BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028F08

Length=774
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011082185.1|  PREDICTED: uncharacterized protein LOC105165...    252   2e-75   Sesamum indicum [beniseed]
ref|XP_008348925.1|  PREDICTED: uncharacterized protein LOC103412105    237   3e-75   
ref|XP_011082184.1|  PREDICTED: uncharacterized protein LOC105165...    252   4e-75   Sesamum indicum [beniseed]
ref|XP_011082183.1|  PREDICTED: uncharacterized protein LOC105165...    252   4e-75   Sesamum indicum [beniseed]
gb|KDP31566.1|  hypothetical protein JCGZ_15383                         246   8e-73   Jatropha curcas
ref|XP_007210882.1|  hypothetical protein PRUPE_ppa002815mg             245   1e-72   Prunus persica
gb|KJB25105.1|  hypothetical protein B456_004G177500                    241   3e-72   Gossypium raimondii
gb|KJB25103.1|  hypothetical protein B456_004G177500                    241   3e-72   Gossypium raimondii
ref|XP_004300682.1|  PREDICTED: uncharacterized protein LOC101298609    243   4e-72   Fragaria vesca subsp. vesca
gb|KJB25104.1|  hypothetical protein B456_004G177500                    243   7e-72   Gossypium raimondii
gb|KJB25102.1|  hypothetical protein B456_004G177500                    243   9e-72   Gossypium raimondii
emb|CBI29197.3|  unnamed protein product                                243   1e-71   Vitis vinifera
ref|XP_002269181.2|  PREDICTED: uncharacterized protein LOC100263017    242   2e-71   Vitis vinifera
ref|XP_010518959.1|  PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D...    241   4e-71   Tarenaya hassleriana [spider flower]
ref|XP_006385158.1|  hypothetical protein POPTR_0004s24390g             240   7e-71   
ref|XP_008365916.1|  PREDICTED: uncharacterized protein LOC103429...    240   1e-70   
ref|XP_007040865.1|  Xyloglucanase 113 isoform 1                        239   2e-70   
ref|XP_009769854.1|  PREDICTED: uncharacterized protein LOC104220660    238   5e-70   Nicotiana sylvestris
ref|XP_007156344.1|  hypothetical protein PHAVU_003G278600g             225   5e-70   Phaseolus vulgaris [French bean]
ref|XP_004142646.1|  PREDICTED: uncharacterized protein LOC101203732    238   6e-70   Cucumis sativus [cucumbers]
emb|CDP07209.1|  unnamed protein product                                238   7e-70   Coffea canephora [robusta coffee]
ref|XP_002519934.1|  reticulon3-A3, putative                            238   7e-70   Ricinus communis
gb|EYU37484.1|  hypothetical protein MIMGU_mgv1a002766mg                237   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_009141501.1|  PREDICTED: uncharacterized protein LOC103865...    237   1e-69   Brassica rapa
ref|XP_009143647.1|  PREDICTED: uncharacterized protein LOC103867343    237   1e-69   Brassica rapa
ref|XP_009603199.1|  PREDICTED: uncharacterized protein LOC104098231    237   1e-69   Nicotiana tomentosiformis
ref|XP_009141500.1|  PREDICTED: uncharacterized protein LOC103865...    237   1e-69   Brassica rapa
ref|XP_009362859.1|  PREDICTED: uncharacterized protein LOC103952897    236   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_004246017.1|  PREDICTED: uncharacterized protein LOC101254412    236   2e-69   Solanum lycopersicum
ref|XP_010111777.1|  hypothetical protein L484_008781                   236   4e-69   Morus notabilis
gb|AAD15452.2|  unknown protein                                         233   6e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444233.1|  PREDICTED: uncharacterized protein LOC103487624    235   1e-68   Cucumis melo [Oriental melon]
ref|XP_006410719.1|  hypothetical protein EUTSA_v10016368mg             234   1e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010266425.1|  PREDICTED: uncharacterized protein LOC104603...    234   1e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006359953.1|  PREDICTED: uncharacterized protein LOC102605...    234   2e-68   Solanum tuberosum [potatoes]
ref|XP_010266424.1|  PREDICTED: uncharacterized protein LOC104603...    234   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010056116.1|  PREDICTED: uncharacterized protein LOC104444...    234   2e-68   
ref|XP_010056115.1|  PREDICTED: uncharacterized protein LOC104444...    234   2e-68   Eucalyptus grandis [rose gum]
dbj|BAD94473.1|  hypothetical protein                                   219   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KJB51493.1|  hypothetical protein B456_008G219000                    233   4e-68   Gossypium raimondii
emb|CDP07210.1|  unnamed protein product                                234   5e-68   Coffea canephora [robusta coffee]
ref|XP_011028505.1|  PREDICTED: uncharacterized protein LOC105128...    233   6e-68   Populus euphratica
ref|XP_011028504.1|  PREDICTED: uncharacterized protein LOC105128...    233   6e-68   Populus euphratica
ref|XP_003517099.1|  PREDICTED: uncharacterized protein LOC100776463    232   6e-68   Glycine max [soybeans]
gb|KHG12903.1|  hypothetical protein F383_16835                         231   1e-67   Gossypium arboreum [tree cotton]
ref|XP_006293822.1|  hypothetical protein CARUB_v10022808mg             231   2e-67   Capsella rubella
ref|XP_010516741.1|  PREDICTED: uncharacterized protein LOC104792321    231   3e-67   Camelina sativa [gold-of-pleasure]
emb|CDP12729.1|  unnamed protein product                                229   9e-67   Coffea canephora [robusta coffee]
ref|XP_010505074.1|  PREDICTED: uncharacterized protein LOC104781967    229   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_007158076.1|  hypothetical protein PHAVU_002G122000g             229   1e-66   Phaseolus vulgaris [French bean]
gb|KFK36454.1|  hypothetical protein AALP_AA4G126700                    228   3e-66   Arabis alpina [alpine rockcress]
ref|XP_003612490.1|  hypothetical protein MTR_5g025590                  228   4e-66   
ref|XP_006430896.1|  hypothetical protein CICLE_v10011269mg             228   5e-66   Citrus clementina [clementine]
ref|XP_009388198.1|  PREDICTED: uncharacterized protein LOC103975012    214   6e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388312.1|  PREDICTED: uncharacterized protein LOC103975128    213   7e-66   
ref|XP_010509590.1|  PREDICTED: uncharacterized protein LOC104785987    227   1e-65   Camelina sativa [gold-of-pleasure]
emb|CDY32116.1|  BnaC04g44500D                                          225   3e-65   Brassica napus [oilseed rape]
ref|XP_010676705.1|  PREDICTED: uncharacterized protein LOC104892...    223   4e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676704.1|  PREDICTED: uncharacterized protein LOC104892...    223   5e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006590766.1|  PREDICTED: uncharacterized protein LOC100789338    224   6e-65   Glycine max [soybeans]
ref|XP_006359954.1|  PREDICTED: uncharacterized protein LOC102605...    224   7e-65   Solanum tuberosum [potatoes]
ref|XP_006482352.1|  PREDICTED: uncharacterized protein LOC102613765    224   9e-65   Citrus sinensis [apfelsine]
ref|XP_009381925.1|  PREDICTED: uncharacterized protein LOC103970025    211   9e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804433.1|  PREDICTED: uncharacterized protein LOC103717721    218   9e-65   
gb|KDO72261.1|  hypothetical protein CISIN_1g036925mg                   224   9e-65   Citrus sinensis [apfelsine]
gb|AES95448.2|  nucleotide-diphospho-sugar transferase family pro...    224   1e-64   Medicago truncatula
ref|XP_010676703.1|  PREDICTED: uncharacterized protein LOC104892...    223   2e-64   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP12731.1|  unnamed protein product                                223   4e-64   Coffea canephora [robusta coffee]
ref|NP_850250.1|  xyloglucanase 113                                     222   6e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40459.1|  BnaA04g20580D                                          221   1e-63   Brassica napus [oilseed rape]
ref|XP_004512439.1|  PREDICTED: uncharacterized protein LOC101497257    220   2e-63   
dbj|BAH19600.1|  AT2G35610                                              220   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003547737.1|  PREDICTED: uncharacterized protein LOC100780346    219   6e-63   Glycine max [soybeans]
gb|KHN05539.1|  hypothetical protein glysoja_020504                     219   9e-63   Glycine soja [wild soybean]
ref|XP_004509491.1|  PREDICTED: uncharacterized protein LOC101505601    218   1e-62   Cicer arietinum [garbanzo]
gb|AET03500.2|  nucleotide-diphospho-sugar transferase family pro...    218   2e-62   Medicago truncatula
ref|XP_003548765.1|  PREDICTED: uncharacterized protein LOC100819032    218   3e-62   Glycine max [soybeans]
ref|XP_003629024.1|  hypothetical protein MTR_8g072310                  218   3e-62   
ref|XP_002881404.1|  hypothetical protein ARALYDRAFT_902666             217   4e-62   
ref|XP_010907097.1|  PREDICTED: uncharacterized protein LOC105033...    215   2e-61   Elaeis guineensis
ref|XP_010907098.1|  PREDICTED: uncharacterized protein LOC105033...    215   2e-61   Elaeis guineensis
emb|CDY31704.1|  BnaA05g08430D                                          213   1e-60   Brassica napus [oilseed rape]
gb|KHN27499.1|  hypothetical protein glysoja_018611                     213   1e-60   Glycine soja [wild soybean]
ref|XP_006878624.1|  hypothetical protein AMTR_s00011p00260650          212   3e-60   Amborella trichopoda
emb|CDX84192.1|  BnaC04g09540D                                          210   1e-59   
ref|XP_009383104.1|  PREDICTED: uncharacterized protein LOC103970914    210   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS68350.1|  hypothetical protein M569_06419                         194   6e-54   Genlisea aurea
ref|XP_003562333.1|  PREDICTED: uncharacterized protein LOC100845970    194   9e-54   Brachypodium distachyon [annual false brome]
ref|XP_006650304.1|  PREDICTED: uncharacterized protein LOC102706084    194   1e-53   Oryza brachyantha
ref|XP_009383108.1|  PREDICTED: uncharacterized protein LOC103970917    186   1e-53   
ref|XP_002464281.1|  hypothetical protein SORBIDRAFT_01g015590          193   2e-53   Sorghum bicolor [broomcorn]
gb|EPS58524.1|  hypothetical protein M569_16289                         189   2e-53   Genlisea aurea
gb|KHG12902.1|  hypothetical protein F383_16835                         192   4e-53   Gossypium arboreum [tree cotton]
gb|ABF97349.1|  expressed protein                                       192   8e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75649.1|  hypothetical protein OsI_12401                          192   8e-53   Oryza sativa Indica Group [Indian rice]
gb|EEE59420.1|  hypothetical protein OsJ_11574                          192   9e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982506.1|  PREDICTED: uncharacterized protein LOC101753789    191   1e-52   Setaria italica
ref|XP_010540709.1|  PREDICTED: uncharacterized protein LOC104814389    189   6e-52   Tarenaya hassleriana [spider flower]
ref|NP_001143144.1|  hypothetical protein                               188   2e-51   Zea mays [maize]
ref|XP_010235552.1|  PREDICTED: uncharacterized protein LOC100829311    187   4e-51   
gb|KHF98530.1|  hypothetical protein F383_12515                         184   3e-50   Gossypium arboreum [tree cotton]
emb|CDP12730.1|  unnamed protein product                                182   2e-49   Coffea canephora [robusta coffee]
gb|EPS68351.1|  hypothetical protein M569_06420                         157   5e-45   Genlisea aurea
gb|KHN03113.1|  hypothetical protein glysoja_049543                     162   4e-42   Glycine soja [wild soybean]
ref|XP_002988322.1|  glycosyltransferase-like protein                   159   2e-41   
gb|KHN41773.1|  Pentatricopeptide repeat-containing protein, mito...    162   6e-41   Glycine soja [wild soybean]
ref|XP_002991425.1|  glycosyltransferase-like protein                   153   3e-39   
ref|XP_001761094.1|  predicted protein                                  144   5e-36   
gb|KCW72694.1|  hypothetical protein EUGRSUZ_E01147                     139   4e-34   Eucalyptus grandis [rose gum]
gb|KJB25101.1|  hypothetical protein B456_004G177500                    138   6e-34   Gossypium raimondii
tpg|DAA50139.1|  TPA: hypothetical protein ZEAMMB73_624371              107   8e-26   
ref|XP_009383105.1|  PREDICTED: uncharacterized protein LOC103970915    111   2e-25   
ref|XP_002506735.1|  glycosyltransferase family 77 protein              105   8e-22   Micromonas commoda
ref|XP_003062865.1|  glycosyltransferase family 77 protein            97.1    2e-19   Micromonas pusilla CCMP1545
emb|CAN79199.1|  hypothetical protein VITISV_040773                   94.4    3e-18   Vitis vinifera
gb|KJB25098.1|  hypothetical protein B456_004G177500                  93.6    4e-18   Gossypium raimondii
ref|XP_002956941.1|  hypothetical protein VOLCADRAFT_83868            90.5    6e-17   Volvox carteri f. nagariensis
ref|XP_002957630.1|  hypothetical protein VOLCADRAFT_77645            84.0    6e-15   Volvox carteri f. nagariensis
gb|KIZ02111.1|  hypothetical protein MNEG_5846                        80.5    1e-14   Monoraphidium neglectum
ref|XP_005852062.1|  hypothetical protein CHLNCDRAFT_133059           78.2    7e-13   Chlorella variabilis
ref|XP_001690605.1|  hypothetical protein CHLREDRAFT_114491           77.0    1e-12   Chlamydomonas reinhardtii
ref|XP_005843950.1|  hypothetical protein CHLNCDRAFT_37217            76.6    2e-12   Chlorella variabilis
ref|XP_004167890.1|  PREDICTED: uncharacterized protein LOC101229261  70.9    2e-12   
emb|CDX84231.1|  BnaC04g09930D                                        74.7    5e-12   
ref|XP_005646140.1|  hypothetical protein COCSUDRAFT_17381            73.6    1e-11   Coccomyxa subellipsoidea C-169
ref|XP_001692787.1|  predicted protein                                65.9    6e-09   Chlamydomonas reinhardtii
ref|XP_005649227.1|  hypothetical protein COCSUDRAFT_62105            63.5    4e-08   Coccomyxa subellipsoidea C-169
ref|XP_011397701.1|  hypothetical protein F751_1692                   55.5    1e-05   Auxenochlorella protothecoides



