BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028F01

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010023766.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    346   1e-115   
ref|XP_010023765.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    346   4e-115   
ref|XP_010023764.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    346   2e-114   
ref|XP_010065851.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    350   3e-114   Eucalyptus grandis [rose gum]
gb|KCW63539.1|  hypothetical protein EUGRSUZ_G01176                     350   4e-114   Eucalyptus grandis [rose gum]
gb|KCW60134.1|  hypothetical protein EUGRSUZ_H02859                     346   5e-113   Eucalyptus grandis [rose gum]
gb|KCW63540.1|  hypothetical protein EUGRSUZ_G01176                     341   8e-111   Eucalyptus grandis [rose gum]
ref|XP_010650169.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    339   6e-110   Vitis vinifera
ref|XP_009589035.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    337   6e-110   
ref|XP_007035291.1|  GLU-ADT subunit B isoform 1                        337   5e-109   
ref|XP_009357958.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    337   6e-109   Pyrus x bretschneideri [bai li]
ref|XP_009797350.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    336   7e-109   Nicotiana sylvestris
ref|XP_009589032.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    336   8e-109   Nicotiana tomentosiformis
ref|XP_010326798.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    336   1e-108   Solanum lycopersicum
ref|XP_008460666.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    335   1e-108   Cucumis melo [Oriental melon]
ref|XP_006340880.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    335   2e-108   
ref|XP_008340674.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    337   4e-108   
ref|XP_011091352.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    334   4e-108   
gb|KDP33336.1|  hypothetical protein JCGZ_12885                         327   8e-108   Jatropha curcas
ref|XP_008224029.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    333   9e-108   Prunus mume [ume]
ref|XP_008224027.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    333   1e-107   Prunus mume [ume]
gb|KGN61558.1|  hypothetical protein Csa_2G170810                       333   1e-107   Cucumis sativus [cucumbers]
ref|XP_004147167.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    333   2e-107   
ref|XP_002528338.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    330   3e-106   
gb|KDO52268.1|  hypothetical protein CISIN_1g043020mg                   330   5e-106   Citrus sinensis [apfelsine]
gb|EYU43758.1|  hypothetical protein MIMGU_mgv1a003561mg                329   1e-105   Erythranthe guttata [common monkey flower]
ref|XP_006480233.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    327   2e-105   Citrus sinensis [apfelsine]
ref|XP_006297361.1|  hypothetical protein CARUB_v10013381mg             327   2e-105   Capsella rubella
gb|KJB38438.1|  hypothetical protein B456_006G255000                    328   3e-105   Gossypium raimondii
ref|XP_007223309.1|  hypothetical protein PRUPE_ppa003810mg             324   4e-104   
ref|NP_564530.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B         324   5e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530925.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    324   6e-104   Glycine max [soybeans]
ref|XP_011462425.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    323   8e-104   Fragaria vesca subsp. vesca
ref|XP_010264847.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    322   2e-103   Nelumbo nucifera [Indian lotus]
ref|XP_003525222.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    322   2e-103   Glycine max [soybeans]
ref|XP_010532821.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    322   3e-103   Tarenaya hassleriana [spider flower]
gb|KHN21619.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B, ch...    322   3e-103   Glycine soja [wild soybean]
ref|XP_010490175.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    321   3e-103   
ref|XP_004169939.1|  PREDICTED: LOW QUALITY PROTEIN: glutamyl-tRN...    322   4e-103   
ref|XP_010527184.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    322   4e-103   Tarenaya hassleriana [spider flower]
ref|XP_006420387.1|  hypothetical protein CICLE_v10004652mg             322   4e-103   
ref|XP_010467088.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    321   6e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010412724.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    320   1e-102   Camelina sativa [gold-of-pleasure]
gb|KFK39734.1|  hypothetical protein AALP_AA3G281100                    319   4e-102   Arabis alpina [alpine rockcress]
ref|XP_007160438.1|  hypothetical protein PHAVU_002G322100g             317   3e-101   Phaseolus vulgaris [French bean]
ref|XP_011029735.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    317   3e-101   Populus euphratica
ref|XP_004490131.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    316   4e-101   Cicer arietinum [garbanzo]
ref|XP_009135887.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    314   3e-100   Brassica rapa
ref|XP_010667086.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    313   6e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004979428.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    313   6e-100   Setaria italica
ref|XP_006418762.1|  hypothetical protein EUTSA_v10002467mg             312   2e-99    Eutrema salsugineum [saltwater cress]
ref|XP_003614593.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    311   5e-99    Medicago truncatula
ref|XP_010667083.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    314   7e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|AFW64900.1|  hypothetical protein ZEAMMB73_511569                    310   8e-99    
ref|XP_009420135.1|  PREDICTED: LOW QUALITY PROTEIN: glutamyl-tRN...    306   2e-98    
ref|XP_002314512.2|  hypothetical protein POPTR_0010s07520g             307   3e-98    
ref|XP_006662992.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    308   5e-98    Oryza brachyantha
ref|XP_002450901.1|  hypothetical protein SORBIDRAFT_05g020870          308   5e-98    Sorghum bicolor [broomcorn]
ref|XP_008796400.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    308   1e-97    Phoenix dactylifera
sp|A2ZF53.1|GATB_ORYSI  RecName: Full=Glutamyl-tRNA(Gln) amidotra...    307   1e-97    Oryza sativa Indica Group [Indian rice]
ref|NP_001068056.2|  Os11g0544800                                       306   3e-97    
emb|CDX93007.1|  BnaA03g37290D                                          306   6e-97    
emb|CDX94828.1|  BnaC03g43600D                                          305   2e-96    
ref|XP_010936074.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    305   2e-96    Elaeis guineensis
ref|XP_003575991.2|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    303   5e-96    Brachypodium distachyon [annual false brome]
gb|EMS48922.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...    302   1e-95    Triticum urartu
gb|EPS62098.1|  hypothetical protein M569_12692                         297   2e-94    Genlisea aurea
gb|EMT05438.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...    298   3e-94    
gb|ADE76344.1|  unknown                                                 296   1e-93    Picea sitchensis
dbj|BAJ94910.1|  predicted protein                                      297   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006854350.1|  hypothetical protein AMTR_s00039p00150510          293   5e-92    Amborella trichopoda
gb|EMS55713.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...    287   8e-90    Triticum urartu
dbj|BAJ96366.1|  predicted protein                                      288   1e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25645.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...    281   2e-87    
ref|XP_010110683.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B      272   3e-84    
ref|XP_002311699.2|  GLU-TRNA AMIDOTRANSFERASE SUBUNIT B family p...    272   3e-84    
ref|XP_009797353.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    269   1e-83    Nicotiana sylvestris
gb|AAF79700.1|AC020889_8  T1N15.14                                      271   9e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936076.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    268   2e-82    Elaeis guineensis
gb|KHN16523.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B, ch...    252   2e-77    Glycine soja [wild soybean]
ref|XP_001782927.1|  predicted protein                                  247   2e-74    
gb|KCW63541.1|  hypothetical protein EUGRSUZ_G01176                     236   7e-71    Eucalyptus grandis [rose gum]
emb|CBI23733.3|  unnamed protein product                                228   8e-70    Vitis vinifera
ref|XP_002972781.1|  hypothetical protein SELMODRAFT_441971             231   1e-68    
emb|CDO99325.1|  unnamed protein product                                221   1e-67    Coffea canephora [robusta coffee]
gb|KJB38439.1|  hypothetical protein B456_006G255000                    223   1e-65    Gossypium raimondii
ref|NP_973991.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B         218   9e-64    Arabidopsis thaliana [mouse-ear cress]
ref|WP_015185138.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    216   5e-63    Microcoleus sp. PCC 7113
ref|WP_006618596.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    210   9e-61    Arthrospira platensis
ref|WP_015190648.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    208   4e-60    Gloeocapsa sp. PCC 7428
ref|WP_015157951.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    208   5e-60    Chamaesiphon minutus
ref|WP_011058226.1|  glutamyl-tRNA amidotransferase subunit B           208   6e-60    Thermosynechococcus
ref|WP_006621670.1|  MULTISPECIES: glutamyl-tRNA amidotransferase...    208   6e-60    Arthrospira
ref|WP_036018373.1|  glutamyl-tRNA amidotransferase                     208   6e-60    Leptolyngbya sp. PCC 7375
gb|EKV00390.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amid...    208   8e-60    Leptolyngbya sp. PCC 7375
ref|WP_023076379.1|  aspartyl glutamyl-trna(asn gln) amidotransfe...    207   1e-59    Leptolyngbya sp. Heron Island J
ref|WP_009785353.1|  glutamyl-tRNA amidotransferase subunit B           207   2e-59    Lyngbya sp. PCC 8106
ref|WP_023064119.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    206   4e-59    Lyngbya aestuarii
ref|WP_019506831.1|  glutamyl-tRNA amidotransferase subunit B           206   4e-59    Pleurocapsa sp. PCC 7319
ref|WP_008177699.1|  glutamyl-tRNA amidotransferase subunit B           204   1e-58    Moorea producens
ref|WP_006667920.1|  glutamyl-tRNA amidotransferase subunit B           204   1e-58    Arthrospira maxima
ref|WP_012161547.1|  glutamyl-tRNA amidotransferase subunit B           204   2e-58    Acaryochloris marina
ref|WP_027248777.1|  glutamyl-tRNA amidotransferase                     203   5e-58    Planktothrix agardhii
ref|WP_026796286.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       203   5e-58    Planktothrix
ref|WP_026785585.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       203   5e-58    Planktothrix
ref|WP_015195258.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    202   6e-58    Stanieria cyanosphaera
gb|KEI66792.1|  GatB                                                    202   6e-58    Planktothrix agardhii NIVA-CYA 126/8
gb|AHB87799.1|  aspartyl/glutamyl-tRNA amidotransferase subunit B...    203   6e-58    Thermosynechococcus sp. NK55a
ref|WP_041429431.1|  glutamyl-tRNA amidotransferase                     203   7e-58    Thermosynechococcus sp. NK55a
ref|WP_006105433.1|  glutamyl-tRNA amidotransferase subunit B           202   1e-57    Coleofasciculus chthonoplastes
ref|WP_035986170.1|  glutamyl-tRNA amidotransferase                     201   2e-57    Leptolyngbya sp. KIOST-1
ref|WP_017299669.1|  glutamyl-tRNA amidotransferase subunit B           201   4e-57    Nodosilinea nodulosa
ref|WP_012626901.1|  glutamyl-tRNA amidotransferase subunit B           200   4e-57    Cyanothece sp. PCC 7425
ref|WP_017718972.1|  glutamyl-tRNA amidotransferase subunit B           200   8e-57    Oscillatoria sp. PCC 10802
ref|WP_041463524.1|  glutamyl-tRNA amidotransferase                     199   1e-56    Chroococcidiopsis
ref|WP_009630311.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    199   1e-56    Synechocystis sp. PCC 7509
ref|WP_008312219.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    199   1e-56    Leptolyngbya sp. PCC 6406
ref|WP_039715161.1|  glutamyl-tRNA amidotransferase                     199   2e-56    
ref|WP_011613215.1|  glutamyl-tRNA amidotransferase subunit B           199   2e-56    Trichodesmium erythraeum
ref|WP_017287840.1|  glutamyl-tRNA amidotransferase subunit B           199   2e-56    Leptolyngbya boryana
ref|WP_010477067.1|  glutamyl-tRNA amidotransferase subunit B           198   2e-56    Acaryochloris sp. CCMEE 5410
ref|XP_002984359.1|  hypothetical protein SELMODRAFT_120349             199   3e-56    
gb|AFY90544.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase ...    199   4e-56    Chroococcidiopsis thermalis PCC 7203
ref|XP_005850490.1|  hypothetical protein CHLNCDRAFT_50146              199   4e-56    Chlorella variabilis
ref|WP_015205388.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    197   5e-56    Crinalium epipsammum
ref|WP_015173670.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    197   6e-56    Geitlerinema sp. PCC 7407
ref|WP_036479698.1|  glutamyl-tRNA amidotransferase                     197   1e-55    Myxosarcina sp. GI1
ref|WP_015175041.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    196   1e-55    Oscillatoria nigro-viridis
ref|WP_015148859.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    195   4e-55    Oscillatoria acuminata
ref|WP_007356597.1|  MULTISPECIES: glutamyl-tRNA amidotransferase...    195   4e-55    Kamptonema
ref|WP_017296048.1|  glutamyl-tRNA amidotransferase subunit B           194   7e-55    Geminocystis herdmanii
ref|WP_008277568.1|  glutamyl-tRNA amidotransferase subunit B           194   8e-55    Cyanothece sp. CCY0110
ref|WP_015230344.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    194   9e-55    Dactylococcopsis salina
ref|WP_039727104.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       194   9e-55    Lyngbya confervoides
ref|WP_006508067.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    194   9e-55    Xenococcus sp. PCC 7305
ref|WP_017327770.1|  glutamyl-tRNA amidotransferase subunit B           194   1e-54    Synechococcus sp. PCC 7336
ref|WP_015220988.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    194   1e-54    Cyanobacterium aponinum
ref|WP_009544472.1|  MULTISPECIES: glutamyl-tRNA amidotransferase...    193   2e-54    Cyanothece
ref|WP_043738443.1|  glutamyl-tRNA amidotransferase                     193   2e-54    Synechococcus sp. RCC307
emb|CAK29278.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase...    193   2e-54    Synechococcus sp. RCC307
ref|WP_015125954.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    193   2e-54    Synechococcus sp. PCC 6312
ref|WP_035996347.1|  glutamyl-tRNA amidotransferase                     193   3e-54    [Leptolyngbya] sp. JSC-1
dbj|GAL91402.1|  aspartyl-tRNA(Asn) amidotransferase subunit B          192   3e-54    Microcystis aeruginosa NIES-44
emb|CCQ64937.1|  Aspartyl-tRNA(Asn) amidotransferase subunit B @ ...    189   4e-54    Crocosphaera watsonii WH 0402
gb|AII44721.1|  glutamyl-tRNA amidotransferase subunit B                192   5e-54    Synechococcus sp. KORDI-100
ref|WP_015227247.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    192   5e-54    Halothece sp. PCC 7418
ref|WP_038547345.1|  glutamyl-tRNA amidotransferase                     192   6e-54    Synechococcus sp. KORDI-100
ref|WP_002797759.1|  glutamyl-tRNA amidotransferase subunit B           192   6e-54    Microcystis aeruginosa
ref|WP_015143331.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    192   8e-54    Pleurocapsa minor
ref|WP_006635745.1|  glutamyl-tRNA amidotransferase subunit B           192   9e-54    Microcoleus vaginatus
