRDNQTNVIKVVPHNSRTASESAARIFRSIQMERQR  758



>gb|EEC70910.1| hypothetical protein OsI_02465 [Oryza sativa Indica Group]
Length=745

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 92/175 (53%), Gaps = 30/175 (17%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN     SAVEQ     R  S  Q  G   N     +
Sbjct  593  QHMGAPGTPTMPMNYFPPFSVPVMNPVALASAVEQ----GRNPSMPQPYG---NFEQHSR  645

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R      SGP+        FP
Sbjct  646  MSCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRL-QCGGSGPVSA------FP  691

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPH-NARSASESAARIFQSIQKERKQ  181
            T+   N    +QP P +G   +   VIRV+PH N+++ASESAARIF+SIQ ER+Q
Sbjct  692  TASAQN----TQPQPSSGSRDNQTNVIRVIPHNNSQTASESAARIFRSIQMERQQ  742



>gb|AEZ53982.1| early flowering protein 3 [Hordeum vulgare subsp. vulgare]
Length=765

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 93/182 (51%), Gaps = 30/182 (16%)
 Frame = -2

Query  681  GDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH-QNS  505
            G P  PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +  H ++S
Sbjct  596  GPPAMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHEHHSRSS  643

Query  504  CNMPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  328
            CNM   +N    V    R H+ + +E+Q +S AS P  R  G   +      +     PT
Sbjct  644  CNM---RNEAVSVGGVWRFHSSRGSELQGSSAASGPFDRQQGQGEARGHAAAAPAAPLPT  700

Query  327  S-------------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKER  187
            S             P V+      P      ARVIRVVPH AR+ASESAARIF+SIQ ER
Sbjct  701  SSSAGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSIQMER  760

Query  186  KQ  181
            +Q
Sbjct  761  QQ  762



>gb|KEH18269.1| early flowering protein, putative [Medicago truncatula]
Length=730

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 82/161 (51%), Gaps = 24/161 (15%)
 Frame = -2

Query  645  FPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADV  466
             PP     M+ ++S S+VEQM      G +   S   +N  + +Q+  NM +Q       
Sbjct  585  LPPCVPSFMHRSISASSVEQMAQ--SNGPKNHYSSAELNSTILYQSPSNMSTQI-SHVMA  641

Query  465  SDAHRLHACKDN-EIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV------NIV  307
             +     + +DN E+Q S A+SPS R            R  LPLFP +P        + +
Sbjct  642  RNFSPYQSLEDNKELQISIANSPSKRMK----------RDELPLFPLAPTFWSSPDRDSI  691

Query  306  DASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            D  Q     H +RVI+ +PHN +SASESAA+IF+SIQ+ERK
Sbjct  692  DEHQE----HHSRVIKALPHNPKSASESAAKIFKSIQEERK  728



>gb|KHN39274.1| Protein EARLY FLOWERING 3 [Glycine soja]
Length=685

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 85/165 (52%), Gaps = 33/165 (20%)
 Frame = -2

Query  639  PYGMP--VMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCN--------M  496
            P+ +P   MN  S++S SAVEQM      G +   S G VN  +  Q+S N        M
Sbjct  541  PHFLPPSFMNHPSSISASAVEQMGQ--SNGPENHHSWGEVNSAILFQSSSNMSSPTSQVM  598

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
            P       ++S  H  H+ KD E+Q S ASSPS R  G            LPLFP +P  
Sbjct  599  PR------NISTYH--HSLKDKELQRSTASSPSKRVSG----------EALPLFPLAPTF  640

Query  315  NIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
               + +       P RVI+ +PHN ++ASE+AA+IF+SIQ+ERK 
Sbjct  641  WQSEDTNTQVEQQP-RVIKAMPHNPKTASETAAKIFRSIQEERKH  684



>dbj|BAL63008.1| Hd17 [Oryza sativa Japonica Group]
 dbj|BAM09630.1| ELF3-like protein [Oryza sativa Japonica Group]
Length=760

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 84/170 (49%), Gaps = 21/170 (12%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN       VEQ     R  S  Q  G   N   Q  
Sbjct  610  QHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHPSMPQPYG---NFEQQSW  662

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R    + SGP+        FP
Sbjct  663  ISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-QCSGSGPVSA------FP  708

Query  330  TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            T    N           +   VI+VVPHN+R+ASESAARIF+SIQ ER++
Sbjct  709  TVSAQNNQPQPSYSSRDNQTNVIKVVPHNSRTASESAARIFRSIQMERQR  758



>dbj|BAA83571.1| putative early flowering 3 [Oryza sativa Japonica Group]
 gb|EAZ35794.1| hypothetical protein OsJ_20086 [Oryza sativa Japonica Group]
 dbj|BAL63007.1| Hd17 [Oryza sativa Japonica Group]
 gb|AGW16338.1| Hd-q [Oryza sativa Japonica Group]
 gb|AGW16342.1| Hd-q [Oryza sativa Indica Group]
Length=760

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 84/170 (49%), Gaps = 21/170 (12%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN       VEQ     R  S  Q  G   N   Q  
Sbjct  610  QHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQ----GRHPSMPQPYG---NFEQQSW  662

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R    + SGP+        FP
Sbjct  663  ISCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRF-QCSGSGPVSA------FP  708

Query  330  TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            T    N           +   VI+VVPHN+R+ASESAARIF+SIQ ER++
Sbjct  709  TVSAQNNQPQPSYSSRDNQTNVIKVVPHNSRTASESAARIFRSIQMERQR  758



>ref|XP_007135598.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135600.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135601.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07592.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07594.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07595.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
Length=655

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 76/144 (53%), Gaps = 13/144 (9%)
 Frame = -2

Query  615  SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACK  436
            S++S SAVEQM      G +   S G VN  + +Q+S N+ S         +    H+ K
Sbjct  523  SSISASAVEQMGQ--SNGPENHNSCGEVNSAIIYQSSSNI-SSPTSQVMSRNISTHHSPK  579

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRV  256
            D E Q S ASSPS R         M    VLPLFP +P     +         P RVI+ 
Sbjct  580  DKEPQRSTASSPSKR---------MSAAEVLPLFPLAPTFWQTEDRNTQVELQP-RVIKA  629

Query  255  VPHNARSASESAARIFQSIQKERK  184
            +PHN +SASESAARIF+SIQ+ERK
Sbjct  630  MPHNPKSASESAARIFRSIQEERK  653



>ref|XP_007135599.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135602.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 ref|XP_007135603.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07593.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07596.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
 gb|ESW07597.1| hypothetical protein PHAVU_010G142900g [Phaseolus vulgaris]
Length=662

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 76/144 (53%), Gaps = 13/144 (9%)
 Frame = -2

Query  615  SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACK  436
            S++S SAVEQM      G +   S G VN  + +Q+S N+ S         +    H+ K
Sbjct  530  SSISASAVEQMGQ--SNGPENHNSCGEVNSAIIYQSSSNI-SSPTSQVMSRNISTHHSPK  586