>ref|XP_011082185.1| PREDICTED: uncharacterized protein LOC105165007 isoform X3 [Sesamum 
indicum]
Length=622

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  740  IGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  561
            +GPGI+FREYS FDNP +PQ+VK+SWLDV LC+EGS GC+ SNSTT  GIL+FPK STE+
Sbjct  478  LGPGINFREYSFFDNPSVPQQVKKSWLDVHLCQEGSHGCEASNSTTQVGILKFPKRSTEQ  537

Query  560  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYY  381
             FKT+FS FKDVKVIQFSSM DAF GF+DK RE RFR RVKRY GIWCCVENQ+PGH+YY
Sbjct  538  MFKTIFSSFKDVKVIQFSSMQDAFLGFSDKTREERFRKRVKRYTGIWCCVENQSPGHIYY  597

Query  380  DMYWDEKPNWKPIPPQTPQEDHPP  309
            DMYWDEKP WKP PPQTP+EDHPP
Sbjct  598  DMYWDEKPGWKPKPPQTPEEDHPP  621



>ref|XP_008348925.1| PREDICTED: uncharacterized protein LOC103412105 [Malus domestica]
Length=154

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  740  IGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  561
             GP I  REYS FDNPLMP++VKESWLDVQLC++G+  C  SN+TT +G LRFPK S EE
Sbjct  10   FGPPIGIREYSFFDNPLMPKQVKESWLDVQLCQQGTRDCIASNTTTPSGALRFPKRSNEE  69

Query  560  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYY  381
             FKTVFS FKDVKVIQFSSM DAF GFTDKARE +FRNR KRYVGIWCCV   TPGH+YY
Sbjct  70   TFKTVFSSFKDVKVIQFSSMQDAFPGFTDKAREEKFRNRAKRYVGIWCCVAEHTPGHIYY  129

Query  380  DMYWDEKPNWKPIPPQTPQEDHPP  309
            DMYWDEKP W+PIPPQT ++DHPP
Sbjct  130  DMYWDEKPGWRPIPPQTREDDHPP  153



>ref|XP_011082184.1| PREDICTED: uncharacterized protein LOC105165007 isoform X2 [Sesamum 
indicum]
Length=639

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  740  IGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  561
            +GPGI+FREYS FDNP +PQ+VK+SWLDV LC+EGS GC+ SNSTT  GIL+FPK STE+
Sbjct  495  LGPGINFREYSFFDNPSVPQQVKKSWLDVHLCQEGSHGCEASNSTTQVGILKFPKRSTEQ  554

Query  560  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYY  381
             FKT+FS FKDVKVIQFSSM DAF GF+DK RE RFR RVKRY GIWCCVENQ+PGH+YY
Sbjct  555  MFKTIFSSFKDVKVIQFSSMQDAFLGFSDKTREERFRKRVKRYTGIWCCVENQSPGHIYY  614

Query  380  DMYWDEKPNWKPIPPQTPQEDHPP  309
            DMYWDEKP WKP PPQTP+EDHPP
Sbjct  615  DMYWDEKPGWKPKPPQTPEEDHPP  638



>ref|XP_011082183.1| PREDICTED: uncharacterized protein LOC105165007 isoform X1 [Sesamum 
indicum]
Length=640

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  740  IGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  561
            +GPGI+FREYS FDNP +PQ+VK+SWLDV LC+EGS GC+ SNSTT  GIL+FPK STE+
Sbjct  496  LGPGINFREYSFFDNPSVPQQVKKSWLDVHLCQEGSHGCEASNSTTQVGILKFPKRSTEQ  555

Query  560  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYY  381
             FKT+FS FKDVKVIQFSSM DAF GF+DK RE RFR RVKRY GIWCCVENQ+PGH+YY
Sbjct  556  MFKTIFSSFKDVKVIQFSSMQDAFLGFSDKTREERFRKRVKRYTGIWCCVENQSPGHIYY  615

Query  380  DMYWDEKPNWKPIPPQTPQEDHPP  309
            DMYWDEKP WKP PPQTP+EDHPP
Sbjct  616  DMYWDEKPGWKPKPPQTPEEDHPP  639



>gb|KDP31566.1| hypothetical protein JCGZ_15383 [Jatropha curcas]
Length=647

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYS  DNP +P++VKESWLDVQLC+EG+ GC  SN T+ +G+LRFPK+S E+ 
Sbjct  504  GPGINIREYSFLDNPSLPKQVKESWLDVQLCQEGTHGCVASNRTSPSGVLRFPKHSNEDM  563

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             K VFS FKDVKVIQFSSM D F GFTDKARE +FRNRVKRYVGIWCCVEN TPGHVYYD
Sbjct  564  IKAVFSSFKDVKVIQFSSMQDGFLGFTDKAREEKFRNRVKRYVGIWCCVENHTPGHVYYD  623

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP+WKP+PP+TP+ DHPPW
Sbjct  624  MYWDEKPDWKPMPPETPELDHPPW  647



>ref|XP_007210882.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
 gb|EMJ12081.1| hypothetical protein PRUPE_ppa002815mg [Prunus persica]
Length=630

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS FDNPLMP++VKESWL+VQLC+EG+  C  SN+T+ +G+LRFPK S EE 
Sbjct  487  GPQINIREYSFFDNPLMPKQVKESWLEVQLCQEGTRDCVASNTTSPSGVLRFPKRSDEET  546

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKT+FS FKDVKVIQFSSM DAF GFTDKARE +FRNRVKRYVGIWCCV   TPGH+YYD
Sbjct  547  FKTIFSSFKDVKVIQFSSMQDAFPGFTDKAREEKFRNRVKRYVGIWCCVAEHTPGHIYYD  606

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKPIPPQTP++DHPP
Sbjct  607  MYWDEKPGWKPIPPQTPEDDHPP  629



>gb|KJB25105.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=488

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S++T+  G+LRFPKNSTEE 
Sbjct  345  GPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM  404

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYD
Sbjct  405  FKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYD  464

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQTP+EDHPP+
Sbjct  465  MYWDEKPGWKPAPPQTPEEDHPPF  488



>gb|KJB25103.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=533

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S++T+  G+LRFPKNSTEE 
Sbjct  390  GPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM  449

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYD
Sbjct  450  FKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYD  509

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQTP+EDHPP+
Sbjct  510  MYWDEKPGWKPAPPQTPEEDHPPF  533



>ref|XP_004300682.1| PREDICTED: uncharacterized protein LOC101298609 [Fragaria vesca 
subsp. vesca]
Length=629

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS FDNPLMP++VK+SWL+VQLC+EG   C  SN+T+ +G+LRFPK S+EE 
Sbjct  486  GPQINIREYSFFDNPLMPKQVKDSWLEVQLCQEGIRDCLASNNTSPSGVLRFPKRSSEET  545

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVI+FSSM DAF GF DK RE RFRNRVKRYVGIWCCV  QTPGH+YYD
Sbjct  546  FKTVFSSFKDVKVIKFSSMQDAFLGFADKIREERFRNRVKRYVGIWCCVAEQTPGHIYYD  605

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTPQ+DHPP
Sbjct  606  MYWDEKPGWKPLPPQTPQDDHPP  628



>gb|KJB25104.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=620

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S++T+  G+LRFPKNSTEE 
Sbjct  477  GPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM  536

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYD
Sbjct  537  FKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYD  596

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQTP+EDHPP+
Sbjct  597  MYWDEKPGWKPAPPQTPEEDHPPF  620



>gb|KJB25102.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=634

 Score =   243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S++T+  G+LRFPKNSTEE 
Sbjct  491  GPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM  550

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM  AF  FTDK RE +FRNR+KRYVGIWCCVEN TPGH+YYD
Sbjct  551  FKTVFSSFKDVKVIQFSSMQGAFYSFTDKTREGKFRNRMKRYVGIWCCVENHTPGHIYYD  610

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQTP+EDHPP+
Sbjct  611  MYWDEKPGWKPAPPQTPEEDHPPF  634



>emb|CBI29197.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYS FDNPLMP++VK+SWLDVQLCREGS GC ++N+T++ GI R PK+STEE 
Sbjct  500  GPGINIREYSFFDNPLMPKQVKDSWLDVQLCREGSPGCNVTNNTSSLGI-RLPKHSTEEM  558

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK+VFSLFKDVKVIQFS+M DAF GFTDK  E +FR RVKRYVGIWCCV+   PGH+YYD
Sbjct  559  FKSVFSLFKDVKVIQFSTMQDAFLGFTDKKTEEKFRKRVKRYVGIWCCVKGSDPGHIYYD  618

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKPNWKPIPPQ  ++DHPPW
Sbjct  619  MYWDEKPNWKPIPPQASEDDHPPW  642



>ref|XP_002269181.2| PREDICTED: uncharacterized protein LOC100263017 [Vitis vinifera]
Length=631

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYS FDNPLMP++VK+SWLDVQLCREGS GC ++N+T++ GI R PK+STEE 
Sbjct  489  GPGINIREYSFFDNPLMPKQVKDSWLDVQLCREGSPGCNVTNNTSSLGI-RLPKHSTEEM  547

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK+VFSLFKDVKVIQFS+M DAF GFTDK  E +FR RVKRYVGIWCCV+   PGH+YYD
Sbjct  548  FKSVFSLFKDVKVIQFSTMQDAFLGFTDKKTEEKFRKRVKRYVGIWCCVKGSDPGHIYYD  607

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKPNWKPIPPQ  ++DHPPW
Sbjct  608  MYWDEKPNWKPIPPQASEDDHPPW  631



>ref|XP_010518959.1| PREDICTED: UDP-D-xylose:L-fucose alpha-1,3-D-xylosyltransferase 
MGP4 [Tarenaya hassleriana]
Length=631

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  +NPL+P+ VKESWLDV+LC+EGSEGC+ SN+T+ +G+L+FPK S+EE+
Sbjct  488  GPGIGIREYSFLENPLLPKHVKESWLDVKLCQEGSEGCEASNNTSPSGVLKFPKRSSEER  547

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS FKDVKVI+FSS+ DAF GF++K RE +FR RVK YVGIWCCVEN+TPGH+YYD
Sbjct  548  FKAIFSSFKDVKVIKFSSIQDAFTGFSNKEREEKFRKRVKTYVGIWCCVENKTPGHIYYD  607

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  608  MYWDEKPGWKPVPPQTPEEDHPP  630



>ref|XP_006385158.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
 gb|ERP62955.1| hypothetical protein POPTR_0004s24390g [Populus trichocarpa]
Length=638

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+FREYS  DNPL+P+ VKESWLDVQLC+EG+E C  SN T+  GILRFPK S E+ 
Sbjct  495  GPAINFREYSFLDNPLLPRHVKESWLDVQLCQEGAEDCGASNKTSRPGILRFPKRSNEDM  554

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKT FS FKDVKVIQFSSM DAF GFTDK RE +FRNR+KRYVGIWCCVEN  PGH+YYD
Sbjct  555  FKTTFSSFKDVKVIQFSSMQDAFVGFTDKRREEKFRNRMKRYVGIWCCVENHDPGHIYYD  614

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEK NWKP+PPQ+ ++DHPPW
Sbjct  615  MYWDEKSNWKPMPPQSAEDDHPPW  638



>ref|XP_008365916.1| PREDICTED: uncharacterized protein LOC103429549 isoform X1 [Malus 
domestica]
 ref|XP_008365917.1| PREDICTED: uncharacterized protein LOC103429549 isoform X2 [Malus 
domestica]
Length=630

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS FDNPLMP++VKESWLDVQLC++G+  C  SN+TT +G LRFPK S EE 
Sbjct  487  GPPIGIREYSFFDNPLMPKQVKESWLDVQLCQQGTRDCIASNTTTPSGALRFPKRSNEET  546

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM DAF GFTDKARE +FRNR KRYVGIWCCV   TPGH+YYD
Sbjct  547  FKTVFSSFKDVKVIQFSSMQDAFPGFTDKAREEKFRNRAKRYVGIWCCVAEHTPGHIYYD  606

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP W+PIPPQT ++DHPP
Sbjct  607  MYWDEKPGWRPIPPQTREDDHPP  629



>ref|XP_007040865.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
 gb|EOY25366.1| Xyloglucanase 113 isoform 1 [Theobroma cacao]
Length=636

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKE WLDVQLC+EG+E C  S++T+  G+LRFPK+S EE 
Sbjct  493  GPAINIREYSFLNNPLLPQQVKELWLDVQLCQEGTEDCHASSNTSRPGLLRFPKHSGEET  552

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM DAF GF+DK RE +FRNRVKRYVGIWCCV++ TPGH+YYD
Sbjct  553  FKTVFSAFKDVKVIQFSSMQDAFLGFSDKTREEKFRNRVKRYVGIWCCVDSHTPGHIYYD  612

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQTP++DHPP+
Sbjct  613  MYWDEKPGWKPAPPQTPEDDHPPF  636



>ref|XP_009769854.1| PREDICTED: uncharacterized protein LOC104220660 [Nicotiana sylvestris]
Length=636

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGIS REYSLF+NP MPQEVK SWLDV LC+EGS GCQ+ NST+ TG+L+ P+++ EE 
Sbjct  494  GPGISIREYSLFENPSMPQEVKRSWLDVHLCQEGSLGCQV-NSTSQTGVLKLPRHTNEET  552

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KTVFS F DVKVIQFSSM DAF GFTDK RE RFRNRVKRYVGIWCCVEN TPGH+YYD
Sbjct  553  LKTVFSKFNDVKVIQFSSMQDAFDGFTDKTREERFRNRVKRYVGIWCCVENHTPGHIYYD  612

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WK   P + ++DHPPW
Sbjct  613  MYWDEKPGWKAAAPNSTEDDHPPW  636



>ref|XP_007156344.1| hypothetical protein PHAVU_003G278600g [Phaseolus vulgaris]
 gb|ESW28338.1| hypothetical protein PHAVU_003G278600g [Phaseolus vulgaris]
Length=195

 Score =   225 bits (574),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  740  IGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATG-ILRFPKNSTE  564
             GP I FREYS  DNP +P E+K SWLDV+LC+EG++GC +SN TT+ G +L+FPK+S E
Sbjct  50   FGPQIDFREYSTLDNPSLPSEIKNSWLDVKLCKEGTQGCDVSNDTTSVGGVLKFPKHSNE  109

Query  563  EKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVY  384
            E F  VFS FKDVKVI+FSS+ DAFQGFTDK RE +FRNRVKRYVGIWCCV + +PGH+Y
Sbjct  110  ETFMKVFSSFKDVKVIKFSSVQDAFQGFTDKEREDKFRNRVKRYVGIWCCVPDLSPGHIY  169