ref|WP_008205758.1|  glutamyl-tRNA amidotransferase subunit B           191   9e-54    Microcystis sp. T1-4
gb|AHF64902.1|  glutamyl-tRNA(Gln) amidotransferase, B subunit          191   9e-54    Synechococcus sp. WH 8109
ref|WP_015167360.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    191   1e-53    Synechococcus sp. PCC 7502
ref|WP_002763085.1|  glutamyl-tRNA amidotransferase subunit B           191   1e-53    Microcystis aeruginosa
ref|WP_011365424.1|  glutamyl-tRNA amidotransferase subunit B           191   1e-53    Synechococcus sp. CC9605
ref|WP_002801811.1|  glutamyl-tRNA amidotransferase subunit B           191   2e-53    Microcystis aeruginosa
ref|WP_002771374.1|  glutamyl-tRNA amidotransferase subunit B           191   2e-53    Microcystis aeruginosa
ref|WP_006042873.1|  glutamyl-tRNA amidotransferase subunit B           191   2e-53    Synechococcus sp. WH 7805
ref|WP_006530558.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    191   2e-53    Gloeocapsa sp. PCC 73106
ref|WP_016516340.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    190   2e-53    Microcystis aeruginosa
ref|WP_024970796.1|  glutamyl-tRNA amidotransferase                     190   2e-53    Microcystis aeruginosa
ref|WP_004161937.1|  glutamyl-tRNA amidotransferase subunit B           190   3e-53    Microcystis aeruginosa
ref|WP_002752075.1|  glutamyl-tRNA amidotransferase subunit B           190   3e-53    Microcystis aeruginosa
ref|WP_006453880.1|  glutamyl-tRNA amidotransferase subunit B           190   3e-53    Synechococcus sp. PCC 7335
ref|WP_002745324.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    190   4e-53    Microcystis aeruginosa
ref|WP_002777996.1|  glutamyl-tRNA amidotransferase subunit B           189   4e-53    Microcystis aeruginosa
ref|WP_015163677.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    189   5e-53    Pseudanabaena sp. PCC 7367
ref|WP_026103235.1|  glutamyl-tRNA amidotransferase                     189   6e-53    Pseudanabaena sp. PCC 6802
ref|WP_002784358.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    189   7e-53    Microcystis aeruginosa
ref|WP_022606717.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    189   7e-53    Rubidibacter lacunae
ref|WP_002788072.1|  glutamyl-tRNA amidotransferase subunit B           189   7e-53    Microcystis aeruginosa
ref|WP_002738351.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)...    189   7e-53    Microcystis aeruginosa
ref|WP_007306559.1|  glutamyl-tRNA amidotransferase subunit B           189   8e-53    Crocosphaera watsonii
ref|WP_038552435.1|  glutamyl-tRNA amidotransferase                     189   1e-52    Synechococcus sp. KORDI-52
ref|WP_012264066.1|  glutamyl-tRNA amidotransferase subunit B           189   1e-52    Microcystis aeruginosa
ref|WP_011934272.1|  glutamyl-tRNA amidotransferase subunit B           188   2e-52    Synechococcus sp. WH 7803
ref|WP_015955550.1|  glutamyl-tRNA amidotransferase subunit B           188   2e-52    Cyanothece sp. PCC 7424
ref|WP_017662518.1|  glutamyl-tRNA amidotransferase subunit B           187   3e-52    Geitlerinema sp. PCC 7105
ref|WP_015223186.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    187   3e-52    
ref|WP_013324449.1|  glutamyl-tRNA amidotransferase subunit B           187   3e-52    Cyanothece sp. PCC 7822
ref|WP_028953064.1|  glutamyl-tRNA amidotransferase                     187   4e-52    Synechococcus sp. CC9616
ref|WP_018397619.1|  glutamyl-tRNA amidotransferase subunit B           187   4e-52    filamentous cyanobacterium ESFC-1
ref|WP_009788701.1|  glutamyl-tRNA amidotransferase subunit B           187   5e-52    Synechococcus sp. BL107
ref|WP_011360908.1|  glutamyl-tRNA amidotransferase subunit B           187   5e-52    Synechococcus sp. CC9902
emb|CDP09051.1|  unnamed protein product                                181   6e-52    Coffea canephora [robusta coffee]
ref|WP_012308131.1|  glutamyl-tRNA amidotransferase subunit B           186   8e-52    Synechococcus
ref|WP_011377450.1|  MULTISPECIES: glutamyl-tRNA amidotransferase...    186   1e-51    Synechococcus
ref|WP_011243698.1|  glutamyl-tRNA amidotransferase subunit B           186   1e-51    Synechococcus elongatus
ref|WP_030007769.1|  glutamyl-tRNA amidotransferase                     186   1e-51    Synechococcus sp. NKBG042902
ref|WP_044105934.1|  glutamyl-tRNA amidotransferase                     186   1e-51    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_043327225.1|  glutamyl-tRNA amidotransferase                     186   1e-51    
ref|WP_036531366.1|  glutamyl-tRNA amidotransferase                     186   2e-51    Neosynechococcus sphagnicola
gb|AFY29834.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amid...    186   2e-51    Cyanobium gracile PCC 6307
ref|WP_028947219.1|  glutamyl-tRNA amidotransferase                     184   4e-51    Synechocystis sp. PCC 6714
ref|WP_016648124.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    184   5e-51    Facklamia hominis
ref|WP_043693520.1|  glutamyl-tRNA amidotransferase                     184   5e-51    Synechococcus sp. KORDI-49
ref|WP_024545250.1|  glutamyl-tRNA amidotransferase                     184   6e-51    Synechococcus sp. NKBG15041c
ref|WP_015783514.1|  glutamyl-tRNA amidotransferase subunit B           184   6e-51    Cyanothece sp. PCC 8802
ref|WP_012594503.1|  glutamyl-tRNA amidotransferase subunit B           184   7e-51    Cyanothece sp. PCC 8801
ref|WP_011129209.1|  glutamyl-tRNA amidotransferase subunit B           184   8e-51    Synechococcus sp. WH 8102
ref|WP_015134085.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    184   9e-51    Leptolyngbya sp. PCC 7376
ref|WP_011620631.1|  glutamyl-tRNA amidotransferase subunit B           183   1e-50    Synechococcus sp. CC9311
ref|WP_017711578.1|  glutamyl-tRNA amidotransferase subunit B           183   2e-50    Prochlorothrix hollandica
ref|WP_022482493.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    182   3e-50    
dbj|BAM54977.1|  aspartyl/glutamyl-tRNA amidotransferase subunitB       181   3e-50    Bacillus subtilis BEST7613
ref|WP_017305024.1|  glutamyl-tRNA amidotransferase subunit B           182   4e-50    Spirulina subsalsa
ref|WP_011429268.1|  glutamyl-tRNA amidotransferase subunit B           181   5e-50    Synechococcus
ref|WP_011432351.1|  glutamyl-tRNA amidotransferase subunit B           181   5e-50    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_006908174.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    181   5e-50    Facklamia hominis
ref|WP_014407113.1|  glutamyl-tRNA amidotransferase subunit B           181   6e-50    Synechocystis
ref|XP_005645477.1|  B subunit of glutamyl-tRNA amidotransferase        181   6e-50    Coccomyxa subellipsoidea C-169
ref|WP_007099233.1|  glutamyl-tRNA amidotransferase subunit B           181   8e-50    Synechococcus sp. RS9916
ref|WP_010872929.1|  glutamyl-tRNA amidotransferase subunit B           181   1e-49    
ref|WP_010313542.1|  glutamyl-tRNA amidotransferase subunit B           181   1e-49    Synechococcus sp. CB0205
ref|XP_002952066.1|  hypothetical protein VOLCADRAFT_81690              180   2e-49    Volvox carteri f. nagariensis
ref|WP_025925749.1|  glutamyl-tRNA amidotransferase                     179   3e-49    
ref|NP_973990.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B         179   3e-49    Arabidopsis thaliana [mouse-ear cress]
ref|WP_022247523.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    179   4e-49    
ref|WP_035833664.1|  glutamyl-tRNA amidotransferase                     179   4e-49    
ref|WP_021945712.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    179   5e-49    
ref|WP_011124207.1|  MULTISPECIES: glutamyl-tRNA amidotransferase...    179   5e-49    Prochlorococcus
ref|WP_025943159.1|  glutamyl-tRNA amidotransferase                     179   6e-49    
gb|KEF40891.1|  glutamyl-tRNA amidotransferase                          179   6e-49    Cyanobium sp. CACIAM 14
ref|WP_017867288.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    178   8e-49    Lactobacillus pobuzihii
ref|WP_021916640.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    177   1e-48    
ref|WP_006854108.1|  glutamyl-tRNA amidotransferase subunit B           177   2e-48    Synechococcus sp. WH 8016
ref|XP_001420207.1|  predicted protein                                  177   2e-48    Ostreococcus lucimarinus CCE9901
ref|WP_009629416.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    177   2e-48    Pseudanabaena biceps
ref|WP_036901802.1|  glutamyl-tRNA amidotransferase                     177   2e-48    Prochlorococcus sp. MIT 0601
ref|WP_037981155.1|  glutamyl-tRNA amidotransferase                     177   3e-48    Synechococcus sp. WH 5701
gb|EAQ76587.1|  aspartyl/glutamyl-tRNA amidotransferase subunit B       177   3e-48    Synechococcus sp. WH 5701
ref|WP_032516877.1|  glutamyl-tRNA amidotransferase                     177   3e-48    Prochlorococcus marinus
emb|CEG00947.1|  Aspartyl/Glutamyl-tRNA(Gln) amidotransferase,sub...    177   4e-48    Ostreococcus tauri
ref|WP_025958674.1|  glutamyl-tRNA amidotransferase                     176   4e-48    
ref|WP_006418596.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    176   5e-48    Eremococcus coleocola
ref|WP_042849535.1|  glutamyl-tRNA amidotransferase                     176   6e-48    Prochlorococcus sp. MIT 0604
ref|WP_011294013.1|  glutamyl-tRNA amidotransferase subunit B           176   6e-48    Prochlorococcus marinus
ref|WP_022458628.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    176   6e-48    
ref|WP_025915357.1|  glutamyl-tRNA amidotransferase                     176   7e-48    
ref|WP_028118977.1|  glutamyl-tRNA amidotransferase                     176   7e-48    Facklamia sourekii
gb|AIQ96157.1|  Aspartyl-tRNA(Asn) amidotransferase subunit B Glu...    176   7e-48    Prochlorococcus sp. MIT 0801
ref|WP_028124912.1|  glutamyl-tRNA amidotransferase                     175   8e-48    Eremococcus coleocola
ref|WP_038650511.1|  glutamyl-tRNA amidotransferase                     176   9e-48    Prochlorococcus sp. MIT 0801
ref|WP_032523030.1|  glutamyl-tRNA amidotransferase                     176   9e-48    Prochlorococcus marinus
ref|WP_025937846.1|  glutamyl-tRNA amidotransferase                     175   1e-47    
ref|WP_032514114.1|  glutamyl-tRNA amidotransferase                     175   1e-47    Prochlorococcus marinus
ref|WP_036916354.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       175   2e-47    Prochlorococcus
ref|WP_019475029.1|  glutamyl-tRNA amidotransferase subunit B           175   2e-47    
ref|WP_022793697.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    174   2e-47    Marinococcus halotolerans
ref|WP_011375614.1|  glutamyl-tRNA amidotransferase subunit B           175   2e-47    Prochlorococcus marinus
ref|WP_041484739.1|  glutamyl-tRNA amidotransferase                     174   2e-47    Prochlorococcus marinus
ref|WP_022440871.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    174   2e-47    
gb|ABO16674.1|  Glutamyl-tRNA (Gln) amidotransferase subunit B          174   2e-47    Prochlorococcus marinus str. MIT 9301
ref|WP_025967753.1|  glutamyl-tRNA amidotransferase                     174   2e-47    
ref|WP_025927823.1|  glutamyl-tRNA amidotransferase                     174   2e-47    
ref|WP_025973642.1|  glutamyl-tRNA amidotransferase                     174   3e-47    
ref|WP_025953913.1|  glutamyl-tRNA amidotransferase                     174   3e-47    
ref|WP_025927249.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       174   3e-47    
ref|WP_016838750.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    174   3e-47    Ureibacillus thermosphaericus
ref|YP_002049015.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    174   3e-47    Paulinella chromatophora
ref|WP_002806141.1|  glutamyl-tRNA amidotransferase subunit B           174   4e-47    Prochlorococcus marinus
ref|WP_032525847.1|  glutamyl-tRNA amidotransferase                     174   4e-47    Prochlorococcus marinus
ref|WP_025972757.1|  glutamyl-tRNA amidotransferase                     174   4e-47    
gb|KGF98816.1|  Aspartyl-tRNA(Asn) amidotransferase subunit B Glu...    174   4e-47    Prochlorococcus marinus str. MIT 9302
ref|WP_036899228.1|  glutamyl-tRNA amidotransferase                     174   5e-47    
ref|WP_017754507.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    173   5e-47    Bacillus oryziterrae
ref|WP_016353823.1|  Aspartyl-tRNA(Asn) amidotransferase subunit ...    173   5e-47    Spiribacter salinus
ref|WP_018199019.1|  hypothetical protein                               173   6e-47    
ref|WP_036906138.1|  glutamyl-tRNA amidotransferase                     173   6e-47    Prochlorococcus marinus
ref|WP_025951748.1|  glutamyl-tRNA amidotransferase                     173   7e-47    
ref|WP_025962099.1|  glutamyl-tRNA amidotransferase                     173   7e-47    
ref|WP_025954250.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       173   7e-47    
ref|WP_025893738.1|  glutamyl-tRNA amidotransferase                     173   8e-47    
ref|WP_025941131.1|  glutamyl-tRNA amidotransferase                     173   8e-47    
ref|WP_025890221.1|  glutamyl-tRNA amidotransferase                     173   8e-47    
ref|WP_025887355.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       173   8e-47    
ref|WP_026701531.1|  glutamyl-tRNA amidotransferase                     172   9e-47    Bacillus aidingensis
ref|WP_025934670.1|  glutamyl-tRNA amidotransferase                     172   1e-46    
ref|WP_025967359.1|  glutamyl-tRNA amidotransferase                     172   1e-46    
ref|WP_025729982.1|  glutamyl-tRNA amidotransferase                     172   1e-46    
ref|WP_022485153.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    170   1e-46    
ref|WP_025920525.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       172   1e-46    
ref|WP_039944189.1|  glutamyl-tRNA amidotransferase                     172   1e-46    
ref|WP_019480169.1|  glutamyl-tRNA amidotransferase subunit B           172   1e-46    
ref|WP_011822864.1|  glutamyl-tRNA amidotransferase subunit B           172   1e-46    
ref|WP_025940021.1|  glutamyl-tRNA amidotransferase                     172   1e-46    
ref|WP_016182944.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    172   1e-46    
ref|WP_029419891.1|  glutamyl-tRNA amidotransferase                     172   1e-46    
ref|WP_035032539.1|  glutamyl-tRNA amidotransferase                     172   2e-46    
ref|WP_006308502.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    172   2e-46    
ref|WP_025923800.1|  glutamyl-tRNA amidotransferase                     172   2e-46    
ref|WP_019475960.1|  glutamyl-tRNA amidotransferase subunit B           172   2e-46    
ref|WP_013669946.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    172   2e-46    
ref|WP_025944301.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       172   2e-46    
ref|WP_036174967.1|  glutamyl-tRNA amidotransferase                     172   2e-46    
ref|WP_003778024.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    171   2e-46    
ref|XP_007510369.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    173   2e-46    
ref|WP_026766894.1|  glutamyl-tRNA amidotransferase                     171   2e-46    
ref|WP_028128868.1|  glutamyl-tRNA amidotransferase                     171   2e-46    
ref|WP_025944982.1|  glutamyl-tRNA amidotransferase                     170   3e-46    
ref|WP_025962766.1|  glutamyl-tRNA amidotransferase                     171   3e-46    
ref|WP_039237413.1|  glutamyl-tRNA amidotransferase                     171   3e-46    
ref|WP_010496864.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    171   3e-46    
ref|WP_043369826.1|  glutamyl-tRNA amidotransferase                     171   3e-46    
ref|WP_036184652.1|  glutamyl-tRNA amidotransferase                     171   3e-46    
ref|WP_003179599.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    171   3e-46    
ref|WP_011197621.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    171   4e-46    
ref|WP_025880069.1|  glutamyl-tRNA amidotransferase                     171   4e-46    
ref|WP_020450467.1|  MULTISPECIES: glutamyl-tRNA(Gln) amidotransf...    171   4e-46    
ref|WP_043925745.1|  glutamyl-tRNA amidotransferase                     171   4e-46    