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRV  256
            D E Q S ASSPS R         M    VLPLFP +P     +         P RVI+ 
Sbjct  587  DKEPQRSTASSPSKR---------MSAAEVLPLFPLAPTFWQTEDRNTQVELQP-RVIKA  636

Query  255  VPHNARSASESAARIFQSIQKERK  184
            +PHN +SASESAARIF+SIQ+ERK
Sbjct  637  MPHNPKSASESAARIFRSIQEERK  660



>ref|XP_004510333.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Cicer arietinum]
 ref|XP_004510334.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Cicer arietinum]
 ref|XP_004510335.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Cicer arietinum]
Length=702

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 86/163 (53%), Gaps = 22/163 (13%)
 Frame = -2

Query  651  GYFPPYGMP------VMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQN-SCNMP  493
            G F    +P       M+ ++S SA+EQM   +  G++   S    N    +Q  S NM 
Sbjct  553  GIFSSSSLPQLLPTSFMHRSISASAIEQMEQ-SNYGTKNHQS----NAEFMYQTPSSNMS  607

Query  492  SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  313
            +Q +     + ++      + E+Q S ASSPS R         M+G   LPLFP +P + 
Sbjct  608  TQISQVMSRNISNYQSYEDNKELQISRASSPSKR---------MKGVDELPLFPVAPTL-  657

Query  312  IVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
               + +     + +RVI+ +PHNA+SASESAARIF+SIQ+ERK
Sbjct  658  WPSSDRDTRVENQSRVIKALPHNAKSASESAARIFKSIQEERK  700



>gb|AEW48248.1| early flowering 3 [Hordeum vulgare subsp. vulgare]
Length=765

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 94/186 (51%), Gaps = 37/186 (20%)
 Frame = -2

Query  681  GDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH--QN  508
            G P  PP+   YFPP+ +PVMN  VS+SAVEQ+         ++V+    N +++H  ++
Sbjct  595  GPPAMPPM---YFPPFSVPVMNPVVSSSAVEQV---------SRVAAARPNTHLEHHSRS  642

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQ-ASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
            SCNM   +N    V    R H+ + +E+Q +S ASSP  R  G    G   G +      
Sbjct  643  SCNM---RNEAVSVGGVWRFHSSRGSELQGSSAASSPFDRQQG---QGEARGHAAAAPAA  696

Query  330  TS----------------PVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSI  199
                              P V+      P      ARVIRVVPH AR+ASESAARIF+SI
Sbjct  697  PPPTSSSAGNGNGNAAQQPQVSSGSQENPVAAAAAARVIRVVPHTARTASESAARIFRSI  756

Query  198  QKERKQ  181
            Q ER+Q
Sbjct  757  QMERQQ  762



>ref|XP_006583036.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X4 [Glycine 
max]
Length=679

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 84/160 (53%), Gaps = 22/160 (14%)
 Frame = -2

Query  648  YFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVN--LNVQHQNSCNMPSQKN  481
            + PP     MN  S++S SAVEQM      G +   S G VN  +  Q  ++ + P+ + 
Sbjct  537  FLPP---SFMNHPSSISASAVEQMGQ--SNGPENHHSWGEVNSAILFQSSSNMSSPTSQV  591

Query  480  GDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDA  301
               ++S  H  H+ +D E+  S ASSPS R  G            LPLFP +P     + 
Sbjct  592  MPRNISTYH--HSLQDKELHRSTASSPSKRVSG----------EALPLFPLAPTCWQSED  639

Query  300  SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            +       P RVI+ +PHN ++ASE+AA+IF+SIQ+ERK 
Sbjct  640  TNTQVEQQP-RVIKAMPHNPKTASETAAKIFRSIQEERKH  678



>ref|XP_006583035.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X3 [Glycine 
max]
Length=686

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 84/159 (53%), Gaps = 22/159 (14%)
 Frame = -2

Query  648  YFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVN--LNVQHQNSCNMPSQKN  481
            + PP     MN  S++S SAVEQM      G +   S G VN  +  Q  ++ + P+ + 
Sbjct  544  FLPP---SFMNHPSSISASAVEQMGQ--SNGPENHHSWGEVNSAILFQSSSNMSSPTSQV  598

Query  480  GDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDA  301
               ++S  H  H+ +D E+  S ASSPS R  G            LPLFP +P     + 
Sbjct  599  MPRNISTYH--HSLQDKELHRSTASSPSKRVSG----------EALPLFPLAPTCWQSED  646

Query  300  SQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
            +       P RVI+ +PHN ++ASE+AA+IF+SIQ+ERK
Sbjct  647  TNTQVEQQP-RVIKAMPHNPKTASETAAKIFRSIQEERK  684



>ref|XP_006583033.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Glycine 
max]
 ref|XP_006583034.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Glycine 
max]
Length=709

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 83/165 (50%), Gaps = 34/165 (21%)
 Frame = -2

Query  648  YFPPYGMPVMN--SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCN--------  499
            + PP     MN  S++S SAVEQM      G +   S G VN  +  Q+S N        
Sbjct  567  FLPP---SFMNHPSSISASAVEQMGQ--SNGPENHHSWGEVNSAILFQSSSNMSSPTSQV  621

Query  498  MPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV  319
            MP       ++S  H  H+ +D E+  S ASSPS R  G            LPLFP +P 
Sbjct  622  MPR------NISTYH--HSLQDKELHRSTASSPSKRVSG----------EALPLFPLAPT  663

Query  318  VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
                + +       P RVI+ +PHN ++ASE+AA+IF+SIQ+ERK
Sbjct  664  CWQSEDTNTQVEQQP-RVIKAMPHNPKTASETAAKIFRSIQEERK  707



>ref|XP_006646013.1| PREDICTED: protein EARLY FLOWERING 3-like [Oryza brachyantha]
Length=721

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 87/172 (51%), Gaps = 28/172 (16%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN     S  EQ     R  S  Q  G   N      
Sbjct  570  QHMGAPGPPAMPMNYFPPFSIPVMNPGAPASMAEQ----GRHPSMPQPYG---NFEQHSW  622

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             S NM       +  S   R HA +D+E QAS ASSP  R   +   G    R V   FP
Sbjct  623  ISGNM-------SHPSGIWRFHASRDSEAQASSASSPFDR---LQCGG---SRPVSAAFP  669

Query  330  TSPVVNIVDASQP-PDTG---HPARVIRVVPHNARSASESAARIFQSIQKER  187
            T+   N    +QP P +G   +   VIRVVPHN+R+ASESAARIF+SIQ+ER
Sbjct  670  TASAQN----TQPQPSSGSQDNQTIVIRVVPHNSRTASESAARIFRSIQRER  717



>emb|CDO97951.1| unnamed protein product [Coffea canephora]
Length=758

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 86/163 (53%), Gaps = 21/163 (13%)
 Frame = -2

Query  645  FPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA----QVSGGGVNLNVQHQNSCNMPSQKNG  478
            F P+ +PVMN+  S+SA EQ + F    S      +V+   +N  + +++   + S + G
Sbjct  607  FQPHALPVMNTENSSSAAEQTSPFVTARSSRPDNHRVATYDINYIIPYRSLDAITSHRTG  666