Query  383  YDMYWDEKPNWKPIPPQTPQEDHPPW  306
            YDMYWDEKP WK IPPQT ++DHPPW
Sbjct  170  YDMYWDEKPGWKAIPPQTSEDDHPPW  195



>ref|XP_004142646.1| PREDICTED: uncharacterized protein LOC101203732 [Cucumis sativus]
 gb|KGN54526.1| hypothetical protein Csa_4G358640 [Cucumis sativus]
Length=640

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI FREYS  +NPL+P++VKESWLDVQLC++ SEGC  SN T   G+L+FPK S E+ 
Sbjct  497  GPGIDFREYSFLENPLLPKQVKESWLDVQLCKQESEGCSASNDTVLPGVLKFPKGSNEDT  556

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS FKDVKVIQFS+M DAF GF+DK RE +FRNRVKRYVGIWCCVEN  PGH+YYD
Sbjct  557  FKAIFSTFKDVKVIQFSTMQDAFPGFSDKKREEKFRNRVKRYVGIWCCVENAAPGHIYYD  616

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKPNWKP PP+TP+ED PP
Sbjct  617  MYWDEKPNWKPHPPRTPEEDRPP  639



>emb|CDP07209.1| unnamed protein product [Coffea canephora]
Length=633

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYSLFDNP MP++VKESWLDV LC+EGS GC++SNST+  GIL+FPK S+EE 
Sbjct  490  GPPIRIREYSLFDNPSMPKKVKESWLDVNLCQEGSRGCEVSNSTSQAGILKFPKRSSEET  549

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +KTVFS FKDV+VIQFSSM DAF GFTDK+ E +FR RVK Y GIWCCVEN TPGH++YD
Sbjct  550  YKTVFSSFKDVEVIQFSSMQDAFSGFTDKSMEDKFRKRVKIYTGIWCCVENHTPGHIFYD  609

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            +YWDEKP+WKP PPQTP+EDHPP
Sbjct  610  IYWDEKPDWKPKPPQTPEEDHPP  632



>ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis]
 gb|EEF42538.1| reticulon3-A3, putative [Ricinus communis]
Length=639

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYS  DNP +P+ VKESWLDV LC+EG++ C  +N TT++G+L+FPK S+EEK
Sbjct  497  GPGINIREYSFLDNPALPKHVKESWLDVHLCQEGAQACY-ANGTTSSGVLKFPKGSSEEK  555

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM DAF GFTDK RE +FRNRVKRY+GIWCCV++ TPGH+YYD
Sbjct  556  FKTVFSSFKDVKVIQFSSMQDAFLGFTDKEREAKFRNRVKRYLGIWCCVDSHTPGHIYYD  615

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WK +PP+TP+ DHPPW
Sbjct  616  MYWDEKPGWKAMPPETPELDHPPW  639



>gb|EYU37484.1| hypothetical protein MIMGU_mgv1a002766mg [Erythranthe guttata]
Length=640

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYSLFDNP M Q+VK+SWLDV LC  GS+GC+LSN TT  GIL+ PK STEE 
Sbjct  497  GPGINIREYSLFDNPAMSQQVKDSWLDVHLCVPGSKGCELSNGTTQAGILKLPKRSTEET  556

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKT+FS FKD KVIQFSSM +AF GFTDK RE +FR RVK Y GIWCCVEN+TPGH+YYD
Sbjct  557  FKTIFSSFKDKKVIQFSSMQEAFLGFTDKKREEKFRKRVKIYPGIWCCVENKTPGHIYYD  616

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WK +PPQTP+EDHPP+
Sbjct  617  MYWDEKPGWKALPPQTPEEDHPPF  640



>ref|XP_009141501.1| PREDICTED: uncharacterized protein LOC103865462 isoform X2 [Brassica 
rapa]
Length=640

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC  SN T+++G+L++PK S E+ 
Sbjct  497  GPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCVASNITSSSGVLKYPKRSNEDT  556

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  557  FKAIFSSFNDVKVIKFSSIEDAFTGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYD  616

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  617  MYWDEKPGWKPVPPQTPEEDHPP  639



>ref|XP_009143647.1| PREDICTED: uncharacterized protein LOC103867343 [Brassica rapa]
Length=643

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN T+ +G L+FPK S E+ 
Sbjct  500  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASNITSPSGFLKFPKRSNEDT  559

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  560  FKAIFSSFNDVKVIKFSSVEDAFTGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYD  619

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  620  MYWDEKPGWKPVPPQTPEEDHPP  642



>ref|XP_009603199.1| PREDICTED: uncharacterized protein LOC104098231 [Nicotiana tomentosiformis]
Length=636

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGIS REYSLF+NP MPQEVK+SWLDV LC EGS GCQ+ NST+ TG+L+ PK++ EE 
Sbjct  494  GPGISIREYSLFENPSMPQEVKKSWLDVHLCHEGSLGCQV-NSTSQTGVLKLPKHTNEET  552

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KTVFS F DVKVIQFSSM DAF GFTDK RE +FRNRVKRYVGIWCCVEN TPGH+YYD
Sbjct  553  LKTVFSKFNDVKVIQFSSMQDAFDGFTDKTREEQFRNRVKRYVGIWCCVENHTPGHIYYD  612

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WK   P + ++DHPPW
Sbjct  613  MYWDEKPGWKAAAPNSTEDDHPPW  636



>ref|XP_009141500.1| PREDICTED: uncharacterized protein LOC103865462 isoform X1 [Brassica 
rapa]
Length=644

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC  SN T+++G+L++PK S E+ 
Sbjct  501  GPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCVASNITSSSGVLKYPKRSNEDT  560

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  561  FKAIFSSFNDVKVIKFSSIEDAFTGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYD  620

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  621  MYWDEKPGWKPVPPQTPEEDHPP  643



>ref|XP_009362859.1| PREDICTED: uncharacterized protein LOC103952897 [Pyrus x bretschneideri]
Length=632

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS FDNPLMP++VKESWLDVQLC+EG+      N+T+  G LRFPK S EE 
Sbjct  489  GPQIGIREYSFFDNPLMPKQVKESWLDVQLCQEGTRDSVALNTTSPLGALRFPKRSNEET  548

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVIQFSSM DAF GFTDKARE +FRNR KRY+GIWCCV   TPGH+YYD
Sbjct  549  FKTVFSSFKDVKVIQFSSMQDAFAGFTDKAREEKFRNRAKRYIGIWCCVAEHTPGHIYYD  608

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP W PIPPQTP++DHPP
Sbjct  609  MYWDEKPGWIPIPPQTPEDDHPP  631



>ref|XP_004246017.1| PREDICTED: uncharacterized protein LOC101254412 [Solanum lycopersicum]
Length=635

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYSLF+NP MPQEVKESWLDV LC+EGS GCQ+ NST+ +G L+ PK+STEE 
Sbjct  493  GPGINIREYSLFENPSMPQEVKESWLDVHLCQEGSPGCQV-NSTSQSGALKLPKHSTEET  551

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KTVFS FKDVKVIQFS+M DAF  FTDK RE +FRNRVKRYVGIWCCVEN TPGH+YYD
Sbjct  552  LKTVFSKFKDVKVIQFSTMQDAFDRFTDKTREEQFRNRVKRYVGIWCCVENHTPGHIYYD  611

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WK  PP +  +DHPPW
Sbjct  612  MYWDEKPGWKAAPPNSTVDDHPPW  635



>ref|XP_010111777.1| hypothetical protein L484_008781 [Morus notabilis]
 gb|EXC31691.1| hypothetical protein L484_008781 [Morus notabilis]
Length=635

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYS FDNPLMPQ+VK+SWL+V LC EG+E C  SN T+  G+LRFPK+S EE 
Sbjct  493  GPGINIREYSFFDNPLMPQQVKDSWLEVHLCEEGAEDCHASNDTSRPGVLRFPKHSNEET  552

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KT+FS FKDVKVIQFSSMH AF GFTDK RE +FR R+KRYVGIWCCV + TPGH+YYD
Sbjct  553  LKTIFSSFKDVKVIQFSSMH-AFMGFTDKTREEKFRRRMKRYVGIWCCVMDHTPGHIYYD  611

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP+WKPIPPQ P++DHPP
Sbjct  612  MYWDEKPDWKPIPPQKPEDDHPP  634



>gb|AAD15452.2| unknown protein [Arabidopsis thaliana]
Length=528

 Score =   233 bits (594),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+ 
Sbjct  386  GPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDT  445

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DKA+E RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  446  FKAIFSSFDDVKVIKFSSIEDAFIGFSDKAKE-RFRRRVKRYVGIWCCEENKTPGHIYYD  504

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  505  MYWDEKPGWKPVPPQTPEEDHPP  527



>ref|XP_008444233.1| PREDICTED: uncharacterized protein LOC103487624 [Cucumis melo]
Length=640

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+FREYS  +NPL+P++VKESWLDV LC++ SEGC  SN T   G+L+FPK S E+ 
Sbjct  497  GPGINFREYSFLENPLLPKQVKESWLDVHLCKQESEGCSASNDTVLPGVLKFPKGSNEDT  556

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS FKDVKVIQFS+M DAF GF+DK RE +FRNRVKRYVGIWCCVEN  PGH+YYD
Sbjct  557  FKAIFSTFKDVKVIQFSTMQDAFPGFSDKKREEKFRNRVKRYVGIWCCVENAAPGHIYYD  616

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP+WKP PP+TP+ED PP
Sbjct  617  MYWDEKPDWKPHPPRTPEEDRPP  639



>ref|XP_006410719.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
 gb|ESQ52172.1| hypothetical protein EUTSA_v10016368mg [Eutrema salsugineum]
Length=645

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN T+ + +L+FPK S E+ 
Sbjct  502  GPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCEASNRTSPSRVLKFPKRSNEDT  561

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  562  FKAIFSTFHDVKVIKFSSVEDAFIGFSDKGREERFRRRVKRYVGIWCCEENKTPGHIYYD  621

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  622  MYWDEKPGWKPVPPQTPEEDHPP  644



>ref|XP_010266425.1| PREDICTED: uncharacterized protein LOC104603944 isoform X2 [Nelumbo 
nucifera]
Length=616

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I F+EYS  DN L+P+++KESWLDVQLC  GS+ C ++N T+  G+LR PK+S+EE 
Sbjct  473  GPAIHFKEYSFLDNSLLPKQIKESWLDVQLCHSGSQDCHVTNKTSRPGVLRLPKHSSEET  532

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KTV S FKDVKVIQFSSM DAF+GF+DK RE +FRNR+KRYVGIWCCV + TPGH+YYD
Sbjct  533  LKTVLSSFKDVKVIQFSSMQDAFEGFSDKTRETKFRNRMKRYVGIWCCVLDHTPGHIYYD  592

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKPNW+P PP+TPQ+DHPPW
Sbjct  593  MYWDEKPNWEPAPPKTPQDDHPPW  616



>ref|XP_006359953.1| PREDICTED: uncharacterized protein LOC102605574 isoform X1 [Solanum 
tuberosum]
Length=635

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYSLF+NP MPQEVK+SWLDV LC+EGS GCQ+ NST+ +G+L+ PK+STEE 
Sbjct  493  GPGINIREYSLFENPSMPQEVKKSWLDVHLCQEGSPGCQV-NSTSQSGVLKLPKHSTEET  551

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KT FS FKDVKVIQFSSM DAF  FTDK RE +FRNRVKRYVGIWCCVE  TPGH+YYD
Sbjct  552  LKTAFSKFKDVKVIQFSSMQDAFDRFTDKTREEQFRNRVKRYVGIWCCVETGTPGHIYYD  611

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WK  PP + ++DHPPW
Sbjct  612  MYWDEKPGWKAAPPNSTKDDHPPW  635



>ref|XP_010266424.1| PREDICTED: uncharacterized protein LOC104603944 isoform X1 [Nelumbo 
nucifera]
Length=634

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I F+EYS  DN L+P+++KESWLDVQLC  GS+ C ++N T+  G+LR PK+S+EE 
Sbjct  491  GPAIHFKEYSFLDNSLLPKQIKESWLDVQLCHSGSQDCHVTNKTSRPGVLRLPKHSSEET  550

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KTV S FKDVKVIQFSSM DAF+GF+DK RE +FRNR+KRYVGIWCCV + TPGH+YYD
Sbjct  551  LKTVLSSFKDVKVIQFSSMQDAFEGFSDKTRETKFRNRMKRYVGIWCCVLDHTPGHIYYD  610

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKPNW+P PP+TPQ+DHPPW
Sbjct  611  MYWDEKPNWEPAPPKTPQDDHPPW  634



>ref|XP_010056116.1| PREDICTED: uncharacterized protein LOC104444183 isoform X2 [Eucalyptus 
grandis]
Length=636

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYSL DNP MP++VKESWLDV+LC+ G++ CQ++NST++ G++R PK S EE 
Sbjct  493  GPGINIREYSLLDNPSMPKQVKESWLDVKLCQGGTKDCQVTNSTSSPGMIRLPKRSNEET  552

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KT FS FKD+KVIQFSSM DAF+GFTD+  E RFRNRVKRYVGIWCC  +  PGH+YYD
Sbjct  553  LKTAFSSFKDIKVIQFSSMQDAFEGFTDQKTEERFRNRVKRYVGIWCCTVDHVPGHIYYD  612

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PPQT  +DHPPW
Sbjct  613  MYWDEKPGWKPVPPQTSADDHPPW  636



>ref|XP_010056115.1| PREDICTED: uncharacterized protein LOC104444183 isoform X1 [Eucalyptus 
grandis]
 gb|KCW72693.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=638

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYSL DNP MP++VKESWLDV+LC+ G++ CQ++NST++ G++R PK S EE 
Sbjct  495  GPGINIREYSLLDNPSMPKQVKESWLDVKLCQGGTKDCQVTNSTSSPGMIRLPKRSNEET  554

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KT FS FKD+KVIQFSSM DAF+GFTD+  E RFRNRVKRYVGIWCC  +  PGH+YYD
Sbjct  555  LKTAFSSFKDIKVIQFSSMQDAFEGFTDQKTEERFRNRVKRYVGIWCCTVDHVPGHIYYD  614

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PPQT  +DHPPW
Sbjct  615  MYWDEKPGWKPVPPQTSADDHPPW  638



>dbj|BAD94473.1| hypothetical protein [Arabidopsis thaliana]
Length=145

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+ 
Sbjct  2    GPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDT  61