ref|WP_019477405.1|  glutamyl-tRNA amidotransferase subunit B           171   4e-46    
gb|EDY38603.1|  glutamyl-tRNA (Gln) amidotransferase subunit B          171   4e-46    
ref|WP_037216104.1|  glutamyl-tRNA amidotransferase                     171   5e-46    
ref|WP_036151638.1|  glutamyl-tRNA amidotransferase                     171   5e-46    
ref|WP_025931215.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       171   5e-46    
ref|WP_025932886.1|  glutamyl-tRNA amidotransferase                     171   5e-46    
ref|WP_026589671.1|  glutamyl-tRNA amidotransferase                     171   5e-46    
ref|WP_022023534.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    171   6e-46    
ref|WP_003354107.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    170   6e-46    
ref|WP_013773570.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    170   6e-46    
ref|WP_006637360.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    170   7e-46    
ref|WP_010632510.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    170   7e-46    
gb|ABV49677.1|  Glutamyl-tRNA (Gln) amidotransferase subunit B          170   7e-46    
ref|WP_041087788.1|  glutamyl-tRNA amidotransferase                     170   9e-46    
ref|WP_041484330.1|  glutamyl-tRNA amidotransferase                     170   9e-46    
ref|WP_013055057.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    170   1e-45    
ref|XP_010667085.1|  PREDICTED: glutamyl-tRNA(Gln) amidotransfera...    171   1e-45    
ref|WP_014461925.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    170   1e-45    
ref|XP_003055655.1|  predicted protein                                  171   1e-45    
ref|WP_010678016.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    169   1e-45    
ref|WP_011827400.1|  glutamyl-tRNA amidotransferase subunit B           170   1e-45    
ref|WP_034989737.1|  glutamyl-tRNA amidotransferase                     169   1e-45    
ref|WP_010780635.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    169   1e-45    
ref|WP_032520479.1|  glutamyl-tRNA amidotransferase                     169   1e-45    
ref|WP_036914749.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       169   2e-45    
ref|WP_007208503.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    169   2e-45    
ref|WP_042478782.1|  glutamyl-tRNA amidotransferase                     169   2e-45    
ref|WP_037352738.1|  glutamyl-tRNA amidotransferase                     169   2e-45    
ref|WP_044747370.1|  glutamyl-tRNA amidotransferase                     169   2e-45    
ref|WP_040047655.1|  glutamyl-tRNA amidotransferase                     169   2e-45    
ref|WP_003320438.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    169   2e-45    
ref|WP_007390339.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    169   2e-45    
ref|WP_041071397.1|  glutamyl-tRNA amidotransferase                     169   2e-45    
ref|WP_038703157.1|  glutamyl-tRNA amidotransferase                     169   2e-45    
ref|WP_043903443.1|  glutamyl-tRNA amidotransferase                     169   2e-45    
ref|WP_017434398.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    169   3e-45    
ref|WP_042408883.1|  glutamyl-tRNA amidotransferase                     169   3e-45    
ref|WP_031538074.1|  glutamyl-tRNA amidotransferase                     169   3e-45    
ref|WP_034320149.1|  glutamyl-tRNA amidotransferase                     169   3e-45    
ref|WP_009369472.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    169   3e-45    
ref|WP_010753864.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    169   3e-45    
ref|WP_028400137.1|  glutamyl-tRNA amidotransferase                     168   3e-45    
ref|WP_024426678.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       168   3e-45    
ref|WP_023605990.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    168   3e-45    
ref|WP_016251986.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    168   3e-45    
ref|WP_041970987.1|  glutamyl-tRNA amidotransferase                     168   4e-45    
gb|ACS23215.1|  glutamyl-tRNA(Gln) amidotransferase, B subunit          168   4e-45    
ref|WP_016205056.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    168   4e-45    
ref|WP_041269560.1|  glutamyl-tRNA amidotransferase                     168   4e-45    
ref|WP_028397423.1|  glutamyl-tRNA amidotransferase                     168   4e-45    
ref|WP_008432165.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    168   5e-45    
ref|WP_015695212.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    168   5e-45    
ref|WP_010305489.1|  glutamyl-tRNA amidotransferase subunit B           168   5e-45    
ref|WP_044334138.1|  glutamyl-tRNA amidotransferase                     167   6e-45    
ref|WP_036198806.1|  glutamyl-tRNA amidotransferase                     168   6e-45    
ref|WP_022492489.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    167   6e-45    
ref|WP_044391461.1|  glutamyl-tRNA amidotransferase                     167   6e-45    
ref|WP_021149776.1|  Aspartyl-tRNA(Asn) amidotransferase subunit,...    165   6e-45    
gb|EKE02760.1|  hypothetical protein ACD_20C00337G0031                  167   7e-45    
ref|WP_003253255.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    167   7e-45    
ref|WP_006700987.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    167   7e-45    
ref|WP_028784692.1|  glutamyl-tRNA amidotransferase                     167   8e-45    
ref|WP_006703629.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    167   9e-45    
ref|WP_008355815.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    167   9e-45    
dbj|GAF65535.1|  aspartyl/glutamyl-tRNA amidotransferase subunit B      167   9e-45    
ref|WP_035508363.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       167   9e-45    
ref|WP_044444917.1|  glutamyl-tRNA amidotransferase                     167   1e-44    
ref|WP_003688512.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    167   1e-44    
ref|WP_036922238.1|  glutamyl-tRNA amidotransferase                     167   1e-44    
ref|WP_029638176.1|  glutamyl-tRNA amidotransferase [                   167   1e-44    
ref|WP_004563759.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    167   1e-44    
ref|WP_026760531.1|  glutamyl-tRNA amidotransferase                     167   1e-44    
ref|WP_035063786.1|  glutamyl-tRNA amidotransferase                     167   1e-44    
ref|WP_024029682.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    167   1e-44    
ref|WP_024424551.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       167   1e-44    
pir||C69795  glutamyl-tRNA(Gln) amidotransferase (EC 2.6.-.-) cha...    166   1e-44 
emb|CEG23601.1|  Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase...    166   2e-44    
ref|WP_021094546.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   2e-44    
ref|WP_006830132.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   2e-44    
ref|WP_042535609.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
ref|WP_012009185.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   2e-44    
ref|WP_003214292.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   2e-44    
ref|WP_023626217.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    166   2e-44    
ref|WP_009792534.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    166   2e-44    
ref|WP_008881443.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    166   2e-44    
ref|WP_027955740.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
gb|ACJ32644.1|  Glutamyl-tRNA(Gln) amidotransferase subunit B           166   2e-44    
ref|WP_034626450.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
ref|WP_036805924.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
ref|WP_034664646.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
ref|WP_041637687.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
ref|WP_012953812.1|  glutamyl-tRNA amidotransferase subunit B           166   2e-44    
ref|WP_008496108.1|  Aspartyl-tRNA(Asn) amidotransferase subunit ...    166   2e-44    
ref|WP_041108662.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
ref|WP_028530535.1|  glutamyl-tRNA amidotransferase                     166   2e-44    
ref|WP_010758830.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    166   2e-44    
ref|WP_008858880.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   3e-44    
ref|WP_007496855.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    166   3e-44    
ref|WP_015388583.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    166   3e-44    
ref|WP_004635944.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   3e-44    
ref|WP_010744985.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    166   3e-44    
ref|WP_002808624.1|  glutamyl-tRNA amidotransferase subunit B           166   3e-44    
ref|WP_035703565.1|  glutamyl-tRNA amidotransferase                     166   3e-44    
ref|WP_029946290.1|  glutamyl-tRNA amidotransferase                     166   3e-44    
ref|WP_013076725.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   3e-44    
ref|XP_002503476.1|  predicted protein                                  167   3e-44    
ref|WP_013307931.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    166   3e-44    
ref|WP_007101280.1|  glutamyl-tRNA amidotransferase subunit B           166   3e-44    
ref|WP_003219444.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    166   4e-44    
ref|WP_011131686.1|  glutamyl-tRNA amidotransferase subunit B           166   4e-44    
ref|WP_029317417.1|  glutamyl-tRNA amidotransferase                     166   4e-44    
ref|WP_041092940.1|  glutamyl-tRNA amidotransferase                     166   4e-44    
ref|WP_026011761.1|  glutamyl-tRNA amidotransferase                     166   4e-44    
gb|AGY92542.1|  glutamyl-tRNA amidotransferase subunit B                165   4e-44    
gb|EGM52231.1|  GatB/GatE catalytic domain protein                      165   4e-44    
ref|WP_029938509.1|  glutamyl-tRNA amidotransferase                     166   4e-44    
ref|WP_034560166.1|  glutamyl-tRNA amidotransferase                     165   4e-44    
ref|WP_041381820.1|  glutamyl-tRNA amidotransferase                     165   4e-44    
ref|WP_029973739.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       165   4e-44    
ref|WP_028389719.1|  glutamyl-tRNA amidotransferase                     165   4e-44    
ref|WP_014469865.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    165   4e-44    
ref|WP_016936997.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   4e-44    
ref|WP_003155730.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    165   4e-44    
ref|WP_010651631.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   4e-44    
ref|WP_038178673.1|  glutamyl-tRNA amidotransferase                     165   5e-44    
gb|AAB83965.1|  Glu-tRNAGln amidotransferase subunit B                  165   5e-44    
ref|WP_003702437.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   5e-44    
ref|WP_034990271.1|  glutamyl-tRNA amidotransferase                     165   5e-44    
ref|WP_040205373.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       165   5e-44    
ref|WP_014641892.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   5e-44    
ref|WP_034982970.1|  glutamyl-tRNA amidotransferase                     165   5e-44    
ref|WP_009353832.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   5e-44    
gb|AAB87634.1|  PET112-like protein                                     165   5e-44    
ref|WP_014568652.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   5e-44    
ref|WP_023391197.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    165   5e-44    
ref|WP_039785607.1|  glutamyl-tRNA amidotransferase                     165   5e-44    
ref|WP_025336483.1|  glutamyl-tRNA amidotransferase                     165   5e-44    
ref|WP_026673852.1|  glutamyl-tRNA amidotransferase                     165   6e-44    
ref|WP_008409014.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    165   6e-44    
ref|WP_010329114.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   6e-44    
sp|O30509.2|GATB_BACSU  RecName: Full=Aspartyl/glutamyl-tRNA(Asn/...    165   6e-44    
ref|WP_016429409.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    165   6e-44    
ref|WP_042400087.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       165   6e-44    
ref|WP_016626122.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    165   6e-44    
ref|WP_022382418.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    165   7e-44    
gb|ETT72105.1|  glutamyl-tRNA(Gln) amidotransferase subunit B           165   7e-44    
ref|WP_036726206.1|  glutamyl-tRNA amidotransferase                     165   7e-44    
ref|WP_013351300.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   7e-44    
ref|WP_033016664.1|  glutamyl-tRNA amidotransferase                     165   7e-44    
ref|WP_017729179.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   8e-44    
ref|WP_019121668.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    165   8e-44    
ref|WP_017381724.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   8e-44    
ref|WP_003126451.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    164   8e-44    
gb|EDN67237.1|  Glutamyl-tRNA(Gln) amidotransferase B subunit           164   8e-44    
ref|WP_006838746.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   8e-44    
ref|WP_038091799.1|  glutamyl-tRNA amidotransferase                     165   8e-44    
ref|WP_023440631.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   8e-44    
ref|WP_036501529.1|  glutamyl-tRNA amidotransferase                     164   8e-44    
ref|WP_039252442.1|  glutamyl-tRNA amidotransferase                     164   8e-44    
ref|WP_025948724.1|  glutamyl-tRNA amidotransferase                     164   8e-44    
ref|WP_025022745.1|  glutamyl-tRNA amidotransferase                     164   9e-44    
ref|WP_034306078.1|  glutamyl-tRNA amidotransferase                     164   9e-44    
emb|CEG30539.1|  glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) ami...    164   9e-44    
ref|WP_038538909.1|  glutamyl-tRNA amidotransferase                     164   9e-44    
ref|WP_011673637.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   9e-44    
ref|WP_015592183.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   9e-44    
ref|WP_006942360.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   1e-43    
ref|WP_025704533.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_033009963.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_010333268.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    164   1e-43    
ref|WP_014082332.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   1e-43    
ref|WP_042131013.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_039737427.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_025910460.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_029054964.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_033018422.1|  MULTISPECIES: glutamyl-tRNA amidotransferase       164   1e-43    
ref|WP_008640227.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    164   1e-43    
ref|WP_003240092.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   1e-43    
ref|WP_031405925.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_039834340.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_016174954.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    164   1e-43    
ref|WP_034570867.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_002358703.1|  MULTISPECIES: aspartyl/glutamyl-tRNA amidotr...    164   1e-43    
ref|WP_033918178.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_016627698.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    164   1e-43    
ref|WP_002419990.1|  aspartyl/glutamyl-tRNA amidotransferase subu...    164   1e-43    
ref|WP_039877188.1|  glutamyl-tRNA amidotransferase                     164   1e-43    
ref|WP_015543870.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    164   1e-43    
ref|WP_016615973.1|  aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe...    164   1e-43    
ref|WP_040083935.1|  glutamyl-tRNA amidotransferase                     164   1e-43    