Query  477  DADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDAS  298
               ++D+ R+      ++  SC+  P   A  +      +  S+ P+ PT      V  S
Sbjct  667  I--MTDSTRIM-----QVSKSCSDFPGSTASNLDERVQADELSLFPMTPT------VQRS  713

Query  297  QPP----DTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            + P    +     +VI+VVPHN +SASESAARIF+SIQ+E+KQ
Sbjct  714  KHPMQNNNNEQQIQVIKVVPHNPKSASESAARIFRSIQEEKKQ  756



>ref|XP_006646014.1| PREDICTED: protein EARLY FLOWERING 3-like [Oryza brachyantha]
Length=690

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 85/171 (50%), Gaps = 22/171 (13%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q MG P  P +   YFPP+ +PVMN      AVEQ     R  S  Q  G   N     +
Sbjct  538  QFMGVPGTPTMPMNYFPPFSVPVMNPVALAPAVEQ----GRHPSMPQPYG---NFEQHSR  590

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R HA +D+E QAS ASSP  R      SGP+        FP
Sbjct  591  MSCNM-------SHPSGIWRFHASRDSEAQASSASSPFDRL-QCGGSGPVSS------FP  636

Query  330  TSPVVNIVDASQPPDTGHPARVIRVVPH-NARSASESAARIFQSIQKERKQ  181
            T+   N           +   VI+VVPH N+++ASESAARIF+SIQ ER++
Sbjct  637  TASAQNAQPQLSSGSRDNQTNVIKVVPHDNSQTASESAARIFRSIQMERQR  687



>ref|NP_180164.1| protein EARLY FLOWERING 3 [Arabidopsis thaliana]
 sp|O82804.1|ELF3_ARATH RecName: Full=Protein EARLY FLOWERING 3; AltName: Full=Nematode-responsive 
protein [Arabidopsis thaliana]
 gb|AAC31242.1| unknown protein [Arabidopsis thaliana]
 gb|AAM15042.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07774.1| protein EARLY FLOWERING 3 [Arabidopsis thaliana]
Length=695

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 87/195 (45%), Gaps = 47/195 (24%)
 Frame = -2

Query  687  GMGDPFAPPIGHGYFPPYGM--PVMNSAVSTSAV------EQMNSFTRTGSQAQVSGGGV  532
            GMG    PP G+GYFPPYGM   +MN   S+         EQMN F   G+         
Sbjct  516  GMG---FPPPGNGYFPPYGMMPTIMNPYCSSQQQQQQQPNEQMNQFGHPGNLQ-------  565

Query  531  NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAP-GVTVSGPMEG  355
            N   Q Q S N P+ +          R    +    Q S  SSPS   P G++ S     
Sbjct  566  NTQQQQQRSDNEPAPQQQQQPTKSYPRARKSR----QGSTGSSPS--GPQGISGS-----  614

Query  354  RSVLPLFPTSPVVNIVDASQPP-----------------DTGHPARVIRVVPHNARSASE  226
            +S  P        NI +A +                   D G   RVI+VVPHNA+ ASE
Sbjct  615  KSFRPFAAVDEDSNINNAPEQTMTTTTTTTRTTVTQTTRDGGGVTRVIKVVPHNAKLASE  674

Query  225  SAARIFQSIQKERKQ  181
            +AARIFQSIQ+ERK+
Sbjct  675  NAARIFQSIQEERKR  689



>gb|AEK05758.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05759.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05760.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05761.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05762.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05764.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05765.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05766.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05767.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05768.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05769.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05770.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05771.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05772.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05773.1| early flowering 3, partial [Populus balsamifera]
 gb|AEK05774.1| early flowering 3, partial [Populus balsamifera]
Length=261

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 16/123 (13%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNLNVQHQNS  505
            P  P  G  +F P+GMPVMN ++  SAVEQ++   R G Q+   Q++ G +N N+  Q+S
Sbjct  139  PGNPHFGQTFFQPFGMPVMNPSICDSAVEQIS--PRIGPQSKDNQLAVGDINFNIPLQSS  196

Query  504  CNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS  325
            CNM +Q +              K++EIQ S A S S           M   + LPLFP  
Sbjct  197  CNMSNQMSRVISCC-VENFQGLKESEIQRSSAGSLSK----------MPKANALPLFPME  245

Query  324  PVV  316
            P +
Sbjct  246  PTL  248



>gb|AEK05757.1| early flowering 3, partial [Populus balsamifera]
Length=261

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 16/123 (13%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNLNVQHQNS  505
            P  P  G  +F P+GMPVMN ++  SAVEQ++   R G Q+   Q++ G +N N+  Q+S
Sbjct  139  PGNPHFGQTFFQPFGMPVMNPSICDSAVEQIS--PRIGPQSKDNQLAVGDINFNIPLQSS  196

Query  504  CNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS  325
            CNM +Q +              K++EIQ S A S S           M   + LPLFP  
Sbjct  197  CNMSNQMSRVISCC-VENFQGLKESEIQRSSAGSLSK----------MPKANALPLFPME  245

Query  324  PVV  316
            P +
Sbjct  246  PTL  248



>ref|XP_002458017.1| hypothetical protein SORBIDRAFT_03g025560 [Sorghum bicolor]
 gb|EES03137.1| hypothetical protein SORBIDRAFT_03g025560 [Sorghum bicolor]
Length=782

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 73/156 (47%), Gaps = 23/156 (15%)
 Frame = -2

Query  690  QGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQ  511
            Q M  P AP +   YFPP+ MPVMN     SAVEQ       GS A       ++  Q  
Sbjct  567  QQMVPPGAPAMHMNYFPPFSMPVMNPGTPASAVEQ-------GSHAAAPQPQGHMEQQSL  619

Query  510  NSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             SCNM       +  S   R  A +D+E QAS ASSP  R     +    +G   +  FP
Sbjct  620  ISCNM-------SHPSGIWRFLASRDSEPQASSASSPFDR-----LEAQGDGSGPVSFFP  667

Query  330  TSPVVNIVDASQPPDTGHPAR--VIRVVPHNARSAS  229
             + V+N     QP   G   +  VIRVVP NA++AS
Sbjct  668  KASVLNA--QPQPSSGGRDQQNHVIRVVPRNAQTAS  701


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  267  VIRVVPHNARSASESAARIFQSIQKERKQ  181
            VIRVVPHNA++ASESAARIF+SIQ ERKQ
Sbjct  751  VIRVVPHNAQTASESAARIFRSIQMERKQ  779



>ref|XP_010429612.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=706

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 88/201 (44%), Gaps = 46/201 (23%)
 Frame = -2

Query  687  GMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAVEQ-----MNSFTRTGSQAQVSGGGVN-  529
            G+G  F P   +GYFPPYG MP M +   +   +Q     MN F   G+  Q     +N 
Sbjct  513  GIG--FPPHPSNGYFPPYGIMPTMMNPYCSGQQQQPNEQHMNQFGYPGNFQQQPNEHMNQ  570