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  62   FKAIFSSFDDVKVIKFSSIEDAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYD  121

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  122  MYWDEKPGWKPVPPQTPEEDHPP  144



>gb|KJB51493.1| hypothetical protein B456_008G219000 [Gossypium raimondii]
Length=628

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NP +PQ V+ESWLDVQLC+EG+E C  S++T+  G+LRFPK S+EE 
Sbjct  485  GPAINIREYSFLNNPFLPQRVRESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKRSSEET  544

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             K VFS FKDVKVIQFSSM DAF GFTDK RE +FR RVK+YVGIWCCVEN  PGH+YYD
Sbjct  545  LKKVFSSFKDVKVIQFSSMQDAFLGFTDKTREEKFRKRVKQYVGIWCCVENHIPGHIYYD  604

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKPIPP+TP++DHPP+
Sbjct  605  MYWDEKPGWKPIPPKTPEDDHPPF  628



>emb|CDP07210.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYSLF NP MP++VKESWLDV  C+EGS GC++SNST+  G+L+FPK S+EE 
Sbjct  493  GPPIRIREYSLFANPSMPKKVKESWLDVNFCQEGSRGCEVSNSTSQAGVLKFPKRSSEET  552

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +KTVFS FKDVKVIQFSSM DAF GF DK+RE +FR RVK Y G+WCCVEN TPGH+ YD
Sbjct  553  YKTVFSSFKDVKVIQFSSMQDAFTGFADKSREDKFRKRVKAYTGLWCCVENHTPGHILYD  612

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            +YWDEKPNWKP PPQTP+EDHPP
Sbjct  613  IYWDEKPNWKPKPPQTPEEDHPP  635



>ref|XP_011028505.1| PREDICTED: uncharacterized protein LOC105128495 isoform X2 [Populus 
euphratica]
Length=648

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+FREYS  DNPL+P+ VKES LDVQLC+EG++ C  SN T+  GILRFPK S E+ 
Sbjct  505  GPAINFREYSFLDNPLLPRHVKESRLDVQLCQEGAKDCGASNKTSRPGILRFPKRSNEDM  564

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKT FS FKDVKVIQFSSM DAF GFTDK RE +FRNR+KRYVGIWCCVEN  PGH+YYD
Sbjct  565  FKTTFSSFKDVKVIQFSSMQDAFVGFTDKRREEKFRNRMKRYVGIWCCVENHDPGHIYYD  624

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEK +WKP+PPQ+ ++DHPPW
Sbjct  625  MYWDEKSDWKPMPPQSAEDDHPPW  648



>ref|XP_011028504.1| PREDICTED: uncharacterized protein LOC105128495 isoform X1 [Populus 
euphratica]
Length=652

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+FREYS  DNPL+P+ VKES LDVQLC+EG++ C  SN T+  GILRFPK S E+ 
Sbjct  509  GPAINFREYSFLDNPLLPRHVKESRLDVQLCQEGAKDCGASNKTSRPGILRFPKRSNEDM  568

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKT FS FKDVKVIQFSSM DAF GFTDK RE +FRNR+KRYVGIWCCVEN  PGH+YYD
Sbjct  569  FKTTFSSFKDVKVIQFSSMQDAFVGFTDKRREEKFRNRMKRYVGIWCCVENHDPGHIYYD  628

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEK +WKP+PPQ+ ++DHPPW
Sbjct  629  MYWDEKSDWKPMPPQSAEDDHPPW  652



>ref|XP_003517099.1| PREDICTED: uncharacterized protein LOC100776463 [Glycine max]
Length=627

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS+ DNP++P EVK+SWLDVQLC++G++ C  SN+TT  G+L+FP++S EE+
Sbjct  484  GPGIDIREYSILDNPILPSEVKKSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEER  543

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +  VFS FKD+KVIQFSSM DAF GF+DK RE RFR RVKRY GIWCCV + TPGH+YYD
Sbjct  544  YMKVFSSFKDIKVIQFSSMQDAFAGFSDKEREDRFRKRVKRYPGIWCCVLDHTPGHIYYD  603

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKPIPPQT  +DHPPW
Sbjct  604  MYWDEKPEWKPIPPQTSADDHPPW  627



>gb|KHG12903.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=619

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NP +PQ V+ESWLDVQLC+EG+E C  S++T+  G+LRFPK S+EE 
Sbjct  476  GPAINIREYSFLNNPFLPQRVRESWLDVQLCQEGTEDCHASSNTSQPGLLRFPKRSSEET  535

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             K VFS FKDVKVIQFSSM DAF GFTDK RE +FR RVK+YVGIWCCVEN  PGH+YYD
Sbjct  536  LKKVFSSFKDVKVIQFSSMQDAFLGFTDKTREEKFRKRVKQYVGIWCCVENHIPGHIYYD  595

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PP+TP++DHPP+
Sbjct  596  MYWDEKPGWKPVPPKTPEDDHPPF  619



>ref|XP_006293822.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
 gb|EOA26720.1| hypothetical protein CARUB_v10022808mg [Capsella rubella]
Length=645

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+ 
Sbjct  502  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDT  561

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  562  FKAIFSSFNDVKVIKFSSVEDAFIGFSDKEREEKFRRRVKRYVGIWCCEENKTPGHIYYD  621

Query  377  MYWDEKPNWKPIPPQTPQEDHP  312
            MYWDEKP WKP+PPQTP+EDHP
Sbjct  622  MYWDEKPGWKPVPPQTPEEDHP  643



>ref|XP_010516741.1| PREDICTED: uncharacterized protein LOC104792321 [Camelina sativa]
Length=644

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG + C+ SN T+ + +L+FPK S E+ 
Sbjct  501  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKDECEASNKTSPSRVLKFPKRSNEDT  560

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  561  FKAIFSFFDDVKVIKFSSVEDAFAGFSDKEREEKFRKRVKRYVGIWCCEENKTPGHIYYD  620

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  621  MYWDEKPGWKPVPPQTPEEDHPP  643



>emb|CDP12729.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   229 bits (584),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTA--TGI  591
            ++G      GP I  +EYS+ DNP MPQ+VK+SWLDV LC+EGS GCQ+S+S T   TG+
Sbjct  461  MKGLPEDEFGPSIRIKEYSILDNPSMPQKVKDSWLDVFLCQEGSHGCQVSSSATTNRTGV  520

Query  590  LRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCV  411
            ++FPKNS+EE ++TVFSLFKDVKV+QFSSM DAF GFTDK RE +FR R+K Y+G WCCV
Sbjct  521  VKFPKNSSEETYRTVFSLFKDVKVLQFSSMQDAFIGFTDKLREEKFRKRMKAYIGRWCCV  580

Query  410  ENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  309
            E+  PGH+YYD+YWDEKP WKP+PPQTP++DHPP
Sbjct  581  EDHFPGHIYYDIYWDEKPGWKPVPPQTPEDDHPP  614



>ref|XP_010505074.1| PREDICTED: uncharacterized protein LOC104781967 [Camelina sativa]
Length=644

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC++G + C+ SN T+ + +L+FPK S E+ 
Sbjct  501  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQDGKDECEASNKTSPSRVLKFPKRSNEDT  560

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  561  FKAIFSFFDDVKVIKFSSVEDAFTGFSDKEREEKFRKRVKRYVGIWCCEENKTPGHIYYD  620

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  621  MYWDEKPGWKPVPPQTPEEDHPP  643



>ref|XP_007158076.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
 gb|ESW30070.1| hypothetical protein PHAVU_002G122000g [Phaseolus vulgaris]
Length=626

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYSL DNP +P EVK+SWLDV LC+EG++ C  SN+T+  G+L+FP++S EE 
Sbjct  483  GPGIDIREYSLLDNPSLPSEVKKSWLDVHLCKEGTQDCVASNNTSIGGVLKFPRHSNEET  542

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +  +FS FKD+KVIQFSSM DAF GF+DK RE +FR RVKRYVGIWCCV + TPGH+YYD
Sbjct  543  YMKIFSSFKDIKVIQFSSMQDAFTGFSDKEREDKFRKRVKRYVGIWCCVLDHTPGHIYYD  602

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PPQT  +DHPPW
Sbjct  603  MYWDEKPEWKPLPPQTSADDHPPW  626



>gb|KFK36454.1| hypothetical protein AALP_AA4G126700 [Arabis alpina]
Length=642

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+ 
Sbjct  499  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASNNTSPSQVLKFPKRSNEDT  558

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F +VKVI+FSS+ DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YY+
Sbjct  559  FKAIFSSFNNVKVIKFSSVEDAFIGFSDKGREEKFRRRVKRYVGIWCCEENKTPGHIYYN  618

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PP TP+EDHPP+
Sbjct  619  MYWDEKPGWKPVPPLTPEEDHPPF  642



>ref|XP_003612490.1| hypothetical protein MTR_5g025590 [Medicago truncatula]
Length=628

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS+ DNP +P EVK+SWLDV LC+EG++ C  SN+ T  G+L+FPK+S EE 
Sbjct  485  GPDIDFREYSILDNPSLPSEVKKSWLDVHLCKEGTQNCNASNNVTVGGVLKFPKHSNEEM  544

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VFS FKDVKVIQFSSM DAF GF DK RE RFR RVK Y GIWCCV + TPGH+YYD
Sbjct  545  FMKVFSSFKDVKVIQFSSMQDAFTGFKDKEREDRFRKRVKHYTGIWCCVTDHTPGHIYYD  604

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            +YWDEKP WKPIPPQT  +DHPPW
Sbjct  605  IYWDEKPGWKPIPPQTSADDHPPW  628



>ref|XP_006430896.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
 gb|ESR44136.1| hypothetical protein CICLE_v10011269mg [Citrus clementina]
Length=639

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI FREYS  DNP +P++VKES L+VQLC +    CQ S++T++ GILRFP++S+EE 
Sbjct  496  GPGIGFREYSFMDNPSVPKQVKESRLEVQLCDDTLIDCQASSNTSSPGILRFPRHSSEET  555

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVI FSSM +AF  FTDK RE RFR RVKRYVGIWCCV++ TPGH+YYD
Sbjct  556  FKTVFSSFKDVKVINFSSMKNAFLNFTDKTREERFRRRVKRYVGIWCCVDSHTPGHIYYD  615

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP+WKPIPPQTP +DHPPW
Sbjct  616  MYWDEKPDWKPIPPQTPGDDHPPW  639



>ref|XP_009388198.1| PREDICTED: uncharacterized protein LOC103975012 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   214 bits (544),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILR  585
            + G +    GP I FREYS   NP +P+ VKES L+VQLC   S+GC +S+ TT+ G ++
Sbjct  2    LHGLSEEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISDGTTSRGFIQ  61

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVEN  405
            FP+NSTE+ +  VFS +KD+KV+ FSSM +AFQGF D+ARE +FRNR+KRYVG+WCCVEN
Sbjct  62   FPRNSTEQMYMQVFSQYKDIKVLHFSSMANAFQGFNDEAREVKFRNRMKRYVGLWCCVEN  121

Query  404  QTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            + PGH+YYD+YWDEKP WKP PP+T Q+DHPPW
Sbjct  122  RDPGHIYYDIYWDEKPEWKPEPPRTSQDDHPPW  154



>ref|XP_009388312.1| PREDICTED: uncharacterized protein LOC103975128 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   213 bits (543),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILR  585
            + G +    GP I FREYS   NP +P+ VKES L+VQLC   S+GC +S+ TT+ G ++
Sbjct  2    LHGLSEEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISDGTTSRGFIQ  61

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVEN  405
            FP+NSTE+ +  VFS +KD+KV+ FSSM +AFQGF D+ARE +FRNR+KRYVG+WCCVEN
Sbjct  62   FPRNSTEQMYMQVFSQYKDIKVLHFSSMANAFQGFNDEAREVKFRNRMKRYVGMWCCVEN  121

Query  404  QTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            + PGH+YYD+YWDEKP WKP PP+T Q+DHPPW
Sbjct  122  RDPGHIYYDIYWDEKPEWKPEPPRTSQDDHPPW  154



>ref|XP_010509590.1| PREDICTED: uncharacterized protein LOC104785987 [Camelina sativa]
Length=644

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC++G + C+ SN T+ + +L+FPK S E+ 
Sbjct  501  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQDGKDECEASNKTSPSRVLKFPKRSNEDT  560

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK++FS F DVKVI+FSS+ DAF GF+DK RE +FR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  561  FKSIFSFFDDVKVIKFSSVEDAFTGFSDKEREEKFRKRVKRYVGIWCCEENKTPGHIYYD  620

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQT +EDHPP
Sbjct  621  MYWDEKPGWKPVPPQTAEEDHPP  643



>emb|CDY32116.1| BnaC04g44500D [Brassica napus]
Length=636

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 117/143 (82%), Gaps = 4/143 (3%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC    +GC+ SN T+++G L+FPK S E+ 
Sbjct  497  GPGIGIREYSFLDNPSLPKQVKESWLDVQLC----QGCEASNITSSSGALKFPKRSNEDT  552

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RV RYVGIWCC EN+TPGH+YYD
Sbjct  553  FKAIFSTFNDVKVIKFSSVEDAFTGFSDKGREERFRRRVMRYVGIWCCEENKTPGHIYYD  612

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  613  MYWDEKPGWKPVPPQTPEEDHPP  635



>ref|XP_010676705.1| PREDICTED: uncharacterized protein LOC104892459 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS  DNP +P+EVKESWLDVQLC+ GS+ C ++++++A G+LRFPK   EE 
Sbjct  388  GPRIDIREYSFLDNPALPREVKESWLDVQLCQVGSKDCHVTDNSSAPGLLRFPKYGNEET  447

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +KTVFS FK+VKVI F S+ DAF GF DK RE +FR RVKRYVGIWCCV N+T GH+YYD
Sbjct  448  YKTVFSSFKNVKVINFLSIQDAFTGFADKEREQKFRRRVKRYVGIWCCVTNRTIGHIYYD  507

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  508  MYWDEKPGWKPLPPQTPEEDHPP  530



>ref|XP_010676704.1| PREDICTED: uncharacterized protein LOC104892459 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=533

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS  DNP +P+EVKESWLDVQLC+ GS+ C ++++++A G+LRFPK   EE 
Sbjct  390  GPRIDIREYSFLDNPALPREVKESWLDVQLCQVGSKDCHVTDNSSAPGLLRFPKYGNEET  449

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +KTVFS FK+VKVI F S+ DAF GF DK RE +FR RVKRYVGIWCCV N+T GH+YYD
Sbjct  450  YKTVFSSFKNVKVINFLSIQDAFTGFADKEREQKFRRRVKRYVGIWCCVTNRTIGHIYYD  509