>ref|XP_010023766.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
isoform X3 [Eucalyptus grandis]
Length=321

 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T+DYVDS+ N LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  124  VTLTKDYVDSIRNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  183

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  184  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  243

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMI+EKDLVQI DP EIEKMVDKV+ DNPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  244  TVKGMIEEKDLVQIADPAEIEKMVDKVLLDNPKQLEQYRGGKTKLQGYFAGQVMKASKGK  303

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  304  ANPGLLNKILLEKLNAK  320



>ref|XP_010023765.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
isoform X2 [Eucalyptus grandis]
Length=357

 Score =   346 bits (888),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T+DYVDS+ N LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  160  VTLTKDYVDSIRNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  219

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  220  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  279

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMI+EKDLVQI DP EIEKMVDKV+ DNPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  280  TVKGMIEEKDLVQIADPAEIEKMVDKVLLDNPKQLEQYRGGKTKLQGYFAGQVMKASKGK  339

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  340  ANPGLLNKILLEKLNAK  356



>ref|XP_010023764.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
isoform X1 [Eucalyptus grandis]
Length=413

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T+DYVDS+ N LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  216  VTLTKDYVDSIRNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  275

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  276  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  335

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMI+EKDLVQI DP EIEKMVDKV+ DNPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  336  TVKGMIEEKDLVQIADPAEIEKMVDKVLLDNPKQLEQYRGGKTKLQGYFAGQVMKASKGK  395

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  396  ANPGLLNKILLEKLNAK  412



>ref|XP_010065851.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Eucalyptus grandis]
Length=548

 Score =   350 bits (898),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+DYVDS+CN LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  351  VILTKDYVDSICNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  411  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMI+EKDLVQI DP EIEKMVDKV+ DNPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  471  TVKGMIEEKDLVQIADPAEIEKMVDKVLLDNPKQLEQYRGGKTKLQGYFAGQVMKASKGK  530

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  531  ANPGLLNKILLEKLNAK  547



>gb|KCW63539.1| hypothetical protein EUGRSUZ_G01176 [Eucalyptus grandis]
Length=538

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+DYVDS+CN LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  341  VILTKDYVDSICNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  400

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  401  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  460

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMI+EKDLVQI DP EIEKMVDKV+ DNPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  461  TVKGMIEEKDLVQIADPAEIEKMVDKVLLDNPKQLEQYRGGKTKLQGYFAGQVMKASKGK  520

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  521  ANPGLLNKILLEKLNAK  537



>gb|KCW60134.1| hypothetical protein EUGRSUZ_H02859 [Eucalyptus grandis]
Length=528

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T+DYVDS+ N LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  331  VTLTKDYVDSIRNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  390

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  391  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  450

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMI+EKDLVQI DP EIEKMVDKV+ DNPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  451  TVKGMIEEKDLVQIADPAEIEKMVDKVLLDNPKQLEQYRGGKTKLQGYFAGQVMKASKGK  510

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  511  ANPGLLNKILLEKLNAK  527



>gb|KCW63540.1| hypothetical protein EUGRSUZ_G01176 [Eucalyptus grandis]
Length=536

 Score =   341 bits (874),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 183/197 (93%), Gaps = 2/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+DYVDS+CN LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  341  VILTKDYVDSICNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  400

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  401  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  460

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMI+EKDL  I DP EIEKMVDKV+ DNPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  461  TVKGMIEEKDL--IADPAEIEKMVDKVLLDNPKQLEQYRGGKTKLQGYFAGQVMKASKGK  518

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  519  ANPGLLNKILLEKLNAK  535



>ref|XP_010650169.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Vitis vinifera]
 ref|XP_010650170.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Vitis vinifera]
Length=548

 Score =   339 bits (870),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+DYV S+ +SLPELPE+KRRRYEKMGLSMQDVLFL ND N+A FFDATIG+GADVK
Sbjct  351  VILTEDYVGSIRSSLPELPELKRRRYEKMGLSMQDVLFLANDVNVAGFFDATIGKGADVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSINEIKLTPQEL+ELI++IKG TISGKIGKEILFE++AKGG
Sbjct  411  LAANWIMGDIAAYMKNEKLSINEIKLTPQELAELIASIKGGTISGKIGKEILFELIAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDLVQIVDP EIEKMVDKV+ +N KQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  471  TVKGLIEEKDLVQIVDPAEIEKMVDKVLVENQKQLEQYRGGKTKLQGYFAGQVMKASKGK  530

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  531  ANPGLLNKILLEKLNAK  547



>ref|XP_009589035.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X2 [Nicotiana tomentosiformis]
Length=478

 Score =   337 bits (864),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T++YVD++  SLPE+PE KRRRYE MGLSMQDVLFL ND N AEFFDATI  GADVK
Sbjct  281  VTLTEEYVDNIRESLPEVPEAKRRRYENMGLSMQDVLFLANDMNTAEFFDATIAAGADVK  340

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK++INEIKL+PQEL ELI++IK  TISGKIGKEILFE+MAKGG
Sbjct  341  LAANWIMGDIAAYMKNEKVTINEIKLSPQELGELIASIKDGTISGKIGKEILFELMAKGG  400

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQIVD  EIEKMVDKVIADNPKQLEQYRGGKTKLQG+FAGQVMKESKGK
Sbjct  401  TVKGLIKEKDLVQIVDTAEIEKMVDKVIADNPKQLEQYRGGKTKLQGFFAGQVMKESKGK  460

Query  195  ANPKMLNKILLEKLNA  148
            ANPK+LNKILLEKLNA
Sbjct  461  ANPKLLNKILLEKLNA  476



>ref|XP_007035291.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
 ref|XP_007035292.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
 gb|EOY06217.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
 gb|EOY06218.1| GLU-ADT subunit B isoform 1 [Theobroma cacao]
Length=549

 Score =   337 bits (863),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVD + NSLPELPEMKRRRYEKMGLSMQDVLFL ND N+AE+FDATI RGAD+K
Sbjct  352  VILTQEYVDGIRNSLPELPEMKRRRYEKMGLSMQDVLFLANDVNVAEYFDATISRGADIK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSINEIKL P+EL ELI++IKG TISGKIGKEILFE++AKGG
Sbjct  412  LAANWIMGDIAAYMKNEKLSINEIKLMPEELVELIASIKGGTISGKIGKEILFELLAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDLVQIVDP EI KMVDKV+++NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  472  TVKGLIEEKDLVQIVDPVEIGKMVDKVLSENPKQLEQYRGGKTKLQGFFAGQVMKISKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  532  ANPVLLNKILLEKLNAK  548



>ref|XP_009357958.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009357959.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
Length=549

 Score =   337 bits (863),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQDYVD + N+LPELPE KRRRYEKMGLSMQDVLFL ND N+AEFFD TI +GADVK
Sbjct  352  VFLTQDYVDGIRNTLPELPETKRRRYEKMGLSMQDVLFLANDVNVAEFFDTTITKGADVK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEKL+INEIKL+P+EL+ELI++IK  TISGKIGKEILFE++AKGG
Sbjct  412  LATNWIMGDIAAYMKNEKLTINEIKLSPKELAELIASIKDGTISGKIGKEILFELLAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDLVQIVDP EIEKMV+KV+++NPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  472  TVKGLIEEKDLVQIVDPAEIEKMVEKVVSENPKQLEQYRGGKTKLQGYFAGQVMKLSKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  532  ANPGLLNKILLEKLNAK  548



>ref|XP_009797350.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009797351.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009797352.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=548

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T++YVD++  SLPE+PE KRRRYE MGLSMQDVLFL ND NIAEFFDATI  GADVK
Sbjct  351  VTLTEEYVDNIRKSLPEVPEAKRRRYENMGLSMQDVLFLANDMNIAEFFDATIAAGADVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK++INEIKLTPQEL ELI++IK  TISGKIGKEILFE+MAKGG
Sbjct  411  LAANWIMGDIAAYMKNEKVTINEIKLTPQELGELIASIKDGTISGKIGKEILFEVMAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQIVD  EIEK+VDKVIADNP QLEQYRGGKTKLQG+FAGQVMKESKGK
Sbjct  471  TVKGLIKEKDLVQIVDTAEIEKLVDKVIADNPMQLEQYRGGKTKLQGFFAGQVMKESKGK  530

Query  195  ANPKMLNKILLEKLNA  148
            ANPK+LNKILLEKLNA
Sbjct  531  ANPKLLNKILLEKLNA  546



>ref|XP_009589032.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009589033.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009589034.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
{ECO:0000255|HAMAP-Rule:MF_03147} isoform 
X1 [Nicotiana tomentosiformis]
Length=548

 Score =   336 bits (862),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T++YVD++  SLPE+PE KRRRYE MGLSMQDVLFL ND N AEFFDATI  GADVK
Sbjct  351  VTLTEEYVDNIRESLPEVPEAKRRRYENMGLSMQDVLFLANDMNTAEFFDATIAAGADVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK++INEIKL+PQEL ELI++IK  TISGKIGKEILFE+MAKGG
Sbjct  411  LAANWIMGDIAAYMKNEKVTINEIKLSPQELGELIASIKDGTISGKIGKEILFELMAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQIVD  EIEKMVDKVIADNPKQLEQYRGGKTKLQG+FAGQVMKESKGK
Sbjct  471  TVKGLIKEKDLVQIVDTAEIEKMVDKVIADNPKQLEQYRGGKTKLQGFFAGQVMKESKGK  530

Query  195  ANPKMLNKILLEKLNA  148
            ANPK+LNKILLEKLNA
Sbjct  531  ANPKLLNKILLEKLNA  546



>ref|XP_010326798.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Solanum lycopersicum]
Length=548