Query  528  -------LNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVS  370
                    N Q Q+S N  + +          R    +    Q S  SSPS R  G+ V+
Sbjct  571  FVHPGNLRNTQQQSSVNEAAAQEQQQPTKSYPRARKSR----QGSTGSSPSGRE-GIAVN  625

Query  369  GPMEGRSVLPLFPTSPVVNIVDASQPPDT------------------GHPARVIRVVPHN  244
                 +S  P        NI   ++P D                   G   RVI+VVPHN
Sbjct  626  -----KSFRPFSAVDDSNNI--NNEPEDMTTTTTTTTRTTVTQTTRDGGVTRVIKVVPHN  678

Query  243  ARSASESAARIFQSIQKERKQ  181
            A+ ASE+AARIF+SIQ+ERK+
Sbjct  679  AKLASENAARIFRSIQEERKR  699



>gb|AEK05763.1| early flowering 3, partial [Populus balsamifera]
Length=261

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 16/123 (13%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA---QVSGGGVNLNVQHQNS  505
            P  P  G  +F P+GMPVMN ++  SAVEQ+    R G Q+   Q++ G  N N+  Q+S
Sbjct  139  PGNPHFGQTFFQPFGMPVMNPSICDSAVEQIX--PRIGPQSKDNQLAVGDXNFNIPLQSS  196

Query  504  CNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTS  325
            CNM +Q +              K++EIQ S A S S           M   + LPLFP  
Sbjct  197  CNMSNQMSRVISCC-VENFQGLKESEIQXSSAGSLSK----------MPKANALPLFPME  245

Query  324  PVV  316
            P +
Sbjct  246  PTL  248



>ref|XP_006853900.1| hypothetical protein AMTR_s00036p00168840 [Amborella trichopoda]
 gb|ERN15367.1| hypothetical protein AMTR_s00036p00168840 [Amborella trichopoda]
Length=784

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 62/126 (49%), Gaps = 23/126 (18%)
 Frame = -2

Query  558  QAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGV  379
            Q    GGG N +  +++          +A      ++   ++ EIQ S ASSP       
Sbjct  679  QQDREGGGFNTSSDYRS----------EAFSCSGWKVQGPRETEIQGSTASSP-------  721

Query  378  TVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSI  199
               G  E    LPLF      + VD   P +      VIRVVPHNARSA+ESAARIFQSI
Sbjct  722  -CEGGGERTDALPLFLMG---SAVDEETPQE--RRGVVIRVVPHNARSATESAARIFQSI  775

Query  198  QKERKQ  181
            Q+ R+Q
Sbjct  776  QEGRQQ  781



>ref|XP_002878908.1| hypothetical protein ARALYDRAFT_481449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55167.1| hypothetical protein ARALYDRAFT_481449 [Arabidopsis lyrata subsp. 
lyrata]
Length=686

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 85/194 (44%), Gaps = 47/194 (24%)
 Frame = -2

Query  687  GMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAV-------EQMNSFTRTG----SQAQVS  544
            GMG    PP G+GYFPPYG MP M +   +          +QMN F   G    +Q Q S
Sbjct  509  GMG---FPPPGNGYFPPYGIMPTMMNPYCSGQQQQQQQPNDQMNQFGHHGNLQNTQQQQS  565

Query  543  GGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGP  364
                   +QHQ     P++    A  S             Q S  SSPS   P   +SG 
Sbjct  566  SVNAAAALQHQ----QPTKSYPRARKSR------------QGSTGSSPS--GPQ-GISGS  606

Query  363  MEGRSVLPLFPTSPVVNIVD-------------ASQPPDTGHPARVIRVVPHNARSASES  223
               R    +   S + N  +                  D G   RVI+VVPHNA+ ASE+
Sbjct  607  KSFRPFSAVDEDSKINNAPEQMMTTTTTTSTTVTQTTRDGGGVTRVIKVVPHNAKLASEN  666

Query  222  AARIFQSIQKERKQ  181
            AARIFQSIQ+ER++
Sbjct  667  AARIFQSIQEERQR  680



>ref|XP_010466369.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
 ref|XP_010466370.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=533

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 47/89 (53%), Gaps = 16/89 (18%)
 Frame = -2

Query  447  HACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV--VNIVDASQPPDTGHP  274
            H   D+E+  S ASSP  +              VL LFPT P    +     Q P    P
Sbjct  451  HESNDSEVHGSTASSPPEK----------HKFEVLQLFPTEPTHQTDEYKEKQQP----P  496

Query  273  ARVIRVVPHNARSASESAARIFQSIQKER  187
             R I+ +PHN+ SASESAARIF+SIQ+ER
Sbjct  497  LRAIKAIPHNSTSASESAARIFRSIQEER  525



>ref|XP_006297383.1| hypothetical protein CARUB_v10013409mg [Capsella rubella]
 gb|EOA30281.1| hypothetical protein CARUB_v10013409mg [Capsella rubella]
Length=538

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 48/86 (56%), Gaps = 14/86 (16%)
 Frame = -2

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPA-RVIR  259
            D+E+  S ASSP  +              VLPLFPT P     +  Q      P  R I+
Sbjct  460  DSEVHGSTASSPPEK----------HKFEVLPLFPTEPTHQTDECKQ---KQQPLLRAIK  506

Query  258  VVPHNARSASESAARIFQSIQKERKQ  181
             +PHN+ SASESAARIF+SIQ+ER++
Sbjct  507  AIPHNSTSASESAARIFRSIQEERRE  532



>ref|XP_009109631.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Brassica 
rapa]
 ref|XP_009109639.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Brassica 
rapa]
Length=518

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 14/85 (16%)
 Frame = -2

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHP-ARVIR  259
            D+E+  S ASSP  +              VLPLFPT P  +  +  Q      P +R I+
Sbjct  440  DSEVHGSTASSPPEK----------HKFDVLPLFPTEPTHHTDEYEQ---KQQPMSRAIK  486

Query  258  VVPHNARSASESAARIFQSIQKERK  184
             +PHN+ SASESAARIF+SIQ+ER+
Sbjct  487  AIPHNSTSASESAARIFRSIQEERR  511



>emb|CDY51450.1| BnaA05g36670D [Brassica napus]
Length=536

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = -2

Query  384  GVTVSGPMEGRS--VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARI  211
            G T S P E     VLPLFPT P  +  +  Q     H  R I+ +PHN+ SASESAARI
Sbjct  463  GSTASSPPEKHKFDVLPLFPTEPTHHNDEHEQKQQPLH--RAIKAIPHNSTSASESAARI  520

Query  210  FQSIQKERK  184
            F+SIQ+ER+
Sbjct  521  FRSIQEERR  529



>ref|XP_009109647.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Brassica 
rapa]
Length=517

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 14/85 (16%)
 Frame = -2

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHP-ARVIR  259
            D+E+  S ASSP  +              VLPLFPT P  +  +  Q      P +R I+
Sbjct  439  DSEVHGSTASSPPEK----------HKFDVLPLFPTEPTHHTDEYEQ---KQQPMSRAIK  485