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  510  MYWDEKPGWKPLPPQTPEEDHPP  532



>ref|XP_006590766.1| PREDICTED: uncharacterized protein LOC100789338 [Glycine max]
Length=627

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            G G+  REYS+ DNP +P EVK SWLDVQLC++G++ C  SN+TT  G+L+FP++S EE 
Sbjct  484  GSGVDIREYSILDNPSLPSEVKMSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEET  543

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +  VF  FKD+KVIQFSSM DAF GF+DK RE RFR RVKRY GIWCCV + TPGH+YYD
Sbjct  544  YMKVFLSFKDIKVIQFSSMQDAFSGFSDKEREDRFRKRVKRYTGIWCCVLDHTPGHIYYD  603

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKPIPPQT  +DHPPW
Sbjct  604  MYWDEKPEWKPIPPQTSADDHPPW  627



>ref|XP_006359954.1| PREDICTED: uncharacterized protein LOC102605574 isoform X2 [Solanum 
tuberosum]
Length=634

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYSLF+NP MPQEVK+SWLDV LC+EGS GCQ+ NST+ +G+L+ PK+STEE 
Sbjct  493  GPGINIREYSLFENPSMPQEVKKSWLDVHLCQEGSPGCQV-NSTSQSGVLKLPKHSTEET  551

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             KT FS FKDVKVIQFSSM DAF  FTDK RE +FRNRVKRYVGIWCCVE  TPGH+YYD
Sbjct  552  LKTAFSKFKDVKVIQFSSMQDAFDRFTDKTREEQFRNRVKRYVGIWCCVETGTPGHIYYD  611

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WK  PP + ++ H P
Sbjct  612  MYWDEKPGWKAAPPNSTEDYHMP  634



>ref|XP_006482352.1| PREDICTED: uncharacterized protein LOC102613765 [Citrus sinensis]
Length=639

 Score =   224 bits (571),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI FREYS  DNP +P++VKES L+VQLC +    CQ S++T++ GILRFP++S+EE 
Sbjct  496  GPGIGFREYSFMDNPSVPKQVKESRLEVQLCDDTLIDCQASSNTSSPGILRFPRHSSEET  555

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVI FSSM +AF  FTDK RE RFR RVKRYVGIWCCV++ TPGH+YYD
Sbjct  556  FKTVFSSFKDVKVINFSSMKNAFLNFTDKTREERFRRRVKRYVGIWCCVDSHTPGHIYYD  615

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP+WKPIPPQTP +DH PW
Sbjct  616  MYWDEKPDWKPIPPQTPGDDHLPW  639



>ref|XP_009381925.1| PREDICTED: uncharacterized protein LOC103970025 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score =   211 bits (536),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILR  585
            + G +    GP I FREYS   NP +P+ VKES L+VQLC   S+GC +S+ TT+   ++
Sbjct  2    LHGLSEEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISDGTTSRDFIQ  61

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVEN  405
            FP+NSTE+ +  VFS +KD+KV+ FSSM +AFQGF D+ARE +FRNR+KRYVG+WCCVEN
Sbjct  62   FPRNSTEQMYMQVFSQYKDIKVLHFSSMANAFQGFDDEAREVKFRNRMKRYVGMWCCVEN  121

Query  404  QTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            + PGH+YYD+YWDEKP WKP PP+T Q+DHPPW
Sbjct  122  RDPGHIYYDIYWDEKPEWKPEPPRTSQDDHPPW  154



>ref|XP_008804433.1| PREDICTED: uncharacterized protein LOC103717721 [Phoenix dactylifera]
Length=396

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  740  IGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  561
             GP I FREYS   NPL+P+E+KES L+VQLC + S  CQ++N TT  G+LRFPK+ST++
Sbjct  252  FGPRIDFREYSFLQNPLVPKEIKESLLEVQLCDDHSAKCQIANETTRRGVLRFPKHSTQQ  311

Query  560  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYY  381
             F   FSL+KDVKVIQFSSM DAFQGFTD+ RE +FR RVKRYVG+WCCVE++ PGH+YY
Sbjct  312  MFIQAFSLYKDVKVIQFSSMEDAFQGFTDEVREEKFRKRVKRYVGLWCCVESRDPGHIYY  371

Query  380  DMYWDEKPNWKPIPPQTPQEDHPPW  306
            DMYWDEKP WKP PP+T ++D PPW
Sbjct  372  DMYWDEKPGWKPEPPRTREDDRPPW  396



>gb|KDO72261.1| hypothetical protein CISIN_1g036925mg [Citrus sinensis]
Length=639

 Score =   224 bits (571),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI FREYS  DNP +P++VKES L+VQLC +    CQ S++T++ GILRFP++S+EE 
Sbjct  496  GPGIGFREYSFMDNPSVPKQVKESRLEVQLCDDTLIDCQASSNTSSPGILRFPRHSSEET  555

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FKTVFS FKDVKVI FSSM +AF  FTDK RE RFR RVKRYVGIWCCV++ TPGH+YYD
Sbjct  556  FKTVFSSFKDVKVINFSSMKNAFLNFTDKTREERFRRRVKRYVGIWCCVDSHTPGHIYYD  615

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP+WKPIPPQTP +DH PW
Sbjct  616  MYWDEKPDWKPIPPQTPGDDHLPW  639



>gb|AES95448.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=688

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS+ DNP +P EVK+SWLDV LC+EG++ C  SN+ T  G+L+FPK+S EE 
Sbjct  485  GPDIDFREYSILDNPSLPSEVKKSWLDVHLCKEGTQNCNASNNVTVGGVLKFPKHSNEEM  544

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VFS FKDVKVIQFSSM DAF GF DK RE RFR RVK Y GIWCCV + TPGH+YYD
Sbjct  545  FMKVFSSFKDVKVIQFSSMQDAFTGFKDKEREDRFRKRVKHYTGIWCCVTDHTPGHIYYD  604

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            +YWDEKP WKPIPPQT  +DHPP
Sbjct  605  IYWDEKPGWKPIPPQTSADDHPP  627



>ref|XP_010676703.1| PREDICTED: uncharacterized protein LOC104892459 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=629

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS  DNP +P+EVKESWLDVQLC+ GS+ C ++++++A G+LRFPK   EE 
Sbjct  486  GPRIDIREYSFLDNPALPREVKESWLDVQLCQVGSKDCHVTDNSSAPGLLRFPKYGNEET  545

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +KTVFS FK+VKVI F S+ DAF GF DK RE +FR RVKRYVGIWCCV N+T GH+YYD
Sbjct  546  YKTVFSSFKNVKVINFLSIQDAFTGFADKEREQKFRRRVKRYVGIWCCVTNRTIGHIYYD  605

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  606  MYWDEKPGWKPLPPQTPEEDHPP  628



>emb|CDP12731.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 2/154 (1%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTA--TGI  591
            V G      GP I  +EYS+ DNP MP++VK+SWLDV LC EGS+GCQ+S+  T   TG+
Sbjct  492  VRGLPEEEFGPSIRIKEYSILDNPSMPRKVKDSWLDVDLCHEGSQGCQVSSYATINQTGV  551

Query  590  LRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCV  411
            L+FPKNS++E + TVFSLFKDVKV+QFSSM DAF GFTDK RE +FR R+K Y+G WCCV
Sbjct  552  LKFPKNSSQETYWTVFSLFKDVKVLQFSSMEDAFIGFTDKLREEKFRKRMKAYIGRWCCV  611

Query  410  ENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPP  309
            E+ +PGH+YYD+YWDEKP WKP PP+TP++DHPP
Sbjct  612  EDHSPGHIYYDIYWDEKPGWKPEPPRTPEDDHPP  645



>ref|NP_850250.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AAL67023.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09128.1| xyloglucanase 113 [Arabidopsis thaliana]
 gb|AHL38813.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=644

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+ 
Sbjct  501  GPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDT  560

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  561  FKAIFSSFDDVKVIKFSSIEDAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYD  620

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  621  MYWDEKPGWKPVPPQTPEEDHPP  643



>emb|CDY40459.1| BnaA04g20580D [Brassica napus]
Length=640

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC  SN TT +G L+FPK S E+ 
Sbjct  497  GPGIGIREYSFLDNPSLPKQVKESWLDVQLCQEGKEGCVASNITTPSGALKFPKRSNEDT  556

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  557  FKAIFSSFNDVKVIKFSSVEDAFTGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYD  616

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  617  MYWDEKPGWKPVPPQTPEEDHPP  639



>ref|XP_004512439.1| PREDICTED: uncharacterized protein LOC101497257 [Cicer arietinum]
Length=623

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS+ DNP +P EVK S LDV LC+EG++ C +SN+ T  G+L+FPK+S EE 
Sbjct  480  GPRINIREYSILDNPSLPSEVKMSRLDVHLCKEGTQYCNVSNNVTVGGVLKFPKHSNEES  539

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VF+ FKDVKVIQFSSM DAF GFT+K RE RFR RVK Y GIWCCV + TPGH+YYD
Sbjct  540  FMKVFTSFKDVKVIQFSSMQDAFTGFTNKEREDRFRKRVKHYTGIWCCVMDHTPGHIYYD  599

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            +YWDEKP WKPIPPQT ++DHPPW
Sbjct  600  IYWDEKPGWKPIPPQTSEDDHPPW  623



>dbj|BAH19600.1| AT2G35610 [Arabidopsis thaliana]
Length=644

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNPL+P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+ 
Sbjct  501  GPGIGIREYSFLDNPLLPKQVKESWLDVQLCQEGKEGCEASNNTSPSRVLKFPKRSNEDT  560

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YY+
Sbjct  561  FKAIFSSFDDVKVIKFSSIEDAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYE  620

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  621  MYWDEKPGWKPVPPQTPEEDHPP  643



>ref|XP_003547737.1| PREDICTED: uncharacterized protein LOC100780346 [Glycine max]
Length=638

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGC--QLSNSTTATGILRFPKNSTE  564
            GP I FREYS+ DNP +P EVK+SWLDVQLC++G++ C    SN TT  G+L+FPK+S E
Sbjct  493  GPQIDFREYSILDNPSLPSEVKKSWLDVQLCKDGTQDCDASASNDTTVGGVLKFPKHSNE  552

Query  563  EKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVY  384
            E F  VFS  KDVKVI+FS++ DAF GFTDK RE +FRNRVKRYVGIWCCV + +PGH+Y
Sbjct  553  EMFMKVFSSLKDVKVIKFSTVQDAFTGFTDKEREEKFRNRVKRYVGIWCCVPDHSPGHIY  612

Query  383  YDMYWDEKPNWKPIPPQTPQEDHPPW  306
            YDMYWDEKP WK +PPQT ++DHPP+
Sbjct  613  YDMYWDEKPGWKAVPPQTSEDDHPPY  638



>gb|KHN05539.1| hypothetical protein glysoja_020504 [Glycine soja]
Length=637

 Score =   219 bits (557),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 116/154 (75%), Gaps = 10/154 (6%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            G G+  REYS+ DNP +P EVK SWLDVQLC++G++ C  SN+TT  G+L+FP++S EE 
Sbjct  484  GSGVDIREYSILDNPSLPSEVKMSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEET  543

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKA----------REHRFRNRVKRYVGIWCCVE  408
            +  VF  FKD+KVIQFSSM DAF GF+DKA          RE RFR RVKRY GIWCCV 
Sbjct  544  YMKVFLSFKDIKVIQFSSMQDAFSGFSDKARTSTLISFEEREDRFRKRVKRYTGIWCCVL  603

Query  407  NQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            + TPGH+YYDMYWDEKP WKPIPPQT  +DHPPW
Sbjct  604  DHTPGHIYYDMYWDEKPEWKPIPPQTSADDHPPW  637



>ref|XP_004509491.1| PREDICTED: uncharacterized protein LOC101505601 [Cicer arietinum]
Length=638

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS+ DNP +P EVK+SWLDVQLC+EG++ C  S ++T  G+L+FPKNS+EE 
Sbjct  495  GPEIDIREYSILDNPSLPPEVKKSWLDVQLCKEGTQDCDGSYNSTVEGVLKFPKNSSEEM  554

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VFS FKDVKVIQ SS+ DAF GFT+K RE RFRNRVK+YVGIWCC+ + T GH+YYD
Sbjct  555  FTKVFSSFKDVKVIQLSSVQDAFTGFTNKEREDRFRNRVKQYVGIWCCMPDTTIGHIYYD  614

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKPIPPQ+ ++DHPP+
Sbjct  615  MYWDEKPGWKPIPPQSSEDDHPPF  638



>gb|AET03500.2| nucleotide-diphospho-sugar transferase family protein [Medicago 
truncatula]
Length=637

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS+ DNP +P EVK+SWLDVQLC+EG++GC  S ++T  G+L+FPK+S EE 
Sbjct  494  GPEIGIREYSMLDNPSLPPEVKKSWLDVQLCKEGTQGCDGSYNSTVGGVLKFPKHSNEEM  553

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VFS FKDVKVI+ SS+ DAF GFT+K RE RFRNRVKRYVGIWCC+ +   GH+YYD
Sbjct  554  FMKVFSSFKDVKVIKLSSVEDAFTGFTNKEREDRFRNRVKRYVGIWCCMPDTPIGHIYYD  613

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WK IPPQ+P+EDHPP
Sbjct  614  MYWDEKPGWKAIPPQSPEEDHPP  636



>ref|XP_003548765.1| PREDICTED: uncharacterized protein LOC100819032 [Glycine max]
Length=639

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 117/147 (80%), Gaps = 3/147 (2%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNST---TATGILRFPKNST  567
            GP I FREYS+ DNP +P EVK+SWLDVQLC+EG++ C  S S       G+L+FPK+S 
Sbjct  493  GPQIDFREYSILDNPSLPSEVKKSWLDVQLCKEGTQDCDASASNDTNVGGGVLKFPKHSN  552

Query  566  EEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHV  387
            EE F  VFS FKDVKVI+FSS+ +AF GFTDK RE +FRNRVKRYVGIWCCV + TPGH+
Sbjct  553  EETFMKVFSSFKDVKVIKFSSVQEAFTGFTDKEREDKFRNRVKRYVGIWCCVPDHTPGHI  612

Query  386  YYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            YYDMYWDEKP WK +PPQT ++DHPP+
Sbjct  613  YYDMYWDEKPGWKAVPPQTSEDDHPPY  639



>ref|XP_003629024.1| hypothetical protein MTR_8g072310 [Medicago truncatula]
Length=655