 Score =   336 bits (861),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V++T++YV+S+  SLPELPE KRRRYEK+GLSMQDVLFL ND NIA+FFDAT   GAD+K
Sbjct  351  VSLTEEYVNSIRESLPELPEDKRRRYEKLGLSMQDVLFLANDINIADFFDATTAGGADIK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK++INEIKLTPQEL ELI++IK ETISGKIGKEILFE++AKGG
Sbjct  411  LAANWIMGDIAAYMKNEKVTINEIKLTPQELGELIASIKDETISGKIGKEILFELIAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQIVD  EIEKMVDKVIAD+PKQLEQYRGGKTKLQGYFAGQVMKESKGK
Sbjct  471  TVKGLIKEKDLVQIVDTAEIEKMVDKVIADSPKQLEQYRGGKTKLQGYFAGQVMKESKGK  530

Query  195  ANPKMLNKILLEKLNAK  145
            ANPK+LNKILLEKLNAK
Sbjct  531  ANPKLLNKILLEKLNAK  547



>ref|XP_008460666.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cucumis melo]
 ref|XP_008460667.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cucumis melo]
Length=547

 Score =   335 bits (860),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T++YVD++ +SLPELPEMKRRRYE MGLSMQDVLFL ND ++AEFFDATI RGA+VK
Sbjct  350  VILTKEYVDNIHDSLPELPEMKRRRYESMGLSMQDVLFLANDISVAEFFDATIARGAEVK  409

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKL+IN+IKLTPQEL+ELI++IKG TISGKIGKEILFE++AKGG
Sbjct  410  LAANWIMGDIAAYMKNEKLTINDIKLTPQELAELIASIKGGTISGKIGKEILFELLAKGG  469

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQI DP EIEKMV+KV+ +NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  470  TVKGLIKEKDLVQIADPAEIEKMVEKVLVENPKQLEQYRGGKTKLQGFFAGQVMKASKGK  529

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  530  ANPGLLNKILLEKLNAK  546



>ref|XP_006340880.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=554

 Score =   335 bits (859),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+T++YV+S+  SLPELPE KRRRYEKMGLSMQDVLFL ND NIA+FFD T   GAD+K
Sbjct  357  VTLTEEYVNSIRESLPELPEDKRRRYEKMGLSMQDVLFLANDINIADFFDTTTAGGADIK  416

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK++INEIKLTPQEL ELI++IK ETISGKIGKEILFE++AKGG
Sbjct  417  LAANWIMGDIAAYMKNEKVTINEIKLTPQELGELIASIKDETISGKIGKEILFELIAKGG  476

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQIVD  EIEKMVDKVIAD+PKQLEQYRGGKTKLQGYFAGQVMKESKGK
Sbjct  477  TVKGLIKEKDLVQIVDTAEIEKMVDKVIADSPKQLEQYRGGKTKLQGYFAGQVMKESKGK  536

Query  195  ANPKMLNKILLEKLNAK  145
            ANPK+LNKILLEKLNA+
Sbjct  537  ANPKLLNKILLEKLNAE  553



>ref|XP_008340674.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Malus domestica]
Length=652

 Score =   337 bits (865),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQDYVD + N+LPELPE KRRRYEKMGLSMQDVLFL ND N+AEFFD TI +GADVK
Sbjct  455  VFLTQDYVDGIRNTLPELPETKRRRYEKMGLSMQDVLFLANDVNVAEFFDTTITKGADVK  514

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEKL+INEIKL+PQEL+ELI++IK  TISGKIGKEILFE++A GG
Sbjct  515  LATNWIMGDIAAYMKNEKLTINEIKLSPQELAELIASIKDGTISGKIGKEILFELLAXGG  574

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDLVQIVDP EIEKMV+KV+++NPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  575  TVKGLIEEKDLVQIVDPAEIEKMVEKVVSENPKQLEQYRGGKTKLQGYFAGQVMKLSKGK  634

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  635  ANPGVLNKILLEKLNAK  651



>ref|XP_011091352.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
 ref|XP_011091353.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
 ref|XP_011091354.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
 ref|XP_011091356.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Sesamum indicum]
Length=548

 Score =   334 bits (857),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++++Y++ + +SLPELPEMKRRRYEK+GLSMQDVLFL ND N+A FFDATIG GADVK
Sbjct  351  VALSEEYINGIHDSLPELPEMKRRRYEKLGLSMQDVLFLANDINVAAFFDATIGPGADVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSIN+IKLTP+EL ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  411  LAANWIMGDIAAYMKNEKLSINDIKLTPKELGELIASIKGGTISGKIGKEILFELMAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV+G+IKEKDLVQIVDP EIEK+VDKV+A NPKQLEQYRGGKTKLQG+FAGQ+M+E+KGK
Sbjct  471  TVEGLIKEKDLVQIVDPAEIEKIVDKVLAANPKQLEQYRGGKTKLQGFFAGQIMRETKGK  530

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  531  ANPGLLNKILLEKLNAK  547



>gb|KDP33336.1| hypothetical protein JCGZ_12885 [Jatropha curcas]
Length=355

 Score =   327 bits (839),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V  T++YVDS+ NSLP+LPE+KRRRYE MGL MQDVLFL ND +IAEFFDATI +GADVK
Sbjct  158  VIFTKEYVDSIKNSLPDLPEIKRRRYENMGLGMQDVLFLANDMSIAEFFDATIAKGADVK  217

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK+SINEIKLTPQEL+ELI++IKG TISGKIGKEILFE++A GG
Sbjct  218  LAANWIMGDIAAYMKNEKVSINEIKLTPQELAELIASIKGGTISGKIGKEILFELIANGG  277

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQIVDP EIEKMVDKV+++NPKQLE YR GK+K+QG+FAGQVMK SKGK
Sbjct  278  TVKGLIKEKDLVQIVDPAEIEKMVDKVLSENPKQLELYRAGKSKIQGFFAGQVMKISKGK  337

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  338  ANPGLLNKILLEKLNAK  354



>ref|XP_008224029.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X2 [Prunus mume]
Length=549

 Score =   333 bits (855),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T DYVD + NSLPELPE KRRRYEKMGLSMQDVLFL ND N+AEFFD TI +GADVK
Sbjct  352  VFLTTDYVDGIRNSLPELPETKRRRYEKMGLSMQDVLFLANDMNVAEFFDTTITKGADVK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEKL+INEIKLTPQEL+ELI++IK  TISGKIGKEILFE++AKGG
Sbjct  412  LATNWIMGDIAAYMKNEKLTINEIKLTPQELAELIASIKDGTISGKIGKEILFELLAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+ KDLVQIVDP EIEK V+KV+++NPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  472  TVKGLIEAKDLVQIVDPAEIEKWVEKVLSENPKQLEQYRGGKTKLQGYFAGQVMKLSKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  532  ANPGLLNKILLEKLNAK  548



>ref|XP_008224027.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Prunus mume]
 ref|XP_008224028.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Prunus mume]
Length=550

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T DYVD + NSLPELPE KRRRYEKMGLSMQDVLFL ND N+AEFFD TI +GADVK
Sbjct  353  VFLTTDYVDGIRNSLPELPETKRRRYEKMGLSMQDVLFLANDMNVAEFFDTTITKGADVK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEKL+INEIKLTPQEL+ELI++IK  TISGKIGKEILFE++AKGG
Sbjct  413  LATNWIMGDIAAYMKNEKLTINEIKLTPQELAELIASIKDGTISGKIGKEILFELLAKGG  472

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+ KDLVQIVDP EIEK V+KV+++NPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  473  TVKGLIEAKDLVQIVDPAEIEKWVEKVLSENPKQLEQYRGGKTKLQGYFAGQVMKLSKGK  532

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  533  ANPGLLNKILLEKLNAK  549



>gb|KGN61558.1| hypothetical protein Csa_2G170810 [Cucumis sativus]
Length=560

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T++YV+++ +SLPELPEMKRRRYE MGLSMQDVLFL ND ++AEFFDATI RGA+VK
Sbjct  363  VILTKEYVENIHDSLPELPEMKRRRYESMGLSMQDVLFLANDISVAEFFDATIARGAEVK  422

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKL+IN+IKLTPQEL+ELI++IKG TISGKIGKEILFE++AKGG
Sbjct  423  LAANWIMGDIAAYMKNEKLTINDIKLTPQELAELIASIKGGTISGKIGKEILFELLAKGG  482

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IK+KDLVQI DP EIEKMV+KV+A+NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  483  TVKGLIKDKDLVQIADPAEIEKMVEKVLAENPKQLEQYRGGKTKLQGFFAGQVMKASKGK  542

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNA+
Sbjct  543  ANPGLLNKILLEKLNAQ  559



>ref|XP_004147167.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cucumis sativus]
Length=555

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T++YV+++ +SLPELPEMKRRRYE MGLSMQDVLFL ND ++AEFFDATI RGA+VK
Sbjct  358  VILTKEYVENIHDSLPELPEMKRRRYESMGLSMQDVLFLANDISVAEFFDATIARGAEVK  417

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKL+IN+IKLTPQEL+ELI++IKG TISGKIGKEILFE++AKGG
Sbjct  418  LAANWIMGDIAAYMKNEKLTINDIKLTPQELAELIASIKGGTISGKIGKEILFELLAKGG  477

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IK+KDLVQI DP EIEKMV+KV+A+NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  478  TVKGLIKDKDLVQIADPAEIEKMVEKVLAENPKQLEQYRGGKTKLQGFFAGQVMKASKGK  537

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNA+
Sbjct  538  ANPGLLNKILLEKLNAQ  554



>ref|XP_002528338.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
[Ricinus communis]
 sp|B9SQR9.1|GATB_RICCO RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Ricinus communis]
 gb|EEF34010.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, putative 
[Ricinus communis]
Length=549

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T++YVDS+ +SLPELPE KRRRYE MGLSMQDVLFL ND+++AEFFDATI +GA VK
Sbjct  352  VVLTEEYVDSIQSSLPELPETKRRRYENMGLSMQDVLFLANDTSVAEFFDATIAQGAQVK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK+SINEIKLTP+EL+ELI++IKG  ISGKIGKEILFE++AKGG
Sbjct  412  LAANWIMGDIAAYMKNEKVSINEIKLTPKELAELIASIKGGIISGKIGKEILFELIAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQIVDP EIEKMVDKV+++NPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  472  TVKGLIKEKDLVQIVDPAEIEKMVDKVLSENPKQLEQYRAGKTKLQGFFAGQVMKASKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKIL EKLNAK
Sbjct  532  ANPGLLNKILQEKLNAK  548



>gb|KDO52268.1| hypothetical protein CISIN_1g043020mg [Citrus sinensis]
Length=564

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++YVDS+ +SLPELPEMKRRRYE+MGLSMQDVLFL ND N+A FFDATI +GADVK
Sbjct  367  VILNKEYVDSIQSSLPELPEMKRRRYEEMGLSMQDVLFLANDINVARFFDATIEKGADVK  426

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKL+INEIKL+  EL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  427  LAANWIMGDIAAYMKNEKLTINEIKLSAAELAELIASIKGATISGKIGKEILFELMAKGG  486

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I EKDLVQIVDP EIEKMVDKV+++NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  487  TVKGIIIEKDLVQIVDPSEIEKMVDKVLSENPKQLEQYRGGKTKLQGFFAGQVMKISKGK  546

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  547  ANPGLLNKILLEKLNAK  563



>gb|EYU43758.1| hypothetical protein MIMGU_mgv1a003561mg [Erythranthe guttata]
Length=578

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++++YV+ + NSLPELPE KRRR+E MGLSMQDVLFL ND N+A FFDATI  GADVK
Sbjct  381  VNLSEEYVNEIRNSLPELPETKRRRFENMGLSMQDVLFLANDVNVAAFFDATIASGADVK  440

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLS+NEIKLTPQEL ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  441  LAANWIMGDIAAYMKNEKLSVNEIKLTPQELGELIASIKGGTISGKIGKEILFELMAKGG  500

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQI D  EIEK+VD+V+A+NPKQLEQYRGGKTKLQG+FAGQ+MKE+KGK
Sbjct  501  TVKGLIKEKDLVQITDLSEIEKIVDRVLAENPKQLEQYRGGKTKLQGFFAGQIMKETKGK  560

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  561  ANPGILNKILLEKLNAK  577



>ref|XP_006480233.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=553

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++YVDS+ +SLPELPEMKRRRYE+MGLSMQDVLFL ND N+A FFDATI +GADVK
Sbjct  356  VILNKEYVDSIQSSLPELPEMKRRRYEEMGLSMQDVLFLANDINVARFFDATIEKGADVK  415

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKL+INEIKL+  EL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  416  LAANWIMGDIAAYMKNEKLTINEIKLSAAELAELIASIKGATISGKIGKEILFELMAKGG  475

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I EKDLVQIVDP EIEKMVDKV+++NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  476  TVKGIIIEKDLVQIVDPSEIEKMVDKVLSENPKQLEQYRGGKTKLQGFFAGQVMKISKGK  535

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLN K
Sbjct  536  ANPGLLNKILLEKLNVK  552



>ref|XP_006297361.1| hypothetical protein CARUB_v10013381mg [Capsella rubella]
 gb|EOA30259.1| hypothetical protein CARUB_v10013381mg [Capsella rubella]
Length=550

 Score =   327 bits (839),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGLSMQDVLFL ND  +AE+F+A IG+GA+VK
Sbjct  353  VILTQEYVDSIRASLPELPEAKRRRYEAMGLSMQDVLFLANDVTVAEYFEAVIGKGAEVK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLSIN++KLTPQEL+ELI+AIK  TISGKIGKEILFE++AKGG
Sbjct  413  LAANWIMGDIAAYLKNEKLSINDMKLTPQELAELIAAIKDGTISGKIGKEILFELLAKGG  472