Query  258  VVPHNARSASESAARIFQSIQKERK  184
             +PHN+ SASESAARIF+SIQ+ER+
Sbjct  486  AIPHNSTSASESAARIFRSIQEERR  510



>ref|XP_009145486.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=536

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = -2

Query  384  GVTVSGPMEGRS--VLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARI  211
            G T S P E     VLPLFPT P  +  +  Q     H  R I+ +PHN+ SASESAARI
Sbjct  463  GSTASSPPEKHKFDVLPLFPTEPTHHNDEHEQKQQPLH--RAIKAIPHNSTSASESAARI  520

Query  210  FQSIQKERK  184
            F+SIQ+ER+
Sbjct  521  FRSIQEERR  529



>emb|CDY62750.1| BnaC01g43670D [Brassica napus]
Length=489

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 49/86 (57%), Gaps = 16/86 (19%)
 Frame = -2

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPV--VNIVDASQPPDTGHPARVI  262
            D+E+  S ASSP  +              VLPLFPT P    +  +  Q P +G     I
Sbjct  411  DSEVHGSTASSPPEK----------HKFDVLPLFPTEPTHHTDEYEQKQQPFSG----AI  456

Query  261  RVVPHNARSASESAARIFQSIQKERK  184
            + +PHN+ SASESAARIF+SIQ+ER+
Sbjct  457  KAIPHNSTSASESAARIFRSIQEERR  482



>gb|AAX23847.1| hypothetical protein At3g21320 [Arabidopsis thaliana]
Length=348

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 69/165 (42%), Gaps = 40/165 (24%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P + P  H YFPP      N+  +         F R  + +      +  +++       
Sbjct  216  PVSSPFSHSYFPP-----PNARTTVDQTNPFGQFQRWSNTSSHMTQAIPFSLKK------  264

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
             SQ++ D+D              I  S ASSP  +              VLPLFPT P  
Sbjct  265  -SQESNDSD--------------IHGSTASSPPEK----------HKLEVLPLFPTEPTH  299

Query  315  NIVDASQPPDTGHP-ARVIRVVPHNARSASESAARIFQSIQKERK  184
               +  Q      P  R I+ VPHN+ SASESAARIF+ IQ+ER+
Sbjct  300  QTDEYKQ---KQQPMLRAIKAVPHNSTSASESAARIFRFIQEERR  341



>ref|NP_188769.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAV68859.1| hypothetical protein AT3G21320 [Arabidopsis thaliana]
 gb|AEE76492.1| uncharacterized protein AT3G21320 [Arabidopsis thaliana]
Length=540

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 67/165 (41%), Gaps = 40/165 (24%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P + P  H YFPP          + + V+Q N F                  Q Q   N 
Sbjct  408  PVSSPFSHSYFPPPN--------ARTTVDQTNPFG-----------------QFQRWSNT  442

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
             S        S   +     D++I  S ASSP  +              VLPLFPT P  
Sbjct  443  SSHMTQAIPFS-LKKSQESNDSDIHGSTASSPPEK----------HKLEVLPLFPTEPTH  491

Query  315  NIVDASQPPDTGHP-ARVIRVVPHNARSASESAARIFQSIQKERK  184
               +  Q      P  R I+ VPHN+ SASESAARIF+ IQ+ER+
Sbjct  492  QTDEYKQ---KQQPMLRAIKAVPHNSTSASESAARIFRFIQEERR  533



>ref|XP_010526158.1| PREDICTED: protein EARLY FLOWERING 3-like [Tarenaya hassleriana]
Length=664

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 80/184 (43%), Gaps = 56/184 (30%)
 Frame = -2

Query  675  PFAPPIGH-GYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCN  499
            P+ P IG  GYFPPY  P +N   S                      G   +VQ Q+SCN
Sbjct  512  PYHPGIGFSGYFPPYSGPTVNPNFS----------------------GHLEDVQQQSSCN  549

Query  498  MPSQKNGDADVSDAHRLHACKDNEIQASC----ASSPSVRAPGVTVSGPMEGRSVLPLFP  331
             P+               A    + Q+SC    A++P    P VT   P    S   +  
Sbjct  550  FPT---------------AAAQPQPQSSCNFPNAATPPQPRPLVTKPRPWNRESSRVMQG  594

Query  330  TS-------------PVVNIVDASQPPDTGHPA-RVIRVVPHNARSASESAARIFQSIQK  193
             S             P+V   + S+  +    A RVI+VVPHN ++ASESAARIF+SIQ+
Sbjct  595  RSGSGPGSGMSRSALPLVRAAENSRGNERLLAATRVIKVVPHNPKAASESAARIFRSIQE  654

Query  192  ERKQ  181
            ERKQ
Sbjct  655  ERKQ  658



>emb|CAA72719.1| nematode responsive protein [Arabidopsis thaliana]
Length=702

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 87/202 (43%), Gaps = 54/202 (27%)
 Frame = -2

Query  687  GMGDPFAPPIGHGYFPPYGM--PVMNSAVSTSAV------EQMNSFTRTGSQAQVSGGGV  532
            GMG    PP G+GYFPPYGM   +MN   S+         EQMN F   G+         
Sbjct  516  GMG---FPPPGNGYFPPYGMMPTIMNPYCSSQQQQQQQPNEQMNQFGHPGNLQ-------  565

Query  531  NLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAP-GVTVSGPMEG  355
            N   Q Q S N P+ +          R    +    Q S  SSPS   P G++ S     
Sbjct  566  NTQQQQQRSDNEPAPQQQQQPTKSYPRARKSR----QGSTGSSPS--GPQGISGS-----  614

Query  354  RSVLPLFPTSPVVNIVDASQPP-----------------DTGHPARVIRVVPHNARS---  235
            +S  P        NI +A +                   D G   RVI+VVPHNA+    
Sbjct  615  KSFGPFAAVDEDSNINNAPEQTMTTTTTTTRTTVTQTTRDGGGVTRVIKVVPHNAKVVPH  674

Query  234  ----ASESAARIFQSIQKERKQ  181
                ASE+AARIFQSIQ+ERK+
Sbjct  675  NAKLASENAARIFQSIQEERKR  696



>dbj|BAB01726.1| unnamed protein product [Arabidopsis thaliana]
Length=623

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 67/165 (41%), Gaps = 40/165 (24%)
 Frame = -2

Query  675  PFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNM  496
            P + P  H YFPP          + + V+Q N F                  Q Q   N 
Sbjct  491  PVSSPFSHSYFPPPN--------ARTTVDQTNPFG-----------------QFQRWSNT  525

Query  495  PSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
             S        S   +     D++I  S ASSP  +              VLPLFPT P  
Sbjct  526  SSHMTQAIPFS-LKKSQESNDSDIHGSTASSPPEK----------HKLEVLPLFPTEPTH  574