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS+ DNP +P EVK+SWLDVQLC+EG++GC  S ++T  G+L+FPK+S EE 
Sbjct  512  GPEIGIREYSMLDNPSLPPEVKKSWLDVQLCKEGTQGCDGSYNSTVGGVLKFPKHSNEEM  571

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VFS FKDVKVI+ SS+ DAF GFT+K RE RFRNRVKRYVGIWCC+ +   GH+YYD
Sbjct  572  FMKVFSSFKDVKVIKLSSVEDAFTGFTNKEREDRFRNRVKRYVGIWCCMPDTPIGHIYYD  631

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WK IPPQ+P+EDHPP
Sbjct  632  MYWDEKPGWKAIPPQSPEEDHPP  654



>ref|XP_002881404.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57663.1| hypothetical protein ARALYDRAFT_902666 [Arabidopsis lyrata subsp. 
lyrata]
Length=640

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN+T+ + +L+FPK S E+ 
Sbjct  497  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEPSNNTSPSQVLKFPKRSNEDT  556

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F++VKVI+FSS+ DAF GF+DK RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  557  FKAIFSSFENVKVIKFSSIEDAFIGFSDKEREERFRRRVKRYVGIWCCEENKTPGHIYYD  616

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  617  MYWDEKPGWKPVPPQTPEEDHPP  639



>ref|XP_010907097.1| PREDICTED: uncharacterized protein LOC105033849 isoform X1 [Elaeis 
guineensis]
Length=643

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS   NPL+ +EVKES L+VQLC + S  CQ++N TT  G+LRFPK+ST++ 
Sbjct  500  GPRIDFREYSFLQNPLVLKEVKESLLEVQLCDDRSAKCQIANETTRRGVLRFPKHSTQQM  559

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VFSL+KDVKV+QFSSM D FQGFTD+ARE +FR RVKRYVG+WCCVE++  GH+YYD
Sbjct  560  FIQVFSLYKDVKVLQFSSMEDVFQGFTDEAREEKFRKRVKRYVGLWCCVEHRDRGHIYYD  619

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQT ++D PPW
Sbjct  620  MYWDEKPGWKPEPPQTREDDRPPW  643



>ref|XP_010907098.1| PREDICTED: uncharacterized protein LOC105033849 isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS   NPL+ +EVKES L+VQLC + S  CQ++N TT  G+LRFPK+ST++ 
Sbjct  498  GPRIDFREYSFLQNPLVLKEVKESLLEVQLCDDRSAKCQIANETTRRGVLRFPKHSTQQM  557

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            F  VFSL+KDVKV+QFSSM D FQGFTD+ARE +FR RVKRYVG+WCCVE++  GH+YYD
Sbjct  558  FIQVFSLYKDVKVLQFSSMEDVFQGFTDEAREEKFRKRVKRYVGLWCCVEHRDRGHIYYD  617

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQT ++D PPW
Sbjct  618  MYWDEKPGWKPEPPQTREDDRPPW  641



>emb|CDY31704.1| BnaA05g08430D [Brassica napus]
Length=632

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 111/143 (78%), Gaps = 11/143 (8%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VKESWLDVQLC+EG EGC+ SN T+ +G L+FPK S E+ 
Sbjct  500  GPGIGIREYSFLDNPALPKQVKESWLDVQLCQEGKEGCEASNITSPSGFLKFPKRSNEDT  559

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS            RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  560  FKAIFSSFNDVKVIKFSS-----------GREERFRRRVKRYVGIWCCEENKTPGHIYYD  608

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  609  MYWDEKPGWKPVPPQTPEEDHPP  631



>gb|KHN27499.1| hypothetical protein glysoja_018611 [Glycine soja]
Length=648

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 119/156 (76%), Gaps = 12/156 (8%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGC--QLSNSTTATGILRFPKNSTE  564
            GP I FREYS+ DNP +P EVK+SWLDVQLC++G++ C    SN TT  G+L+FPK+S E
Sbjct  493  GPQIDFREYSILDNPSLPSEVKKSWLDVQLCKDGTQDCDASASNDTTVGGVLKFPKHSNE  552

Query  563  EKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKA----------REHRFRNRVKRYVGIWCC  414
            E F  VFS  KDVKVI+FS++ DAF GFTDKA          RE +FRNRVKRYVGIWCC
Sbjct  553  EMFMKVFSSLKDVKVIKFSTVQDAFTGFTDKAGTFCFFSFEEREEKFRNRVKRYVGIWCC  612

Query  413  VENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            V + +PGH+YYDMYWDEKP WK +PPQT ++DHPP+
Sbjct  613  VPDHSPGHIYYDMYWDEKPGWKAVPPQTSEDDHPPY  648



>ref|XP_006878624.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
 gb|ERM94769.1| hypothetical protein AMTR_s00011p00260650 [Amborella trichopoda]
Length=638

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILR  585
            + G      GP I FREYS  DNPL+P++VKES LDV+LC EGS  C  +N     G+LR
Sbjct  487  LHGLPEDEFGPVIDFREYSFLDNPLLPKQVKESMLDVELCDEGSFNCH-ANEKEQHGVLR  545

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVEN  405
            FPK+S EE FK VFS +K VKVI+FSSM DAFQGF+D+ RE +FR+RVKRYVGIWCCV+ 
Sbjct  546  FPKHSNEETFKAVFSSYKHVKVIRFSSMQDAFQGFSDEGREEKFRHRVKRYVGIWCCVDQ  605

Query  404  QTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            +  GH+YYDMYWDEKPNWKP+ P+T  EDHP W
Sbjct  606  KRIGHIYYDMYWDEKPNWKPVLPETEHEDHPNW  638



>emb|CDX84192.1| BnaC04g09540D [Brassica napus]
Length=632

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 110/143 (77%), Gaps = 11/143 (8%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPG   REYS  DNP +P++VK+SWLDVQLC+EG EGC+ +N TT +G L+FPK S E+ 
Sbjct  500  GPGTGIREYSFLDNPALPKQVKDSWLDVQLCQEGKEGCEATNITTPSGFLKFPKRSNEDT  559

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK +FS F DVKVI+FSS            RE RFR RVKRYVGIWCC EN+TPGH+YYD
Sbjct  560  FKAIFSSFNDVKVIKFSS-----------GREERFRRRVKRYVGIWCCEENKTPGHIYYD  608

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKP+PPQTP+EDHPP
Sbjct  609  MYWDEKPGWKPVPPQTPEEDHPP  631



>ref|XP_009383104.1| PREDICTED: uncharacterized protein LOC103970914 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILR  585
            V G +    GP I FREYS   NP MP+ VKES L+VQLC   S+GC +SN TT+ G ++
Sbjct  529  VRGLSEEEFGPQIHFREYSFLQNPSMPKHVKESLLNVQLCDAHSKGCNISNETTSRGFIQ  588

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVEN  405
            FP+NSTE+ +  VFS +KD+KV+ FSSM +AF+GF+D+ARE +FR+RVKRYVG WCC+EN
Sbjct  589  FPRNSTEQMYMQVFSQYKDIKVLHFSSMANAFKGFSDEAREAKFRSRVKRYVGKWCCLEN  648

Query  404  QTPGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            +  GHVYYDMYWDEKP WKP PP+T ++D+PPW
Sbjct  649  RDLGHVYYDMYWDEKPGWKPEPPRTNEDDYPPW  681



>gb|EPS68350.1| hypothetical protein M569_06419, partial [Genlisea aurea]
Length=546

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 110/151 (73%), Gaps = 8/151 (5%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQE-------VKESWLDVQLCREGSEGCQLSNSTTATGILRFP  579
            GP I  REYS  DNP +PQ+       VK SWLDV LC   S+GC+++ +T +T +++FP
Sbjct  397  GPQIGIREYSFLDNPALPQQAIAYFTTVKYSWLDVTLCNPKSKGCEVT-TTNSTALIKFP  455

Query  578  KNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQT  399
            + S EE F  VFS FKDVKVI+FSSM  AF  F D+ RE  FR RVKRY+G WCC+EN+ 
Sbjct  456  RESAEETFMAVFSAFKDVKVIRFSSMQRAFSRFNDETREELFRKRVKRYLGAWCCLENKA  515

Query  398  PGHVYYDMYWDEKPNWKPIPPQTPQEDHPPW  306
             GH++YDMYWDEKPNWKP+PP+T  EDHPP+
Sbjct  516  LGHIFYDMYWDEKPNWKPVPPKTKAEDHPPF  546



>ref|XP_003562333.1| PREDICTED: uncharacterized protein LOC100845970 [Brachypodium 
distachyon]
Length=614

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P++VKES+L+VQLC E S  C  +N T     L   +NSTEE 
Sbjct  470  GPHIDFREYSFLENPSLPKQVKESFLEVQLCDEHSTRCSTANGTNKHRPLILARNSTEET  529

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               VFSL+K++K+IQFSSM DAF+GF D A E +FR+RVKRYVGIWCCVE +  GH+YYD
Sbjct  530  LLNVFSLYKNIKIIQFSSMVDAFRGFADAAVETKFRDRVKRYVGIWCCVELREIGHIYYD  589

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PP+  +EDHPPW
Sbjct  590  MYWDEKPGWKPHPPRNREEDHPPW  613



>ref|XP_006650304.1| PREDICTED: uncharacterized protein LOC102706084 [Oryza brachyantha]
Length=618

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P++VKES+ +V+LC E S  C  +N T     +  P+NSTE+ 
Sbjct  474  GPLIDFREYSFLENPSLPKQVKESFREVELCNEHSTRCSATNRTNKGAPVLLPRNSTEQT  533

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               +F  +KD+K++QFSSM DAF+GF+D A E +FRNRVKRYVG+WCCV+ +  GH+YYD
Sbjct  534  ILNIFKPYKDIKILQFSSMVDAFRGFSDAAVETKFRNRVKRYVGLWCCVQFREIGHIYYD  593

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PPQT +EDHPPW
Sbjct  594  MYWDEKPGWKPLPPQTKEEDHPPW  617



>ref|XP_009383108.1| PREDICTED: uncharacterized protein LOC103970917 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILR  585
            V G +    GP I FREYS   NP +P+ VKES L+VQLC   S+GC +SN TT+ G ++
Sbjct  137  VRGLSEEEFGPQIHFREYSFLQNPSVPKHVKESLLNVQLCDAHSKGCNISNETTSRGFIQ  196

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVEN  405
            FP+NSTE+ +  VFS +KD++V+ FSSM +AF GF+D+ARE  FRNRVKRYVG WCCV N
Sbjct  197  FPRNSTEQVYMQVFSQYKDIQVLHFSSMSNAFLGFSDEAREATFRNRVKRYVGTWCCVRN  256

Query  404  QTPGHVYYDMYWDEKP  357
            Q+P H+YYDMYWDEKP
Sbjct  257  QSPSHIYYDMYWDEKP  272



>ref|XP_002464281.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
 gb|EER91279.1| hypothetical protein SORBIDRAFT_01g015590 [Sorghum bicolor]
Length=615

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P+EVK+S LDVQLC E S  C   + T        P+NSTEEK
Sbjct  471  GPHIDFREYSFLENPSLPKEVKDSLLDVQLCDEHSSRCSAVDETDKHRPFLLPRNSTEEK  530

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               + S +KDVK+IQFSSM DAF GF D A E +FRNRVKRYVG+WCCVE +  GH+YYD
Sbjct  531  LLDLLSPYKDVKIIQFSSMVDAFGGFADAAVEKKFRNRVKRYVGLWCCVEFRDIGHIYYD  590

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PP+T ++DHPPW
Sbjct  591  MYWDEKPGWKPHPPETREQDHPPW  614



>gb|EPS58524.1| hypothetical protein M569_16289, partial [Genlisea aurea]
Length=402

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKE--SWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTE  564
            GP I FRE++ F+NP  P EVKE  SWL V LC   S+GC++SN+TT   IL+ P+NS+E
Sbjct  272  GPHIDFREHTFFENPSSPHEVKEEESWLKVHLCDTKSKGCRISNATTTGRILKLPENSSE  331

Query  563  EKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVY  384
            E  + VFS FKDVK IQFSSM DAF+GFTDK R   FR R+KRY G+WCCVEN TPGH+Y
Sbjct  332  ETLRAVFSRFKDVKTIQFSSMQDAFRGFTDKTRAESFRRRMKRYTGLWCCVENVTPGHIY  391

Query  383  YDMYWDEKPNW  351
            YDMYWDEKPNW
Sbjct  392  YDMYWDEKPNW  402



>gb|KHG12902.1| hypothetical protein F383_16835 [Gossypium arboreum]
Length=611

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 105/144 (73%), Gaps = 17/144 (12%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NP +PQ V+ESWLDVQLC+EG+E C  S++T+  G+LRFPK S+EE 
Sbjct  485  GPAINIREYSFLNNPFLPQRVRESWLDVQLCQEGTEDCHASSNTSQPGLLRFPKRSSEET  544

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             K VFS FKDVK                  RE +FR RVK+YVGIWCCVEN  PGH+YYD
Sbjct  545  LKKVFSSFKDVK-----------------TREEKFRKRVKQYVGIWCCVENHIPGHIYYD  587

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PP+TP++DHPP+
Sbjct  588  MYWDEKPGWKPVPPKTPEDDHPPF  611



>gb|ABF97349.1| expressed protein [Oryza sativa Japonica Group]
Length=622

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P++VKES+L+V+LC E S  C  +N T     +  P+NSTE+ 
Sbjct  474  GPHIDFREYSFLENPSLPKQVKESFLEVELCNEHSTRCSTTNRTNKGAPVLLPRNSTEQT  533

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               +F  +KD+K++QFSSM +AF GF+D A + +FRNRVKRYVG+WCCV+ +  GH+YYD
Sbjct  534  LLDIFKPYKDIKILQFSSMVNAFGGFSDAAVDTKFRNRVKRYVGLWCCVQLREIGHIYYD  593

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PPQT  EDHPPW
Sbjct  594  MYWDEKPGWKPLPPQTKVEDHPPW  617



>gb|EEC75649.1| hypothetical protein OsI_12401 [Oryza sativa Indica Group]
Length=622

 Score =   192 bits (487),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P++VKES+L+V+LC E S  C  +N T     +  P+NSTE+ 
Sbjct  474  GPHIDFREYSFLENPSLPKQVKESFLEVELCNEHSTRCSTTNRTNKGAPVLLPRNSTEQT  533