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMIKEKDLVQI DP EIEKMV KV+++NPKQLEQYR GKTKLQGYFAGQ+MK SKGK
Sbjct  473  TVKGMIKEKDLVQITDPAEIEKMVIKVVSENPKQLEQYRSGKTKLQGYFAGQIMKMSKGK  532

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  533  ANPGLLNKILLEKLNAK  549



>gb|KJB38438.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38440.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38441.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38442.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
 gb|KJB38443.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
Length=565

 Score =   328 bits (840),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+ NSLPELPE KRRRYEKMGLSMQDVLFL ND N+AE+FDAT+  GAD+K
Sbjct  368  VILTQEYVDSISNSLPELPEAKRRRYEKMGLSMQDVLFLANDMNVAEYFDATLSSGADIK  427

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSIN+IKLTPQEL+ELI++IK  TISGKIGKEIL E++AKGG
Sbjct  428  LAANWIMGDIAAYMKNEKLSINDIKLTPQELAELIASIKSGTISGKIGKEILSELLAKGG  487

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDL+QI DP EI KM+DKVI++NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  488  TVKGLIEEKDLIQIADPVEIGKMIDKVISENPKQLEQYRGGKTKLQGFFAGQVMKLSKGK  547

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLN +
Sbjct  548  ANPGLLNKILLEKLNGQ  564



>ref|XP_007223309.1| hypothetical protein PRUPE_ppa003810mg [Prunus persica]
 gb|EMJ24508.1| hypothetical protein PRUPE_ppa003810mg [Prunus persica]
Length=547

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 179/197 (91%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T DYVD + NSLPELPE KRRRYEKMGLSMQDVLFL ND N+AEFFD TI +GADVK
Sbjct  351  VFLTTDYVDGIRNSLPELPETKRRRYEKMGLSMQDVLFLANDMNVAEFFDTTITKGADVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEKL+INEIKLTPQEL+ELI++IK  TISGKIGKEILFE++AKGG
Sbjct  411  LATNWIMGDIAAYMKNEKLTINEIKLTPQELAELIASIKDGTISGKIGKEILFELLAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+ KDLVQ  +P EIEK V+KV+++NPKQLEQYRGGKTKLQGYFAGQVMK SKGK
Sbjct  471  TVKGLIEAKDLVQ-ANPAEIEKWVEKVLSENPKQLEQYRGGKTKLQGYFAGQVMKLSKGK  529

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  530  ANPGLLNKILLEKLNAK  546



>ref|NP_564530.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 sp|Q9FV81.1|GATB_ARATH RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG29096.1|AF239836_1 Glu-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 gb|AAL06883.1| At1g48520/T1N15_12 [Arabidopsis thaliana]
 gb|AAL67097.1| At1g48520/T1N15_12 [Arabidopsis thaliana]
 dbj|BAE99203.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32309.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
Length=550

 Score =   324 bits (830),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+FDA IG+GA+VK
Sbjct  353  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFDAVIGKGAEVK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+M DIAAYLKNEKLSIN+IKLTPQEL+ELI+AIK  TISGKIGKEILFE++AKGG
Sbjct  413  LAANWIMSDIAAYLKNEKLSINDIKLTPQELAELIAAIKDGTISGKIGKEILFELLAKGG  472

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMIK KDLVQI DP EIEKMV +V+++NPKQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  473  TVKGMIKAKDLVQITDPAEIEKMVIQVVSENPKQLEQYRSGKTKLQGYFAGQVMKMSKGK  532

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  533  ANPGLLNKILLEKLNAK  549



>ref|XP_003530925.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Glycine max]
Length=549

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++Q+YVD + NSLPELPE+KRRRYE+MGLSMQDVLFL ND NIAEFFDAT+ +GAD K
Sbjct  352  VILSQEYVDGIKNSLPELPEIKRRRYEQMGLSMQDVLFLANDKNIAEFFDATLAKGADSK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            L  NW+M DIAA++KNEKL+INEIKLTP+ELSELI++IKG TISGKIGKEILFE++AKGG
Sbjct  412  LVANWIMSDIAAFMKNEKLTINEIKLTPEELSELIASIKGGTISGKIGKEILFELLAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I++KDLVQI DP EIEKMVDKVI +NPKQ+EQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  472  TVKELIQKKDLVQIADPVEIEKMVDKVIVENPKQVEQYRGGKTKLQGFFAGQVMKLSKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLN+K
Sbjct  532  ANPGLLNKILLEKLNSK  548



>ref|XP_011462425.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Fragaria vesca subsp. vesca]
Length=550

 Score =   323 bits (829),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVD + NSLPELPEMKRRRYEKMGLSMQDVLFL ND N+AEFFD TI  GAD K
Sbjct  353  VFLTQEYVDGIHNSLPELPEMKRRRYEKMGLSMQDVLFLANDMNVAEFFDTTITTGADSK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+M DIAA++KNE+L+I E+KL+PQEL+ELI++IK  TISGKIGK+ILFE++AKGG
Sbjct  413  LAANWIMSDIAAFMKNEELTITEVKLSPQELAELIASIKDGTISGKIGKQILFELLAKGG  472

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDLVQIVDP EIEKMV+KV+++NPKQL+QYRGGKTKLQGYFAGQ+MK SKGK
Sbjct  473  TVKGLIEEKDLVQIVDPAEIEKMVEKVLSENPKQLDQYRGGKTKLQGYFAGQIMKLSKGK  532

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  533  ANPGILNKILLEKLNAK  549



>ref|XP_010264847.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010264848.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010264849.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010264850.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Nelumbo nucifera]
Length=548

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++++YVD++  SL ELPE+KRRRYE+MGLSMQDVLFLTND N+A+FFDATI RGA+VK
Sbjct  351  VVLSEEYVDNIRASLLELPEVKRRRYERMGLSMQDVLFLTNDMNVADFFDATIERGAEVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            +A NW+M DIAAYL NEKLSINEIKLTPQEL+ELIS+IKG TISGKIGKEILFE+++ GG
Sbjct  411  MAANWIMSDIAAYLNNEKLSINEIKLTPQELAELISSIKGGTISGKIGKEILFELISNGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQIVDP EIEKMVDKV+ +NPKQL+QYRGGKTKLQG+FAGQVMK SKGK
Sbjct  471  TVKALIEEKDLVQIVDPAEIEKMVDKVLIENPKQLQQYRGGKTKLQGFFAGQVMKLSKGK  530

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  531  ANPGLLNKILLEKLNAK  547



>ref|XP_003525222.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Glycine max]
Length=544

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++Q+YVD + NSLPELPE+KRRRYE+MGLSMQDVLFL ND NIA+FFDAT+ +GAD K
Sbjct  347  VILSQEYVDGIKNSLPELPEIKRRRYEQMGLSMQDVLFLANDKNIADFFDATLAKGADPK  406

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            L  NW+M DIAA++KNEKL+INEIKLTP+ELSELI++IKG TIS KIGKEILFE++AKGG
Sbjct  407  LVANWIMSDIAAFMKNEKLTINEIKLTPEELSELIASIKGGTISSKIGKEILFELLAKGG  466

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I++KDLVQI DP EIEKMVDK+IADNPKQ+EQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  467  TVKELIEKKDLVQIADPVEIEKMVDKIIADNPKQVEQYRGGKTKLQGFFAGQVMKLSKGK  526

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLN+K
Sbjct  527  ANPGLLNKILLEKLNSK  543



>ref|XP_010532821.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=552

 Score =   322 bits (826),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YV+S+ +SLPELPE KRRRYE MGLSM DVLFL ND+++AE+FDA I +GA+VK
Sbjct  355  VILTQEYVNSIHSSLPELPEAKRRRYEAMGLSMYDVLFLANDTSVAEYFDAVIAKGAEVK  414

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAYLKNEKLSIN+IKLT QEL+ LI+AIK  TISGKIGKEILFE++AKGG
Sbjct  415  LATNWIMGDIAAYLKNEKLSINDIKLTAQELAGLIAAIKDGTISGKIGKEILFELLAKGG  474

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IKEKDLVQI DP EIEKMV+KVI++NPKQLEQYR GKTKL+GYFAGQVMK SKGK
Sbjct  475  TVKGVIKEKDLVQITDPSEIEKMVEKVISENPKQLEQYRAGKTKLEGYFAGQVMKISKGK  534

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  535  ANPGLLNKILLEKLNAK  551



>gb|KHN21619.1| Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Glycine soja]
Length=548

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++Q+YVD + NSLPELPE+KRRRYE+MGLSMQDVLFL ND NIA+FFDAT+ +GAD K
Sbjct  351  VILSQEYVDGIKNSLPELPEIKRRRYEQMGLSMQDVLFLANDKNIADFFDATLAKGADPK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            L  NW+M DIAA++KNEKL+INEIKLTP+ELSELI++IKG TIS KIGKEILFE++AKGG
Sbjct  411  LVANWIMSDIAAFMKNEKLTINEIKLTPEELSELIASIKGGTISSKIGKEILFELLAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I++KDLVQI DP EIEKMVDK+IADNPKQ+EQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  471  TVKELIEKKDLVQIADPVEIEKMVDKIIADNPKQVEQYRGGKTKLQGFFAGQVMKLSKGK  530

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLN+K
Sbjct  531  ANPGLLNKILLEKLNSK  547



>ref|XP_010490175.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=514

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+FDA IG+GA+VK
Sbjct  317  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFDAVIGKGAEVK  376

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLSIN++KLT QEL+ELI+AIK  TISGKIGKEILFE++AKGG
Sbjct  377  LAANWIMGDIAAYLKNEKLSINDMKLTTQELAELIAAIKDGTISGKIGKEILFELLAKGG  436

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMIKEKDLVQI DP EIEKMV KV+++N KQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  437  TVKGMIKEKDLVQITDPAEIEKMVIKVVSENQKQLEQYRSGKTKLQGYFAGQVMKMSKGK  496

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  497  ANPGLLNKILLEKLNAK  513



>ref|XP_004169939.1| PREDICTED: LOW QUALITY PROTEIN: glutamyl-tRNA(Gln) amidotransferase 
subunit B, chloroplastic/mitochondrial-like [Cucumis 
sativus]
Length=556

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIA-EFFDATIGRGADV  559
            V +T++YV+++ +SLPELPEMKRRRYE MGLSMQDVLFL ND +++   FDATI RGA+V
Sbjct  358  VILTKEYVENIHDSLPELPEMKRRRYESMGLSMQDVLFLANDISVSGXVFDATIARGAEV  417

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+MGDIAAY+KNEKL+IN+IKLTPQEL+ELI++IKG TISGKIGKEILFE++AKG
Sbjct  418  KLAANWIMGDIAAYMKNEKLTINDIKLTPQELAELIASIKGGTISGKIGKEILFELLAKG  477

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            GTVKG+IK+KDLVQI DP EIEKMV+KV+A+NPKQLEQYRGGKTKLQG+FAGQVMK SKG
Sbjct  478  GTVKGLIKDKDLVQIADPAEIEKMVEKVLAENPKQLEQYRGGKTKLQGFFAGQVMKASKG  537

Query  198  KANPKMLNKILLEKLNAK  145
            KANP +LNKILLEKLNA+
Sbjct  538  KANPGLLNKILLEKLNAQ  555



>ref|XP_010527184.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=550

 Score =   322 bits (824),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVD + NSLPELPE  RRRYE+MGLSMQDVLFL ND+++AE+FDA I +GA+VK
Sbjct  354  VILTQEYVDGIRNSLPELPEAIRRRYERMGLSMQDVLFLANDTSVAEYFDAVIAKGAEVK  413

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLS+N+IKLTPQELSELI+AIK  TISGKIGKEILFE++AKGG
Sbjct  414  LAANWIMGDIAAYLKNEKLSMNDIKLTPQELSELIAAIKDGTISGKIGKEILFELLAKGG  473

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IK+KDLVQI DP EIEKM+D+VI+++PKQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  474  TVKGIIKDKDLVQITDPLEIEKMIDEVISESPKQLEQYRAGKTKLQGYFAGQVMKMSKGK  533

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKILLEKLN 
Sbjct  534  ANPGLLNKILLEKLNT  549



>ref|XP_006420387.1| hypothetical protein CICLE_v10004652mg [Citrus clementina]
 gb|ESR33627.1| hypothetical protein CICLE_v10004652mg [Citrus clementina]
Length=563

 Score =   322 bits (825),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 180/197 (91%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++YVDS+ +SLPELPEMKRRRYE+MGLSMQDVLFL ND N+A FFDATIG+GADVK
Sbjct  367  VILNKEYVDSIQSSLPELPEMKRRRYEEMGLSMQDVLFLANDINVARFFDATIGKGADVK  426

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAA++KNEKL+INEIKL+  EL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  427  LAANWIMGDIAAHMKNEKLTINEIKLSAAELAELIASIKGATISGKIGKEILFELMAKGG  486

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV G+IKEKDLVQ  +P EIEKMVDKV ++NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  487  TVNGIIKEKDLVQ-ANPSEIEKMVDKVFSENPKQLEQYRGGKTKLQGFFAGQVMKISKGK  545

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  546  ANPGLLNKILLEKLNAK  562



>ref|XP_010467088.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Camelina sativa]
Length=549