Query  315  NIVDASQPPDTGHP-ARVIRVVPHNARSASESAARIFQSIQKERK  184
               +  Q      P  R I+ VPHN+ SASESAARIF+ IQ+ER+
Sbjct  575  QTDEYKQ---KQQPMLRAIKAVPHNSTSASESAARIFRFIQEERR  616



>ref|XP_010510094.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
 ref|XP_010510102.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=533

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 45/83 (54%), Gaps = 12/83 (14%)
 Frame = -2

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRV  256
            D+E+  S ASSP  +              VL LFPT P     +  Q      P R I+ 
Sbjct  455  DSEVHGSTASSPPEK----------HKFEVLQLFPTEPTHQTDEYKQ--KQQPPLRAIKA  502

Query  255  VPHNARSASESAARIFQSIQKER  187
            +PHN+ SASESAARIF+SIQ+ER
Sbjct  503  IPHNSTSASESAARIFRSIQEER  525



>ref|XP_010526070.1| PREDICTED: protein EARLY FLOWERING 3 [Tarenaya hassleriana]
Length=679

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 82/177 (46%), Gaps = 34/177 (19%)
 Frame = -2

Query  648  YFPPYGMPVMNSAVS-------TSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMPS  490
            Y P Y +P MN   S           EQMN      + +        ++ Q Q+SCN PS
Sbjct  511  YLPHYAVPSMNVNFSGQHHHHHHHHSEQMNQLVHPNTPS------ATMSAQQQSSCNFPS  564

Query  489  QKNGDADVSDAHRLHACKDNEIQASCAS-SPSVRAP-----GVTVSGPMEGRSVLPLFPT  328
              N + +V+      A    + Q+  A   P  R       G T S P +  + + LFPT
Sbjct  565  -SNNNTNVA------ATTQPQPQSRLAKPRPRKRESNRVLQGSTGSSPGDSGNAVRLFPT  617

Query  327  --------SPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
                    +  +    A++    G   RVI+VVPHN ++ASESAARIF+SIQ+ERKQ
Sbjct  618  GENNRGSLTMTMTTTTATKGAAAGIGTRVIKVVPHNPKAASESAARIFRSIQEERKQ  674



>ref|XP_006406284.1| hypothetical protein EUTSA_v10020453mg [Eutrema salsugineum]
 gb|ESQ47737.1| hypothetical protein EUTSA_v10020453mg [Eutrema salsugineum]
Length=547

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 14/85 (16%)
 Frame = -2

Query  435  DNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPA-RVIR  259
            D+E+  S ASSP  +              VLPLFPT P  +  +     +   P  R I+
Sbjct  469  DSEVHGSTASSPPEK----------HKFEVLPLFPTEPTHHTDEYK---EKQQPLFRAIK  515

Query  258  VVPHNARSASESAARIFQSIQKERK  184
             +PHN+ SASESAARIF+SIQ+ER+
Sbjct  516  AIPHNSTSASESAARIFRSIQEERR  540



>gb|AEK26570.1| early flowering 3 [Populus tremula]
Length=261

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 59/118 (50%), Gaps = 12/118 (10%)
 Frame = -2

Query  666  PPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQA-QVSGGGVNLNVQHQNSCNMPS  490
            P  G  +F P+GMPVMN ++  SAV Q++      S+  Q++ G +N N+  Q+SCNM +
Sbjct  142  PHFGQTFFQPFGMPVMNPSIRDSAVGQISPPIGPQSKDNQLAVGDINSNIPLQSSCNMSN  201

Query  489  QKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVV  316
            Q +       A      K++EIQ S A S S           M   + LPLFP  P +
Sbjct  202  QMSRVISCC-AENFQGLKESEIQGSSAGSLSK----------MPKANALPLFPMEPTL  248



>gb|KEH39953.1| EARLY flowering protein, putative [Medicago truncatula]
Length=479

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query  423  QASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHN  244
            +    SSP  +A  +      E R  L    T P+V+  +  +  +T    +VIRVVPHN
Sbjct  396  ERELESSPGEKAQEIIKEKSAEERDTLSSSFTVPIVS-KEVLKSLETRQKPQVIRVVPHN  454

Query  243  ARSASESAARIFQSIQKERKQ  181
             RSA+ SAARIFQSIQ+ERK+
Sbjct  455  PRSATVSAARIFQSIQEERKR  475



>ref|XP_010417373.1| PREDICTED: protein EARLY FLOWERING 3-like [Camelina sativa]
Length=713

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 84/204 (41%), Gaps = 49/204 (24%)
 Frame = -2

Query  687  GMGDPFAPPIGHGYFPPYG-MPVMNSAVSTSAVEQ------MNSFTRTGS----------  559
            G+G  F P   +GYFPPYG MP M +   +   +Q      MN F   G+          
Sbjct  517  GIG--FPPHPSNGYFPPYGIMPTMMNPYCSGQQQQPPNEQHMNQFGYPGNFQHQQQPNEH  574

Query  558  QAQVSGGGVNLNVQHQNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGV  379
              Q    G   N Q Q+S N  + +          R    +    Q S  SSPS      
Sbjct  575  MNQFVCPGNLQNTQQQSSVNEAAAQEQQQPTKSYPRARKSR----QGSTGSSPS------  624

Query  378  TVSGPMEGRSVLPLFPTSPVVNIVDASQPPDT------------------GHPARVIRVV  253
             V G    +S  P        NI +  +P D                   G   RVI+VV
Sbjct  625  GVEGIAGNKSFRPFSTIDDSNNINN--EPEDMMTTTTTTTRTTVTQTTRDGGVTRVIKVV  682

Query  252  PHNARSASESAARIFQSIQKERKQ  181
            PHNA+ ASE+AARIF+SIQ+ERK+
Sbjct  683  PHNAKLASENAARIFRSIQEERKR  706



>emb|CDY32422.1| BnaC03g42060D [Brassica napus]
Length=491

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 71/167 (43%), Gaps = 44/167 (26%)
 Frame = -2

Query  684  MGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQ-AQVSGGGVNLNVQHQN  508
            +G P +  + H YFPP       S   T+   Q+  ++ T S   Q S   +        
Sbjct  360  LGFPVSTQLNHSYFPPTN--ARTSLDQTNPFGQLQRWSNTSSHVTQASPFSLK-------  410

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPT  328
                 SQ++ D+DV                S ASSP  +              VLPLFPT
Sbjct  411  ----KSQESNDSDV--------------HGSTASSPPEK----------HKLDVLPLFPT  442

Query  327  SPV--VNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQK  193
             P    N  +  + P      R I+ +PHN+ SASESAARIF+SIQ+
Sbjct  443  KPTHHTNEYEEKEKPL----RRAIKAIPHNSTSASESAARIFRSIQE  485



>gb|KEH39954.1| EARLY flowering protein, putative [Medicago truncatula]
Length=618

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query  423  QASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHN  244
            +    SSP  +A  +      E R  L    T P+V+  +  +  +T    +VIRVVPHN
Sbjct  535  ERELESSPGEKAQEIIKEKSAEERDTLSSSFTVPIVS-KEVLKSLETRQKPQVIRVVPHN  593