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               +F  +KD+K++QFSSM +AF GF+D A + +FRNRVKRYVG+WCCV+ +  GH+YYD
Sbjct  534  LLDIFKPYKDIKILQFSSMVNAFGGFSDAAVDTKFRNRVKRYVGLWCCVQLREIGHIYYD  593

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PPQT  EDHPPW
Sbjct  594  MYWDEKPGWKPLPPQTKVEDHPPW  617



>gb|EEE59420.1| hypothetical protein OsJ_11574 [Oryza sativa Japonica Group]
Length=683

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P++VKES+L+V+LC E S  C  +N T     +  P+NSTE+ 
Sbjct  410  GPHIDFREYSFLENPSLPKQVKESFLEVELCNEHSTRCSTTNRTNKGAPVLLPRNSTEQT  469

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               +F  +KD+K++QFSSM +AF GF+D A + +FRNRVKRYVG+WCCV+ +  GH+YYD
Sbjct  470  LLDIFKPYKDIKILQFSSMVNAFGGFSDAAVDTKFRNRVKRYVGLWCCVQLREIGHIYYD  529

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP+PPQT  EDHPPW
Sbjct  530  MYWDEKPGWKPLPPQTKVEDHPPW  553



>ref|XP_004982506.1| PREDICTED: uncharacterized protein LOC101753789 [Setaria italica]
Length=619

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P+EVKES L+VQLC + S  C   N T     L   +NSTEEK
Sbjct  475  GPHIDFREYSFLENPSLPKEVKESLLEVQLCDDHSSRCSAVNGTDKHRPLLLSRNSTEEK  534

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               +FS +K VKVIQFSSM DAF GF D   E +FRNRVKRYVG+WCCVE +  GH+YYD
Sbjct  535  LLNIFSSYKSVKVIQFSSMVDAFGGFADADVEMKFRNRVKRYVGLWCCVELREIGHIYYD  594

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PP+T ++DHPPW
Sbjct  595  MYWDEKPGWKPHPPETREQDHPPW  618



>ref|XP_010540709.1| PREDICTED: uncharacterized protein LOC104814389 [Tarenaya hassleriana]
Length=598

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS FDNPL+P+ VKESWLDV+LC EG   C+ S++T ++G ++FPK S+EE+
Sbjct  471  GPGIGIREYSFFDNPLLPKHVKESWLDVKLCHEG---CETSDNTISSGFIKFPKRSSEER  527

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            FK  FS  KDVKVI F S+ DAF GF+DK RE +FR RVKRYVG WCCVEN+T GH+YYD
Sbjct  528  FKATFSSLKDVKVINFYSVQDAFTGFSDKEREEKFRRRVKRYVGRWCCVENRTLGHIYYD  587

Query  377  MYWDEKP  357
            MYWDEKP
Sbjct  588  MYWDEKP  594



>ref|NP_001143144.1| hypothetical protein [Zea mays]
 gb|ACG29327.1| hypothetical protein [Zea mays]
 gb|ACN27867.1| unknown [Zea mays]
 gb|ACR35913.1| unknown [Zea mays]
 tpg|DAA50140.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=615

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            G  I FREYS  +NP +P+EVK+S L+V+LC E S  C   +     G    P+NSTEEK
Sbjct  471  GQHIDFREYSFLENPSLPKEVKDSLLEVELCDEHSSRCSAIDEIDKHGTFLLPRNSTEEK  530

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               + S +KDVK+IQFSSM DAF GF D A E +FRNRV RYVG+WCCVE +  GH+YYD
Sbjct  531  LLDLLSSYKDVKIIQFSSMVDAFGGFADAAVEKKFRNRVNRYVGLWCCVEFREIGHIYYD  590

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PP+T ++DHPPW
Sbjct  591  MYWDEKPGWKPHPPETREQDHPPW  614



>ref|XP_010235552.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235553.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235554.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_010235555.1| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
 ref|XP_003572620.2| PREDICTED: uncharacterized protein LOC100829311 [Brachypodium 
distachyon]
Length=642

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +P++VKES+L+VQLC E S  C  +N T     L   +N+TEE 
Sbjct  498  GPHIDFREYSFLENPSLPKQVKESFLEVQLCDEHSTRCSTANETNKHRPLILARNNTEET  557

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
               VFS +K++K++QFSS+ DAF+GF D A E +FR+RVKRYVGIWCCVE +  GH+YYD
Sbjct  558  LLNVFSPYKNIKILQFSSIVDAFRGFADAAVETKFRDRVKRYVGIWCCVEFREIGHIYYD  617

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQ  ++DHPPW
Sbjct  618  MYWDEKPGWKPHPPQNREDDHPPW  641



>gb|KHF98530.1| hypothetical protein F383_12515 [Gossypium arboreum]
Length=605

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 100/144 (69%), Gaps = 29/144 (20%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S++T+  G+LRFPKNSTEE 
Sbjct  491  GPAINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM  550

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
                                          RE +FRNR+KRYVGIWCCVEN TPGH+YYD
Sbjct  551  -----------------------------TREEKFRNRMKRYVGIWCCVENHTPGHIYYD  581

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
            MYWDEKP WKP PPQTP+EDHPP+
Sbjct  582  MYWDEKPGWKPAPPQTPEEDHPPF  605



>emb|CDP12730.1| unnamed protein product [Coffea canephora]
Length=622

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 107/138 (78%), Gaps = 2/138 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            G  I  RE+S F+NPLMPQ+VKES L V LC+EGSE CQ+SN+T+ TG+L+ PKNS+EE 
Sbjct  487  GQPIRIREHSFFENPLMPQKVKESRLVVSLCQEGSEDCQVSNATSQTGVLKVPKNSSEET  546

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
            +KTVFS FKDVKV+QFSSM DAF+GFTDK+ E  FR RV  Y  IWCCV N T   + YD
Sbjct  547  YKTVFSSFKDVKVVQFSSMQDAFRGFTDKSMEENFRKRVTAYTSIWCCV-NYTQV-ISYD  604

Query  377  MYWDEKPNWKPIPPQTPQ  324
            +YWDEKP+WKP P + P+
Sbjct  605  IYWDEKPDWKPKPSRIPE  622



>gb|EPS68351.1| hypothetical protein M569_06420, partial [Genlisea aurea]
Length=92

 Score =   157 bits (398),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -2

Query  590  LRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCV  411
            L+ P+ S+EE FK VFS FKDVKVI+FSSM  AF GFTDK RE  FR RVK Y GIWCCV
Sbjct  1    LKLPRESSEETFKAVFSPFKDVKVIRFSSMQRAFAGFTDKTREASFRKRVKGYTGIWCCV  60

Query  410  ENQTPGHVYYDMYWDEKPNWKPIPPQTPQEDH  315
            EN+TPGH+YYDMYWDEKPNWKP+PPQTP EDH
Sbjct  61   ENKTPGHIYYDMYWDEKPNWKPVPPQTPAEDH  92



>gb|KHN03113.1| hypothetical protein glysoja_049543 [Glycine soja]
Length=610

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 93/147 (63%), Gaps = 32/147 (22%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNS---TTATGILRFPKNST  567
            GP I FREYS+ DNP +P EVK+SWLDVQLC+EG++ C  S S       G+L+FPK+S 
Sbjct  493  GPQIDFREYSILDNPSLPSEVKKSWLDVQLCKEGTQDCDASASNDTNVGGGVLKFPKHSN  552

Query  566  EEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHV  387
            EE                               RE +FRNRVKRYVGIWCCV + TPGH+
Sbjct  553  EE-----------------------------TEREDKFRNRVKRYVGIWCCVPDHTPGHI  583

Query  386  YYDMYWDEKPNWKPIPPQTPQEDHPPW  306
            YYDMYWDEKP WK +PPQT ++DHPP+
Sbjct  584  YYDMYWDEKPGWKAVPPQTSEDDHPPY  610



>ref|XP_002988322.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ10741.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=557

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +PQE+K S L ++LC  G +     +S  + G +  P N T+ +
Sbjct  417  GPAIDFREYSFLENPRVPQEIKTSRLSIRLCSRGKD----CSSEVSQGAIELPINMTDTQ  472

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             +  FS  KDVK++ FS+M + F GF DK +  +FR R+++Y GIWCC+E+   GH+YYD
Sbjct  473  LRDEFSRHKDVKILDFSTMQNVFGGFVDKDKALKFRRRLQKYTGIWCCLESLERGHIYYD  532

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
             +WDEKP WKP+PP  P+ DHPP+
Sbjct  533  FFWDEKPGWKPLPPTRPENDHPPF  556



>gb|KHN41773.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine 
soja]
Length=1470

 Score =   162 bits (409),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 73/143 (51%), Positives = 91/143 (64%), Gaps = 29/143 (20%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS+ DNP++P EVK+SWLDVQLC++G++ C  SN+TT  G+L+FP++S EE+
Sbjct  484  GPGIDIREYSILDNPILPSEVKKSWLDVQLCKDGTQDCFASNNTTVGGVLKFPRHSNEER  543

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             +                                   RVKRY GIWCCV + TPGH+YYD
Sbjct  544  EREDRFR-----------------------------KRVKRYPGIWCCVLDHTPGHIYYD  574

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            MYWDEKP WKPIPPQT  +DHPP
Sbjct  575  MYWDEKPEWKPIPPQTSADDHPP  597



>ref|XP_002991425.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ07537.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=545

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 5/144 (3%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS  +NP +PQE+K S L ++LC  G + C   +S  + G +  P N T+ +
Sbjct  406  GPAIDFREYSFLENPRVPQEIKTSRLSIRLCSRG-KNC---SSEVSQGAIELPINMTDTQ  461

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
             +  FS  KDVK++ FS+M + F GF DK    +FR R++RY  IWCC+E+   GH+YYD
Sbjct  462  LRDEFSRHKDVKILDFSTMKNVFGGFVDKV-TLKFRRRLQRYTAIWCCLESLERGHIYYD  520

Query  377  MYWDEKPNWKPIPPQTPQEDHPPW  306
             +WDEKP WKP+PP  P+ DHPP+
Sbjct  521  FFWDEKPGWKPLPPTRPENDHPPF  544



>ref|XP_001761094.1| predicted protein [Physcomitrella patens]
 gb|EDQ74161.1| predicted protein, partial [Physcomitrella patens]
Length=526

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 95/143 (66%), Gaps = 2/143 (1%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I  REYS  +NPL+  +VK+S L V+LC     GC   N  + +G+L+ PKNST+E+
Sbjct  385  GPQIGIREYSFLENPLLENKVKKSVLKVKLCDRKLAGCSHKNKVS-SGVLKLPKNSTDEE  443

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYD  378
                  +F   K+++F+S  D F GF +     +F  R+K Y GIWCCV ++TPGH++YD
Sbjct  444  LSAKLDIFNKFKILEFTSAIDVFGGFRNIV-SMKFTRRIKSYTGIWCCVMDKTPGHIWYD  502

Query  377  MYWDEKPNWKPIPPQTPQEDHPP  309
            +YWDEKPNWKP+PP TP +DH P
Sbjct  503  IYWDEKPNWKPLPPATPADDHQP  525



>gb|KCW72694.1| hypothetical protein EUGRSUZ_E01147 [Eucalyptus grandis]
Length=611

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI+ REYSL DNP MP++VKESWLDV+LC+ G++ CQ++NST++ G++R PK S EE 
Sbjct  495  GPGINIREYSLLDNPSMPKQVKESWLDVKLCQGGTKDCQVTNSTSSPGMIRLPKRSNEET  554

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRF  453
             KT FS FKD+KVIQFSSM DAF+GFTD+ R H +
Sbjct  555  LKTAFSSFKDIKVIQFSSMQDAFEGFTDQVRIHLY  589



>gb|KJB25101.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=588

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S++T+  G+LRFPKNSTEE 
Sbjct  491  GPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM  550

Query  557  FKTVFSLFKDVKVIQFSSMHDAFQGFTDKAR  465
            FKTVFS FKDVKVIQFSSM  AF  FTDKA+
Sbjct  551  FKTVFSSFKDVKVIQFSSMQGAFYSFTDKAK  581



>tpg|DAA50139.1| TPA: hypothetical protein ZEAMMB73_624371 [Zea mays]
Length=67

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  503  MHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDMYWDEKPNWKPIPPQTPQ  324
            M DAF GF D A E +FRNRV RYVG+WCCVE +  GH+YYDMYWDEKP WKP PP+T +
Sbjct  1    MVDAFGGFADAAVEKKFRNRVNRYVGLWCCVEFREIGHIYYDMYWDEKPGWKPHPPETRE  60

Query  323  EDHPPW  306
            +DHPPW
Sbjct  61   QDHPPW  66



>ref|XP_009383105.1| PREDICTED: uncharacterized protein LOC103970915 [Musa acuminata 
subsp. malaccensis]
Length=245

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 0/99 (0%)
 Frame = -2

Query  764  VEGTTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILR  585
            + G +    GP I FREYS   NP +P+ VKES L+V LC   SE C +SN T++ G ++
Sbjct  137  LRGLSEEVFGPQIHFREYSFLQNPSVPKHVKESLLNVHLCDAHSEECNISNETSSHGFIQ  196

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKA  468
            FP+NSTE+ +  VFS +KD+KV+ FSSM +AFQGF+D+ 
Sbjct  197  FPRNSTEQMYMQVFSQYKDIKVLHFSSMTNAFQGFSDQV  235



>ref|XP_002506735.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
 gb|ACO67993.1| glycosyltransferase family 77 protein [Micromonas sp. RCC299]
Length=746

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 79/132 (60%), Gaps = 5/132 (4%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCRE-GSEGCQLSNSTTATG---ILRFPKNS  570
            GP I FREYS F NPL+P  V++S + V L  E G E C  +    A      +   +N 
Sbjct  595  GPHIDFREYSFFRNPLVPTNVRDSTVTVSLVDECGREECTQAVGKAAPAGQDTIVAARNF  654

Query  569  TEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGH  390
            T+ + +T+ + +KDVKV+ F+SM  AF  F D     +F NR+K+Y  IWCC +++ PGH
Sbjct  655  TDVQVQTLLTEYKDVKVLNFTSMVGAFSQFEDPEDAKKFSNRIKKYAAIWCC-KHRNPGH  713

Query  389  VYYDMYWDEKPN  354
            ++YDM +D  P+
Sbjct  714  IWYDMEFDIVPH  725



>ref|XP_003062865.1| glycosyltransferase family 77 protein [Micromonas pusilla CCMP1545]
 gb|EEH52804.1| glycosyltransferase family 77 protein [Micromonas pusilla CCMP1545]
Length=525