 Score =   321 bits (823),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+FDA IG+GA+VK
Sbjct  352  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFDAVIGKGAEVK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLSIN++KLT QEL+ELI+AIK  TISGKIGKEILFE++AKGG
Sbjct  412  LAANWIMGDIAAYLKNEKLSINDMKLTTQELAELIAAIKDGTISGKIGKEILFELLAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMIKEKDLVQI DP EIEKMV KV+++N KQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  472  TVKGMIKEKDLVQITDPAEIEKMVIKVVSENQKQLEQYRSGKTKLQGYFAGQVMKMSKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  532  ANPGLLNKILLEKLNAK  548



>ref|XP_010412724.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=549

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+FDA IG+GA+VK
Sbjct  352  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFDAVIGKGAEVK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLSIN++KLT QEL+ELI+AIK  TISGKIGKEILFE++AKGG
Sbjct  412  LAANWIMGDIAAYLKNEKLSINDMKLTTQELAELIAAIKDGTISGKIGKEILFELLAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKGMIKEKDLVQI DP EIEKMV KV+++N KQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  472  TVKGMIKEKDLVQITDPAEIEKMVIKVVSENQKQLEQYRSGKTKLQGYFAGQVMKMSKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  532  ANPGLLNKILLEKLNAK  548



>gb|KFK39734.1| hypothetical protein AALP_AA3G281100 [Arabis alpina]
Length=551

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+ +SLPELPE KRRRYE MGL MQDVLFL ND ++A+FFDA IG+GA+VK
Sbjct  354  VILTQEYVDSIHSSLPELPEGKRRRYEAMGLGMQDVLFLANDVSVADFFDAVIGKGAEVK  413

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNE +SIN++KLTPQEL+ELI+AIK  TISGKIGK+ILFE++AKGG
Sbjct  414  LAANWIMGDIAAYLKNENISINDVKLTPQELAELIAAIKDGTISGKIGKQILFELLAKGG  473

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV+GMIK KDLVQI DP EIEKMV KV+++NPKQLEQYR G+TKL+GYFAGQVMK SKGK
Sbjct  474  TVQGMIKAKDLVQITDPAEIEKMVLKVVSENPKQLEQYRSGRTKLEGYFAGQVMKMSKGK  533

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  534  ANPGLLNKILLEKLNAK  550



>ref|XP_007160438.1| hypothetical protein PHAVU_002G322100g [Phaseolus vulgaris]
 gb|ESW32432.1| hypothetical protein PHAVU_002G322100g [Phaseolus vulgaris]
Length=548

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + Q+YVD +  SLPELPE+KRRRYE+MGLSMQDVLFL ND NIAEFFDAT+ +GAD K
Sbjct  351  VILAQEYVDDIIKSLPELPEIKRRRYEQMGLSMQDVLFLANDKNIAEFFDATLAKGADPK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            L  NW+M DIAA++KNEKL+INEI+LTP+ELSELI++IKG TISGKIGKE+LFE++AKGG
Sbjct  411  LVANWIMSDIAAFMKNEKLTINEIRLTPEELSELIASIKGGTISGKIGKEVLFELLAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I++KDLVQIVDP EIEKMV+KVIA+NPKQ+EQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  471  TVKELIEKKDLVQIVDPVEIEKMVEKVIAENPKQVEQYRGGKTKLQGFFAGQVMKLSKGK  530

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LN+ILLEKL++
Sbjct  531  ANPGLLNRILLEKLSS  546



>ref|XP_011029735.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029736.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029737.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029738.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
 ref|XP_011029739.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Populus euphratica]
Length=546

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++YVDS+ NSLPELPEMKRRRYE MGLSMQDVLFL ND N+A+FFDATI  GADVK
Sbjct  349  VILKKEYVDSIQNSLPELPEMKRRRYENMGLSMQDVLFLANDINVAKFFDATIAEGADVK  408

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEK+SIN+IKL P+EL+ELI++IKG TISGKIGKEILFE++ KGG
Sbjct  409  LATNWIMGDIAAYMKNEKVSINDIKLVPRELAELIASIKGGTISGKIGKEILFELIEKGG  468

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EK+LVQIVD  EIEKMVDKV+++NP QLEQYR GKTK+QGYFAGQVMK SKGK
Sbjct  469  TVKGLIEEKNLVQIVDHTEIEKMVDKVLSENPNQLEQYRAGKTKIQGYFAGQVMKLSKGK  528

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL +KLNA
Sbjct  529  ANPGLLNKILQQKLNA  544



>ref|XP_004490131.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Cicer arietinum]
Length=536

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + Q+YVD + NSLPELPE KRRRYEKMGL MQDVLFL ND NIAEFFDAT+ +GAD K
Sbjct  339  VILCQEYVDGIQNSLPELPEEKRRRYEKMGLGMQDVLFLANDKNIAEFFDATLAKGADAK  398

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            L  NW+M DIAA++KNEKL+IN+IKLTP+ELSELI++IKG  ISGKIGKEILFE++AKGG
Sbjct  399  LVANWIMSDIAAFMKNEKLTINDIKLTPEELSELIASIKGGIISGKIGKEILFELLAKGG  458

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            +VK +I++KDLVQI DP EIEKMVDKVIA+NPKQ+EQ+RGGKTKLQG+FAGQVMK SKGK
Sbjct  459  SVKEIIEKKDLVQIADPVEIEKMVDKVIAENPKQVEQFRGGKTKLQGFFAGQVMKVSKGK  518

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLN+K
Sbjct  519  ANPGLLNKILLEKLNSK  535



>ref|XP_009135887.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Brassica rapa]
Length=545

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL +QDVLFL ND ++AE+FD  IG+GADVK
Sbjct  348  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGIQDVLFLANDVSVAEYFDEVIGKGADVK  407

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A NW+M DIAAYLKNE+LSI+++KLTP EL+ELI+AIK ETISGKIGK+ILFE++AKGG
Sbjct  408  SAANWLMSDIAAYLKNEELSISDVKLTPHELAELIAAIKDETISGKIGKQILFELLAKGG  467

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV+GMIKEKDLVQI DP EIEKM+ KVI+++PKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  468  TVQGMIKEKDLVQITDPVEIEKMIMKVISESPKQLEQYRSGKTKLQGFFAGQVMKMSKGK  527

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  528  ANPALLNKILLEKLNAK  544



>ref|XP_010667086.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667087.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667088.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667089.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667091.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667092.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T++Y+ S+ +SLPELPE+KRRRYE+MGLSMQDVLFL ND NIAEFFD T+ +GAD K
Sbjct  352  VILTKEYIKSMRDSLPELPELKRRRYEQMGLSMQDVLFLANDVNIAEFFDETLSKGADTK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK+SI +IKLTP EL+ELI +IK  TISGKIGKEILFE++AKGG
Sbjct  412  LAANWIMGDIAAYMKNEKVSIIDIKLTPIELAELIDSIKNGTISGKIGKEILFELIAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IK+K+LVQI D  EIEKM+DKV+A+NPKQ+EQYRGGKTKLQG+FAGQVMKESKGK
Sbjct  472  TVKGLIKDKNLVQITDSAEIEKMIDKVLAENPKQVEQYRGGKTKLQGFFAGQVMKESKGK  531

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILL+KLNAK
Sbjct  532  ANPGVLNKILLDKLNAK  548



>ref|XP_004979428.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Setaria italica]
Length=546

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++ DY+D +  S+PELPE KRRRYE MGLSMQDVLFL ND N+A FFD+T+  GAD K
Sbjct  350  VVLSTDYIDEISKSMPELPEAKRRRYENMGLSMQDVLFLANDDNVAHFFDSTLEHGADAK  409

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLSINE KLTP ELSELI +IK  TISGKIGKEIL E++AKGG
Sbjct  410  LACNWIMGDIAAYLKNEKLSINETKLTPLELSELIESIKNGTISGKIGKEILVELIAKGG  469

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDLVQI DP  IE MVDKVIADNPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  470  TVKGVIEEKDLVQIADPAAIEAMVDKVIADNPKQLEQYRAGKTKLQGFFAGQVMKASKGK  529

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL EKLNA
Sbjct  530  ANPVLLNKILGEKLNA  545



>ref|XP_006418762.1| hypothetical protein EUTSA_v10002467mg [Eutrema salsugineum]
 gb|ESQ37198.1| hypothetical protein EUTSA_v10002467mg [Eutrema salsugineum]
Length=551

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+F+A IG+GADVK
Sbjct  354  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFEAVIGKGADVK  413

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A NW+M DIAAYLKNE+LSIN+ KLTPQEL+ELI+AIK  TISGKIGK+ILFE++AKGG
Sbjct  414  SAANWIMSDIAAYLKNEELSINDAKLTPQELAELIAAIKDGTISGKIGKQILFELLAKGG  473

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV+GMIK KDLVQI DP EIEKMV KV+++NPKQLEQYR GKTKL+GYFAGQVMK SKGK
Sbjct  474  TVQGMIKAKDLVQITDPAEIEKMVLKVVSENPKQLEQYRSGKTKLEGYFAGQVMKMSKGK  533

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKIL EKLNAK
Sbjct  534  ANPALLNKILQEKLNAK  550



>ref|XP_003614593.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Medicago 
truncatula]
 gb|AES97551.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Medicago 
truncatula]
Length=542

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + Q+YVD + NSLPELPE KRRRYEKMGL MQDVLFL ND NIAEFFDAT+ +GAD K
Sbjct  347  VILYQEYVDGIKNSLPELPEGKRRRYEKMGLGMQDVLFLANDKNIAEFFDATLAKGADAK  406

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            L  NW+M DIA ++KNEKL+IN+IKLTP+EL+ELI++IK  TISGKIGKEILFE++A+GG
Sbjct  407  LVANWIMSDIAGFMKNEKLTINDIKLTPEELAELIASIKDGTISGKIGKEILFELLAEGG  466

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            +VK +I++KDLVQI DP EIEKMVDK IADNPKQ+EQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  467  SVKEIIEKKDLVQITDPVEIEKMVDKAIADNPKQVEQYRGGKTKLQGFFAGQVMKASKGK  526

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKILLEKLN+
Sbjct  527  ANPGLLNKILLEKLNS  542



>ref|XP_010667083.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010667084.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=679

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T++Y+ S+ +SLPELPE+KRRRYE+MGLSMQDVLFL ND NIAEFFD T+ +GAD K
Sbjct  482  VILTKEYIKSMRDSLPELPELKRRRYEQMGLSMQDVLFLANDVNIAEFFDETLSKGADTK  541

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEK+SI +IKLTP EL+ELI +IK  TISGKIGKEILFE++AKGG
Sbjct  542  LAANWIMGDIAAYMKNEKVSIIDIKLTPIELAELIDSIKNGTISGKIGKEILFELIAKGG  601

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+IK+K+LVQI D  EIEKM+DKV+A+NPKQ+EQYRGGKTKLQG+FAGQVMKESKGK
Sbjct  602  TVKGLIKDKNLVQITDSAEIEKMIDKVLAENPKQVEQYRGGKTKLQGFFAGQVMKESKGK  661

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILL+KLNAK
Sbjct  662  ANPGVLNKILLDKLNAK  678



>gb|AFW64900.1| hypothetical protein ZEAMMB73_511569 [Zea mays]
Length=546

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 169/197 (86%), Gaps = 0/197 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V IT DY++ +  S+PELPE KRRRYE MGLSMQDVLFL ND NI  FFD+T+  GAD K
Sbjct  350  VVITSDYINEISKSMPELPEAKRRRYENMGLSMQDVLFLANDDNIGHFFDSTLEHGADAK  409

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLK+EK+SI+EIKLTP ELSELI++IK  TISGKIGKEIL E++AKGG
Sbjct  410  LAANWIMGDIAAYLKDEKVSIDEIKLTPLELSELIASIKNGTISGKIGKEILAELIAKGG  469

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVDKVIADNPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  470  TVKAVIEEKDLVQIADPAAIEAMVDKVIADNPKQLEQYRAGKTKLQGFFAGQVMKASKGK  529

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKIL EKLNAK
Sbjct  530  ANPVLLNKILGEKLNAK  546



>ref|XP_009420135.1| PREDICTED: LOW QUALITY PROTEIN: glutamyl-tRNA(Gln) amidotransferase 
subunit B, chloroplastic/mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=442

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+DYVD +   LPELPE KRRRYEK+GL+MQDVLFL ND+++AEFFDA++  GAD K
Sbjct  245  VILTKDYVDKIQQVLPELPEAKRRRYEKLGLNMQDVLFLANDNHVAEFFDASVENGADAK  304

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAA+LKNE LS+NEIKLTP ELSELI++IK  TISGKIGKEILFE+++KGG
Sbjct  305  LAANWIMGDIAAFLKNEXLSMNEIKLTPVELSELITSIKNGTISGKIGKEILFELLSKGG  364

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQIVDP  IE +VDKV+A NPKQL+QYRGGKTKLQG+FAGQVMKESKGK
Sbjct  365  TVKSLIEEKDLVQIVDPAAIEALVDKVLAANPKQLQQYRGGKTKLQGFFAGQVMKESKGK  424

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL +KLN 
Sbjct  425  ANPLVLNKILADKLNG  440



>ref|XP_002314512.2| hypothetical protein POPTR_0010s07520g, partial [Populus trichocarpa]
 gb|EEF00683.2| hypothetical protein POPTR_0010s07520g, partial [Populus trichocarpa]
Length=488

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 176/196 (90%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++Y+DS+ NSLPELPEMKRRRYE MGLSMQDVLFL ND N+AEFFDATI +GADVK
Sbjct  292  VIVKKEYIDSIQNSLPELPEMKRRRYESMGLSMQDVLFLANDINVAEFFDATIAKGADVK  351