Query  243  ARSASESAARIFQSIQKERKQ  181
             RSA+ SAARIFQSIQ+ERK+
Sbjct  594  PRSATVSAARIFQSIQEERKR  614



>emb|CDY35321.1| BnaA04g15260D [Brassica napus]
Length=599

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 75/181 (41%), Gaps = 56/181 (31%)
 Frame = -2

Query  651  GYFPPYGMPVMN-----SAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQHQNSCNMP-S  490
            GYFPPYGM  MN             EQMN F               +N Q Q+S N   S
Sbjct  441  GYFPPYGM--MNPYGSGHQQQQQPSEQMNQFVHP------------VNTQQQSSVNEAIS  486

Query  489  QKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVNI  310
            Q+        A +         Q S  SSP  R P        EG S    F    VV+ 
Sbjct  487  QQQPTKSYPRARKSR-------QRSTGSSP--RGP--------EGISDTNSFRPFSVVDD  529

Query  309  VDASQPP-------------------DTGHPARVIRVVPHNARSASESAARIFQSIQKER  187
             D ++P                    D G   RVI+VVPHNA+ ASE+AARIF+SIQ+ER
Sbjct  530  DDNNEPEQMMTTTTTTTRTTVTQTTRDGGAVTRVIKVVPHNAKLASENAARIFRSIQEER  589

Query  186  K  184
            K
Sbjct  590  K  590



>ref|XP_009140718.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=602

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 77/182 (42%), Gaps = 58/182 (32%)
 Frame = -2

Query  651  GYFPPYGMPVMN-----SAVSTSAVEQMNSFTR-TGSQAQVSGGGVNLNV-QHQNSCNMP  493
            GYFPPYGM  MN             EQMN F     +Q Q+S   VN  + Q Q + + P
Sbjct  444  GYFPPYGM--MNPYGSGHQQQQQPSEQMNQFVHPVNTQQQIS---VNEAISQQQPTKSYP  498

Query  492  SQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSPVVN  313
              +                    Q S  SSP  R P        EG S    F    VV+
Sbjct  499  RARKSR-----------------QRSTGSSP--RGP--------EGISDTNSFRPLSVVD  531

Query  312  IVDASQPP-------------------DTGHPARVIRVVPHNARSASESAARIFQSIQKE  190
              D ++P                    D G   RVI+VVPHNA+ ASE+AARIF+SIQ+E
Sbjct  532  DDDNNEPEQMMTTTTTTTRTTVTQTTRDGGAVTRVIKVVPHNAKLASENAARIFRSIQEE  591

Query  189  RK  184
            RK
Sbjct  592  RK  593



>ref|XP_010545644.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Tarenaya 
hassleriana]
Length=532

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 49/88 (56%), Gaps = 19/88 (22%)
 Frame = -2

Query  438  KDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP----VVNIVDASQPPDTGHPA  271
            KD+++Q S ASSP  R            R VLPLFPT P    +   V   Q P   HP 
Sbjct  450  KDSDVQGSTASSPPER----------HKRQVLPLFPTEPTRQNLETDVHGQQEP--LHP-  496

Query  270  RVIRVVPHNARSASESAARIFQSIQKER  187
              I+  P+ + SASESAARIF++IQ+ER
Sbjct  497  --IKTTPYTSTSASESAARIFRTIQEER  522



>gb|AFK35699.1| unknown [Medicago truncatula]
Length=183

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 55/110 (50%), Gaps = 9/110 (8%)
 Frame = -2

Query  507  SCNMPSQKNGDADVSDAHRLHACKDNEI-QASCASSPSVRAPGVTVSGPMEGRSVLPLFP  331
            S +   QKNG         LH  K     +    SSP  +A  +      E R  L    
Sbjct  78   SVSAVEQKNGAT-------LHVRKPQPFRERELESSPGEKAQEIIKEKFAEERDTLFFSF  130

Query  330  TSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            T P+V+  +  +  +T    +VIRVVPHN R A+ SAARIFQSIQ+ERK+
Sbjct  131  TVPIVS-KEVLKSLETRQKPQVIRVVPHNPRFATVSAARIFQSIQEERKR  179



>ref|XP_010545643.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Tarenaya 
hassleriana]
Length=600

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 49/88 (56%), Gaps = 19/88 (22%)
 Frame = -2

Query  438  KDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLFPTSP----VVNIVDASQPPDTGHPA  271
            KD+++Q S ASSP  R            R VLPLFPT P    +   V   Q P   HP 
Sbjct  518  KDSDVQGSTASSPPER----------HKRQVLPLFPTEPTRQNLETDVHGQQEP--LHP-  564

Query  270  RVIRVVPHNARSASESAARIFQSIQKER  187
              I+  P+ + SASESAARIF++IQ+ER
Sbjct  565  --IKTTPYTSTSASESAARIFRTIQEER  590



>emb|CDY56915.1| BnaCnng31360D [Brassica napus]
Length=538

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = -2

Query  384  GVTVSGPMEG--RSVLPLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARI  211
            G T S P E     VLPLFPT P  +  +           R I+ +PHN+ SASESAARI
Sbjct  463  GSTASSPPEKPKFDVLPLFPTEPTHHNDEHEHEQKQQPLHRAIKAIPHNSTSASESAARI  522

Query  210  FQSIQKERK  184
            F+SIQ+ER+
Sbjct  523  FRSIQEERR  531



>ref|XP_002885435.1| hypothetical protein ARALYDRAFT_342282 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61694.1| hypothetical protein ARALYDRAFT_342282 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 70/171 (41%), Gaps = 15/171 (9%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            Y+    P  PP      P YG   + +A       Q +        A+ +    N   Q+
Sbjct  371  YKPYAGPCPPPSSAFMVPVYGQDSIETAFRFPVSSQFSHSYFPPPNARTTVDQTNPFGQY  430

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRSVLPLF  334
            Q   N  S        S   +     D++I  S ASSP  +              VLPLF
Sbjct  431  QRWSNTSSHMTQAIPFS-LKKSQESNDSDIHGSTASSPPEK----------HKFEVLPLF  479

Query  333  PTSPVVNIVDASQPPDTGHPA-RVIRVVPHNARSASESAARIFQSIQKERK  184
            PT P     +     +   P  R I+ VPH + SASESAARIF+SIQ+ER+
Sbjct  480  PTEPTHQTDEYK---EKQQPVLRAIKAVPHTSTSASESAARIFRSIQEERR  527



>gb|KFK29903.1| early flowering 3 [Arabis alpina]
Length=625

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 77/173 (45%), Gaps = 37/173 (21%)
 Frame = -2

Query  687  GMGDP-FAPPIGH-GYFPPYGMPVMNSAVSTSAVEQ-MNSFTRTGSQAQVSGGGVNLNVQ  517
            G+ +P F P +G   YFPPYGMP  N +      EQ +N F+  G+   +    +N   Q
Sbjct  481  GLPNPAFHPGVGFPSYFPPYGMP--NPSWQQPPTEQTVNQFSHPGN---LHNPAMNTQQQ  535