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 74/139 (53%), Gaps = 11/139 (8%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLC--------REGSEGC-QLSNSTTATGILR  585
            GPGI+FRE+S F+NP +P  V  S ++V             G E C Q       +G+ R
Sbjct  369  GPGIAFREHSFFENPNVPASVAASTVEVTFVPSCGGGGGGGGGEKCTQAEGEPAPSGVKR  428

Query  584  F--PKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCV  411
               P N+T+ +   + S    VKV+ F+S   AF    D A   +F  RVKRY G+WCCV
Sbjct  429  VVAPGNATDVEIANLLSNHAGVKVLNFTSTLGAFGRHADAADAKKFSTRVKRYAGLWCCV  488

Query  410  ENQTPGHVYYDMYWDEKPN  354
             +  PGH++YDM +D  P+
Sbjct  489  FDAVPGHIWYDMEFDVVPH  507



>emb|CAN79199.1| hypothetical protein VITISV_040773 [Vitis vinifera]
Length=715

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  561
            GPGI+ REYS FDNPLMP +VK+SWLDVQLCREGS GC ++N+T++ GI R PK+STEE
Sbjct  583  GPGINIREYSFFDNPLMPXQVKDSWLDVQLCREGSPGCNVTNNTSSLGI-RLPKHSTEE  640



>gb|KJB25098.1| hypothetical protein B456_004G177500 [Gossypium raimondii]
Length=559

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I+ REYS  +NPL+PQ+VKESWLDVQLC+EG+E C  S++T+  G+LRFPKNSTEE 
Sbjct  491  GPEINIREYSFLNNPLLPQQVKESWLDVQLCQEGTEDCHASSNTSRPGLLRFPKNSTEEM  550

Query  557  FKTVFSLF  534
               +  L 
Sbjct  551  VWLILHLL  558



>ref|XP_002956941.1| hypothetical protein VOLCADRAFT_83868 [Volvox carteri f. nagariensis]
 gb|EFJ42066.1| hypothetical protein VOLCADRAFT_83868 [Volvox carteri f. nagariensis]
Length=647

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 72/138 (52%), Gaps = 4/138 (3%)
 Frame = -2

Query  770  CDVEG---TTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTA  600
             D+EG     R   GP + +REYS F+NP M + V ES + V +C+ G   C   ++   
Sbjct  383  LDLEGGWYPQRPEFGPHLEYREYSFFNNPRMNKAVNESRVTVVICKPGEADCSNGDAPAP  442

Query  599  TGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIW  420
             G++R       ++        +  K+I  S+  +AF+ F+ K ++ +F NR+  Y  ++
Sbjct  443  DGVVRLAPQLNSDQINKALEAVRGFKIITLSNAAEAFKEFSSKEKQDQFVNRMNHYASVF  502

Query  419  CCVENQTPGHVYYDMYWD  366
            CC+ N  PG ++YD + D
Sbjct  503  CCLAN-NPGWIWYDFFAD  519



>ref|XP_002957630.1| hypothetical protein VOLCADRAFT_77645 [Volvox carteri f. nagariensis]
 gb|EFJ41296.1| hypothetical protein VOLCADRAFT_77645 [Volvox carteri f. nagariensis]
Length=535

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 64/133 (48%), Gaps = 7/133 (5%)
 Frame = -2

Query  746  GGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGI------LR  585
            G  GP    REYS F+N  M   V++  + V+LC  G+  C          I      +R
Sbjct  383  GDYGPRTEIREYSFFNNSKMTPRVRDDRVVVELCNPGTPECSDGREPAKLQIDGGVAKVR  442

Query  584  FPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVEN  405
                    + +   S  K  KV+ F++M +A   F+D A   RF NR+K Y  IWCCV  
Sbjct  443  VQAGLPSGQLEVALSSVKTTKVLHFTTMANAMGDFSDSAVAARFTNRMKLYGSIWCCVLA  502

Query  404  QTPGHVYYDMYWD  366
              PGH++YDM +D
Sbjct  503  H-PGHIHYDMLFD  514



>gb|KIZ02111.1| hypothetical protein MNEG_5846 [Monoraphidium neglectum]
Length=233

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (7%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I++RE+S  ++  +P  V+ S + V  CR GS GC   ++      L F +   EE+
Sbjct  87   GPDIAYREHSFLNHSALPDVVRGSVVHVVSCRHGSVGCATGDNPA---TLEFNRLFVEER  143

Query  557  FKT-----VFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPG  393
              +       S    + V+ F+S+  AF  F+  A   RF+ R+ +Y  +WCCV+   PG
Sbjct  144  LDSDRLAMALSSVASISVLNFTSIGSAFGNFSRPADFTRFQRRMAQYGAVWCCVDAH-PG  202

Query  392  HVYYDMYWD  366
            HV+YD++WD
Sbjct  203  HVHYDLWWD  211



>ref|XP_005852062.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
 gb|EFN59960.1| hypothetical protein CHLNCDRAFT_133059 [Chlorella variabilis]
Length=727

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 71/131 (54%), Gaps = 5/131 (4%)
 Frame = -2

Query  743  GIGPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTE  564
            G  P I FREYS   N   PQ +K+S + +    + ++  +L        ++R P+  T+
Sbjct  598  GTPPPIPFREYSFLQNERTPQALKDSKVVISPATDATKVEELKEGGKT--VVRIPQGQTD  655

Query  563  EKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCC---VENQTPG  393
             + + + + +KDV+++ F+++H AF G+ DKA   +F++R+   +G +CC    E +  G
Sbjct  656  AQLRELLAPYKDVQLLHFNTLHKAFGGWEDKAMVGKFQHRLSHMMGFFCCKKVKEGEDGG  715

Query  392  HVYYDMYWDEK  360
            + YY    D K
Sbjct  716  YAYYRFLEDPK  726



>ref|XP_001690605.1| hypothetical protein CHLREDRAFT_114491 [Chlamydomonas reinhardtii]
 gb|EDP05864.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=501

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 70/133 (53%), Gaps = 7/133 (5%)
 Frame = -2

Query  770  CDVEG---TTRGGIGPGISFREYSLFDNPLMPQEVKESWLDVQLCR-EGSEGCQLSNSTT  603
             D+EG    TR   G  + +REYS F+NP M + V ES + V++C    + GC+   +  
Sbjct  372  LDLEGGWHNTRPEFGAHLHYREYSFFNNPRMSKAVNESRVTVEICAPPDATGCE-EGAGP  430

Query  602  ATGILRFPKNSTEEKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGI  423
            A G+++   N             +D K+I   +  DAF GF+D   + R+ NR+K Y  +
Sbjct  431  ADGVVKLMPNLKSAAVAKALEAVQDKKIIVLKNAKDAFSGFSDP-EQARYENRLKHYTSV  489

Query  422  WCCVENQTPGHVY  384
            +CC++ + PG ++
Sbjct  490  FCCLD-KNPGWIW  501



>ref|XP_005843950.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
 gb|EFN51848.1| hypothetical protein CHLNCDRAFT_37217 [Chlorella variabilis]
Length=631

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 66/131 (50%), Gaps = 13/131 (10%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GP I FREYS   N      +  S L + +C++ S        T A G  +      EE 
Sbjct  493  GPNIEFREYSFLQNQ-HAAALNASVLTLDICQDAS--------TCADGADKLKPQLHEEA  543

Query  557  FKTVFSLFK--DVKVIQF-SSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHV  387
             K   +  K  + KV+ F   +   F G+TD+A   RF+ R+ RY  IWCCV N  PGH+
Sbjct  544  LKAALTEGKVAEAKVLHFVGGIERLFGGWTDEAAGERFKRRLDRYGSIWCCV-NAHPGHI  602

Query  386  YYDMYWDEKPN  354
            +YD ++D+ P+
Sbjct  603  WYDFFFDQLPH  613



>ref|XP_004167890.1| PREDICTED: uncharacterized protein LOC101229261 [Cucumis sativus]
Length=77

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = -3

Query  529  MSK*FSSHQCMMPSKVLLTRPGNTDSGTESSGMWVYGVVWKIKHQVTYTTTCIGMRNLIG  350
            MS+  SS QC MPS V L R G   SGTESS    YGVVW+++   TY TTC GMRN IG
Sbjct  1    MSRLSSSLQCKMPSLVSLIRKGKRSSGTESSVTSAYGVVWRMQLLATYITTCTGMRNPIG  60

Query  349  NQYRPRLHKKITPLGEI  299
            N  R    +KI  L ++
Sbjct  61   NHTRLEHPRKIDLLCKV  77



>emb|CDX84231.1| BnaC04g09930D [Brassica napus]
Length=384

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 27/95 (28%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTATGILRFPKNSTEEK  558
            GPGI  REYS  DNP +P++VK+                       +G L+FPK S E+ 
Sbjct  295  GPGIGIREYSFLDNPSLPKQVKD----------------------PSGFLKFPKRSNEDT  332

Query  557  -----FKTVFSLFKDVKVIQFSSMHDAFQGFTDKA  468
                 F ++FS F DVKVI+FSS+ DAF GF+DKA
Sbjct  333  VTKDLFSSIFSSFNDVKVIKFSSVEDAFTGFSDKA  367



>ref|XP_005646140.1| hypothetical protein COCSUDRAFT_17381, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21596.1| hypothetical protein COCSUDRAFT_17381, partial [Coccomyxa subellipsoidea 
C-169]
Length=529

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 7/129 (5%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWL-DVQLCREGSEGCQLSNSTTATGILRFPKNSTEE  561
            GP I +REYS  DNP     + E+ + +V +C+   + C+  ++   +  L+   +    
Sbjct  389  GPDIPYREYSFLDNP--KTNITEAGIFNVVVCQVRRD-CRPPDAQANSVALQ--SDPEHA  443

Query  560  KFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYY  381
                  + F   +V+ F  M  A+  F  K    RF  R K Y  +WCCV+   PGHV+Y
Sbjct  444  SLIQALAPFSSKRVLHFEDMRHAYGNFPTKEYRDRFEQRTKLYTSLWCCVDKH-PGHVWY  502

Query  380  DMYWDEKPN  354
            DM+WD  P+
Sbjct  503  DMWWDVIPH  511



>ref|XP_001692787.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03806.1| predicted protein [Chlamydomonas reinhardtii]
Length=703

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 66/136 (49%), Gaps = 14/136 (10%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQL--------CREGSEGCQLSNSTTATGILRF  582
            GP   FREYS F+N  M   V++  + V++        C +GS+  QL        I   
Sbjct  549  GPSTEFREYSFFNNSRMTPAVRDDRVVVEVCDTAGAAGCSDGSKPAQLVTEGGVKKIKIA  608

Query  581  PKNSTEEKFKTVFS--LFKDVKVIQFSSMH--DAFQGFTDKAREHRFRNRVKRYVGIWCC  414
            P  S+ E   T  S    K  KV+ F+SM   +  Q F++     RF  R+K Y  IWCC
Sbjct  609  PFLSSAE-LATALSDPAVKGAKVLHFTSMAGFNFPQAFSEPGAAARFVERMKLYGSIWCC  667

Query  413  VENQTPGHVYYDMYWD  366
            V    PGH++YD+ WD
Sbjct  668  VLAH-PGHIHYDLLWD  682



>ref|XP_005649227.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24683.1| hypothetical protein COCSUDRAFT_62105 [Coccomyxa subellipsoidea 
C-169]
Length=857

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 34/110 (31%), Positives = 55/110 (50%), Gaps = 8/110 (7%)
 Frame = -2

Query  737  GPGISFREYSLFDNPLMPQEVKESWLDVQ--LCREGSEGCQLSNSTTATGILRFPKNSTE  564
            GP I+FRE+S +DNP  P E+K++ ++V     RE +   ++ N  T       P N ++
Sbjct  733  GPPIAFREHSFWDNPDTPAELKDNQVEVVPVATREWNPAKRMGNQLT------IPANLSD  786

Query  563  EKFKTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCC  414
            E  +       D+KV+   ++   F+GF+D      F  R+     IWCC
Sbjct  787  EDLRRTLQPHDDIKVLMVRNVTGIFRGFSDMTAADGFWRRMAHISSIWCC  836



>ref|XP_011397701.1| hypothetical protein F751_1692 [Auxenochlorella protothecoides]
 gb|KFM24813.1| hypothetical protein F751_1692 [Auxenochlorella protothecoides]
Length=291

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 62/141 (44%), Gaps = 17/141 (12%)
 Frame = -2

Query  725  SFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTAT---GILRFPKNSTEEKF  555
             FRE+S    P    E+  S L V +C++  EGC   ++       G+   P  S E+  
Sbjct  150  GFREHSFLSKP-EAAELNASRLLVTICQDAEEGCAAGDAAAEVQDGGVRLQPGRSLEQLR  208

Query  554  KTVFSLFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDM  375
              +    +  K++ F+         + +  E RF +R+  +  I CCV+    GH++YD+
Sbjct  209  VALSGALEKHKLLHFTGGMGRALILSPEEVE-RFGSRLNSFTSIHCCVKAPV-GHIWYDL  266

Query  374  YWD-----------EKPNWKP  345
            +WD           ++  WKP
Sbjct  267  FWDIPGHTDRHQRTQQGEWKP  287


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/178 (24%), Positives = 76/178 (43%), Gaps = 13/178 (7%)
 Frame = -2

Query  725  SFREYSLFDNPLMPQEVKESWLDVQLCREGSEGCQLSNSTTAT--GILRFPKNSTEEKFK  552
             FRE+S    P    E+  S L V +C++  EGC   ++      G +R  +  + E+ +
Sbjct  8    GFREHSFLSKP-EAAELNASRLLVTICQDAEEGCAAGDAAAEVQDGGVRLVRLRSLEQLR  66

Query  551  TVFS-LFKDVKVIQFSSMHDAFQGFTDKAREHRFRNRVKRYVGIWCCVENQTPGHVYYDM  375
               S   +  K++ F+         + +  E RF +R+  +  I CCV+    GH++YD+
Sbjct  67   VALSGALEKHKLLHFTGGMGRALILSPEEVE-RFGSRLNSFTSIHCCVKAPV-GHIWYDL  124

Query  374  YWDEKPNWKPIPPQTPQEDHPPW*NPRVALLTSLHRHSNFNTAKIGKIS*TALWLTAC  201
            +WD       IP  T +            L      HS  +  +  +++ + L +T C
Sbjct  125  FWD-------IPGHTDRHQRTQQGEMSGKLPNGFREHSFLSKPEAAELNASRLLVTIC  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520