Query  516  HQ-NSCNMPSQKNGDADVSDAHRLHACKDNEIQAS-CASSPSVRAPGVTVSGPMEGRSVL  343
             Q +SCN P   N       A+R               S P +R           G    
Sbjct  536  QQQSSCNFPPNSN------TANRAATTPQPHPHPPPIRSQPRIRESS-------NGSEPQ  582

Query  342  PLFPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQKERK  184
             L  T+ V                RVIRVVPHNAR ASE+AARIFQSIQ+ERK
Sbjct  583  RLAKTTTVA--------------TRVIRVVPHNARLASENAARIFQSIQEERK  621



>emb|CDY48882.1| BnaA03g36210D [Brassica napus]
Length=490

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 71/168 (42%), Gaps = 15/168 (9%)
 Frame = -2

Query  693  YQGMGDPFAPPIGHGYFPPYGMPVMNSAVSTSAVEQMNSFTRTGSQAQVSGGGVNLNVQH  514
            Y+    P  PP      P YG   +N  +      Q++        A+ S    N   Q 
Sbjct  331  YKPYAGPSPPPSSAFMVPFYGQDSLNPTLGFPVSTQLSHNYFPQPNARTSLDQTNPFGQL  390

Query  513  QNSCNMPSQKNGDADVSDAHRLHACKDNEIQASCASSPSVRAPGVTVSGPMEGRS-VLPL  337
            Q   N  S        S   +     D+++  S ASSP           P + +S VLPL
Sbjct  391  QRWSNTSSHMTQAVPFS-LKKSQESNDSDVHGSTASSP-----------PEKHKSDVLPL  438

Query  336  FPTSPVVNIVDASQPPDTGHPARVIRVVPHNARSASESAARIFQSIQK  193
            FPT P  +  +  Q        R IR +PHN+ SASESAARIF+SIQ+
Sbjct  439  FPTEPTHHTDEYEQKQKPMR--RAIRAIPHNSTSASESAARIFRSIQE  484



>ref|XP_008650078.1| PREDICTED: protein EARLY FLOWERING 3-like [Zea mays]
 gb|AFW79357.1| hypothetical protein ZEAMMB73_525396 [Zea mays]
Length=647

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  270  RVIRVVPHNARSASESAARIFQSIQKERKQ  181
            RVIRVVPH AR+ASESAARIF+SIQ ERKQ
Sbjct  615  RVIRVVPHTARTASESAARIFRSIQMERKQ  644



>ref|XP_010488142.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Camelina 
sativa]
 ref|XP_010488143.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X1 [Camelina 
sativa]
Length=533

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 40/70 (57%), Gaps = 8/70 (11%)
 Frame = -2

Query  384  GVTVSGPMEGRS--VLPLFPTSPV--VNIVDASQPPDTGHPARVIRVVPHNARSASESAA  217
            G T S P E     VL LFPT P    +     Q P    P R I+ +PHN+ S SESAA
Sbjct  460  GSTASSPPENHKFEVLQLFPTEPTHHTDEYKEKQQP----PLRAIKAIPHNSTSVSESAA  515

Query  216  RIFQSIQKER  187
            RIF+SIQ+ER
Sbjct  516  RIFRSIQEER  525



>ref|XP_010488144.1| PREDICTED: protein EARLY FLOWERING 3-like isoform X2 [Camelina 
sativa]
Length=530

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 40/70 (57%), Gaps = 8/70 (11%)
 Frame = -2

Query  384  GVTVSGPMEGRS--VLPLFPTSPV--VNIVDASQPPDTGHPARVIRVVPHNARSASESAA  217
            G T S P E     VL LFPT P    +     Q P    P R I+ +PHN+ S SESAA
Sbjct  457  GSTASSPPENHKFEVLQLFPTEPTHHTDEYKEKQQP----PLRAIKAIPHNSTSVSESAA  512

Query  216  RIFQSIQKER  187
            RIF+SIQ+ER
Sbjct  513  RIFRSIQEER  522



>emb|CDY66493.1| BnaCnng51090D [Brassica napus]
Length=553

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  288  DTGHPARVIRVVPHNARSASESAARIFQSIQKERKQ  181
            D G   RVI+VVPHNA+ ASE+AARIF+SIQ+ERK 
Sbjct  510  DGGGVTRVIKVVPHNAKLASENAARIFRSIQEERKH  545



>dbj|BAD97872.1| ELF3 homologue [Lemna gibba]
Length=470

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  276  PARVIRVVPHNARSASESAARIFQSIQKERK  184
            PARVI+VVP N +SASESA RIFQ+IQKER+
Sbjct  435  PARVIKVVPRNPKSASESAVRIFQTIQKERQ  465



>ref|XP_009135744.1| PREDICTED: protein EARLY FLOWERING 3-like [Brassica rapa]
Length=522

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 39/68 (57%), Gaps = 8/68 (12%)
 Frame = -2

Query  384  GVTVSGPMEGRS--VLPLFPTSPV--VNIVDASQPPDTGHPARVIRVVPHNARSASESAA  217
            G T S P E     VLPLFPT P    +  +  Q P      R IR +PHN+ SASESAA
Sbjct  453  GSTASSPPEKHKSDVLPLFPTKPTHHTDEYEQKQKPM----CRAIRAIPHNSTSASESAA  508

Query  216  RIFQSIQK  193
            R F+SIQ+
Sbjct  509  RSFRSIQE  516



>emb|CDY11505.1| BnaA09g40710D [Brassica napus]
Length=592

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  270  RVIRVVPHNARSASESAARIFQSIQKERKQ  181
            RVI+VVPHNA  ASE+AARIF+SIQ+ERKQ
Sbjct  560  RVIKVVPHNANLASENAARIFRSIQEERKQ  589



>ref|XP_009117036.1| PREDICTED: protein EARLY FLOWERING 3 [Brassica rapa]
Length=628

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  270  RVIRVVPHNARSASESAARIFQSIQKERKQ  181
            RVI+VVPHNA  ASE+AARIF+SIQ+ERKQ
Sbjct  596  RVIKVVPHNANLASENAARIFRSIQEERKQ  625



>ref|NP_001288828.1| protein EARLY FLOWERING 3 [Brassica rapa]
 gb|AEB33726.1| EARLY FLOWERING 3 [Brassica rapa]
Length=628

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  270  RVIRVVPHNARSASESAARIFQSIQKERKQ  181
            RVI+VVPHNA  ASE+AARIF+SIQ+ERKQ
Sbjct  596  RVIKVVPHNANLASENAARIFRSIQEERKQ  625



>ref|XP_006293368.1| hypothetical protein CARUB_v10022728mg [Capsella rubella]
 gb|EOA26266.1| hypothetical protein CARUB_v10022728mg [Capsella rubella]
Length=722

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  273  ARVIRVVPHNARSASESAARIFQSIQKERK  184
             RVI+VVPHNA+ ASE+AARIF+SIQ+ERK
Sbjct  685  TRVIKVVPHNAKLASENAARIFRSIQEERK  714



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340