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEK+SIN+IKL PQEL+ELI++IK  TISGKIGKEIL E++AKGG
Sbjct  352  LATNWIMGDIAAYMKNEKVSINDIKLNPQELAELIASIKVGTISGKIGKEILSELIAKGG  411

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EK+LVQ  +P  IEKMVDKV+++NPKQLEQYR GKTK+QG+ AGQVMK SKGK
Sbjct  412  TVKGLIEEKNLVQ-ANPAHIEKMVDKVLSENPKQLEQYRAGKTKIQGFLAGQVMKLSKGK  470

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL +KLNA
Sbjct  471  ANPGLLNKILQQKLNA  486



>ref|XP_006662992.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 
[Oryza brachyantha]
Length=548

 Score =   308 bits (790),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            + +  DY+D +  S+PELPE KRRRYE MGLSMQDVLFL ND N+A FFD+T+G GAD K
Sbjct  351  IVLNSDYIDEIQKSMPELPEAKRRRYENMGLSMQDVLFLANDDNVARFFDSTLGHGADAK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKL+I+EIKLTP ELSELI++IK  TISGKIGKEIL E++AKGG
Sbjct  411  LAANWIMGDIAAYLKNEKLTIDEIKLTPLELSELIASIKNGTISGKIGKEILIELIAKGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQIVDP  IE MVD+V+ADNPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  471  TVKSVIEEKDLVQIVDPAAIEAMVDQVLADNPKQLEQYRSGKTKLQGFFAGQVMKASKGK  530

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL EKL A
Sbjct  531  ANPVLLNKILGEKLKA  546



>ref|XP_002450901.1| hypothetical protein SORBIDRAFT_05g020870 [Sorghum bicolor]
 sp|C5Y3V8.1|GATB_SORBI RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Sorghum bicolor]
 gb|EES09889.1| hypothetical protein SORBIDRAFT_05g020870 [Sorghum bicolor]
Length=548

 Score =   308 bits (790),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T DY++ +  S+PELPE KRRRYE MGLSMQDVLFL ND NI  F+D+T+  GAD K
Sbjct  352  VVLTSDYINEISKSMPELPEAKRRRYENMGLSMQDVLFLANDDNIGHFYDSTLEHGADAK  411

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLK+EK+SI+EIKLTP ELSELI++IK  TISGKIGKEIL E++AKGG
Sbjct  412  LAANWIMGDIAAYLKDEKVSIDEIKLTPLELSELIASIKNGTISGKIGKEILAELIAKGG  471

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVKG+I+EKDLVQI DP  IE MVDKVIADNPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  472  TVKGVIEEKDLVQIADPAAIEAMVDKVIADNPKQLEQYRAGKTKLQGFFAGQVMKASKGK  531

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL EKLNA
Sbjct  532  ANPVLLNKILGEKLNA  547



>ref|XP_008796400.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Phoenix dactylifera]
 ref|XP_008796401.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Phoenix dactylifera]
 ref|XP_008796402.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Phoenix dactylifera]
Length=553

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+ +VD +  SLPELPE KRRRYEKMGLSMQDVLFL ND+++A+FFDA +  GA+ K
Sbjct  356  VVLTKGFVDEIRQSLPELPEAKRRRYEKMGLSMQDVLFLANDNSVADFFDAAVENGAEEK  415

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNE+L+I+EIKLTP+ELSELI+ IK  TISGKIGKEILFE+++KGG
Sbjct  416  LAANWIMGDIAAYLKNERLTIDEIKLTPKELSELIAFIKNGTISGKIGKEILFELISKGG  475

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQIVDP  IE +VDKV+A NPKQL+QYRGGKTKLQG+FAGQVMKESKGK
Sbjct  476  TVKSLIEEKDLVQIVDPATIEALVDKVLAANPKQLQQYRGGKTKLQGFFAGQVMKESKGK  535

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL EKLNA
Sbjct  536  ANPMLLNKILTEKLNA  551



>sp|A2ZF53.1|GATB_ORYSI RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Oryza sativa Indica Group]
 gb|EAY81237.1| hypothetical protein OsI_36412 [Oryza sativa Indica Group]
Length=544

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T +Y+D + NS+PELPE KRRR+E MGLSMQDVLFL ND N+A FFD+T+  GAD K
Sbjct  347  VVLTSEYIDEIQNSMPELPEAKRRRFENMGLSMQDVLFLANDDNVARFFDSTLEHGADAK  406

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLSI+EIKLTP ELSELI++IK  TISGKIGKEIL E++AKGG
Sbjct  407  LAANWIMGDIAAYLKNEKLSIDEIKLTPLELSELIASIKNGTISGKIGKEILIELIAKGG  466

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVD+V+ADNPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  467  TVKSVIEEKDLVQIADPAAIEAMVDQVLADNPKQLEQYRSGKTKLQGFFAGQVMKASKGK  526

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL EKL A
Sbjct  527  ANPVLLNKILGEKLKA  542



>ref|NP_001068056.2| Os11g0544800 [Oryza sativa Japonica Group]
 sp|Q2R2Z0.1|GATB_ORYSJ RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA94201.1| Aspartyl/glutamyl-tRNA amidotransferase subunit B, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ18664.1| hypothetical protein OsJ_34183 [Oryza sativa Japonica Group]
 dbj|BAG89266.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28419.2| Os11g0544800 [Oryza sativa Japonica Group]
Length=544

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T +Y+D + NS+PELPE KRRR+E MGLSMQDVLFL ND N+A FFD+T+  GAD K
Sbjct  347  VVLTSEYIDEIQNSMPELPEAKRRRFENMGLSMQDVLFLANDDNVARFFDSTLEHGADAK  406

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNEKLSI+EIKLTP ELSELI++I+  TISGKIGKEIL E++AKGG
Sbjct  407  LAANWIMGDIAAYLKNEKLSIDEIKLTPLELSELIASIRNGTISGKIGKEILIELIAKGG  466

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVD+V+ADNPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  467  TVKSVIEEKDLVQIADPAAIEAMVDQVLADNPKQLEQYRSGKTKLQGFFAGQVMKASKGK  526

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL EKL A
Sbjct  527  ANPVLLNKILGEKLKA  542



>emb|CDX93007.1| BnaA03g37290D [Brassica napus]
Length=552

 Score =   306 bits (783),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 174/197 (88%), Gaps = 2/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL +QDVLFL ND ++AE+FD  IG+GADVK
Sbjct  357  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGIQDVLFLANDVSVAEYFDEVIGKGADVK  416

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A NW+M DIAAYLKNE+LSI+++KLTP EL+ELI+AIK ETISGKIGK+ILFE++AKGG
Sbjct  417  SAANWLMSDIAAYLKNEELSISDVKLTPHELAELIAAIKDETISGKIGKQILFELLAKGG  476

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV+GMIKEKDL  I DP EIEKM+ KVI+++PKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  477  TVQGMIKEKDL--ITDPVEIEKMIMKVISESPKQLEQYRSGKTKLQGFFAGQVMKMSKGK  534

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  535  ANPALLNKILLEKLNAK  551



>emb|CDX94828.1| BnaC03g43600D [Brassica napus]
Length=552

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 173/197 (88%), Gaps = 2/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V  TQ+YVDS+  SLPELPE KRRRYE MGL +QDVLFL ND ++AE+FD  IG+GADVK
Sbjct  357  VIFTQEYVDSIRASLPELPEAKRRRYEAMGLGIQDVLFLANDVSVAEYFDEVIGKGADVK  416

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A NW+M DIAAYLKNE+LSI+++KLTPQEL+ELI+AIK ETISGKIGK+ILFE++AKGG
Sbjct  417  SAANWLMSDIAAYLKNEELSISDVKLTPQELAELIAAIKDETISGKIGKQILFELLAKGG  476

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV+GMIKEKDL  I DP EIEKM+ KVI+++PKQLEQYR GKTKLQG+F GQVMK SKGK
Sbjct  477  TVQGMIKEKDL--ITDPVEIEKMIMKVISESPKQLEQYRSGKTKLQGFFTGQVMKMSKGK  534

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  535  ANPALLNKILLEKLNAK  551



>ref|XP_010936074.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Elaeis guineensis]
 ref|XP_010936075.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X1 [Elaeis guineensis]
Length=552

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++Y+D +  SLPELPE KRRRYEK+GLSMQDVLFL ND+N+A+FFDA +  GAD K
Sbjct  355  VVLVKEYIDEIRQSLPELPEAKRRRYEKLGLSMQDVLFLANDNNVADFFDAAVENGADAK  414

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNE+ +I+EIKLTP+ELSELI+ IK  TISGKIGKEILFE+++KGG
Sbjct  415  LAANWIMGDIAAYLKNERRTIDEIKLTPKELSELIAFIKNGTISGKIGKEILFELISKGG  474

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQIVDP  I  +VDKV+A NPKQL+QYRGGKTKLQG+FAGQVMKESKGK
Sbjct  475  TVKSLIEEKDLVQIVDPATIGALVDKVLAANPKQLQQYRGGKTKLQGFFAGQVMKESKGK  534

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL EKL+A
Sbjct  535  ANPMLLNKILTEKLHA  550



>ref|XP_003575991.2| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Brachypodium distachyon]
Length=547

 Score =   303 bits (776),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T +Y+D + NS+PELPE KRRRYE MGLSMQDV+FL ND N+A FFDAT+ RGAD K
Sbjct  350  VVLTSEYIDEIRNSMPELPEAKRRRYENMGLSMQDVIFLANDDNVAHFFDATLERGADAK  409

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDI AYLKNEKLSI+EIKLTP ELSELI++IK  TI+GKIGKEIL E++AKGG
Sbjct  410  LAANWIMGDITAYLKNEKLSIDEIKLTPLELSELIASIKNGTINGKIGKEILVELIAKGG  469

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE +VD+V+ADNPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  470  TVKSVIEEKDLVQIADPAAIEAIVDQVLADNPKQLEQYRAGKTKLQGFFAGQVMKASKGK  529

Query  195  ANPKMLNKILLEKL  154
            A+P +LNKIL EKL
Sbjct  530  ASPVLLNKILAEKL  543



>gb|EMS48922.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Triticum 
urartu]
Length=546

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T DY+D +CNS+PELPE KRRRYE MGLSMQDV+FL ND  +A FFD+T+  GAD K
Sbjct  350  VVLTSDYIDEICNSMPELPEAKRRRYENMGLSMQDVIFLANDDIVAHFFDSTLEHGADAK  409

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDI AYLKNEKLSI+EIKLTP ELSELI+ IK  TISGKIGKEIL E++ KGG
Sbjct  410  LAANWIMGDITAYLKNEKLSIDEIKLTPLELSELIAFIKNGTISGKIGKEILVELITKGG  469

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVDKV+A+NPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  470  TVKSVIEEKDLVQIADPAAIEAMVDKVLAENPKQLEQYRAGKTKLQGFFAGQVMKASKGK  529

Query  195  ANPKMLNKILLEKL  154
            A+P +LNKIL EKL
Sbjct  530  ASPVLLNKILGEKL  543



>gb|EPS62098.1| hypothetical protein M569_12692, partial [Genlisea aurea]
Length=482

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT++ +YV  + +SLPELPE KRRRYE +GL MQDVLFL ND N+A FFD TI  GADVK
Sbjct  288  VTLSDEYVGRIRDSLPELPETKRRRYESLGLGMQDVLFLANDMNVAAFFDETIATGADVK  347

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A NWMMGDIAAYLKNEKLSIN IKL P+EL+ LI+AIK  TISGKIGKEIL E+M+KGG
Sbjct  348  SAANWMMGDIAAYLKNEKLSINGIKLVPRELASLIAAIKTGTISGKIGKEILLELMSKGG  407

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV+GMI+E DLVQIVDP EIEK+V++V+ +NPKQLEQYR GKT+LQGYFAGQ MKE++GK
Sbjct  408  TVEGMIEENDLVQIVDPVEIEKIVNRVLKENPKQLEQYRSGKTRLQGYFAGQAMKETRGK  467

Query  195  ANPKMLNKILLEKL  154
            ANP++LNKILL++L
Sbjct  468  ANPELLNKILLQRL  481



>gb|EMT05438.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Aegilops 
tauschii]
Length=543

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T DY+D + NS+PELPE KRRRYE MGLSMQDV+FL ND  +A FFD+T+ RGAD K
Sbjct  347  VVLTSDYIDEIRNSMPELPEAKRRRYENMGLSMQDVIFLANDDIVAHFFDSTLERGADAK  406

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDI AYLKNEKLSI+EIKLTP ELSELI+ IK  TISGKIGKEIL E++ KGG
Sbjct  407  LAANWIMGDITAYLKNEKLSIDEIKLTPLELSELIAFIKNGTISGKIGKEILVELITKGG  466

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVDKV+A+NPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  467  TVKSVIEEKDLVQIADPAAIEAMVDKVLAENPKQLEQYRAGKTKLQGFFAGQVMKASKGK  526

Query  195  ANPKMLNKILLEKL  154
            A+P +LNKIL EKL
Sbjct  527  ASPVLLNKILGEKL  540



>gb|ADE76344.1| unknown [Picea sitchensis]
Length=511

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQDY+D++  SLPELP+ KRRRYE+MGLSMQDV+ L NDS++A FFDA + +GADVK
Sbjct  314  VILTQDYIDALKASLPELPDEKRRRYERMGLSMQDVIILANDSDVATFFDAVLEKGADVK  373

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            +A NW+MGDIAA+LK+EKLSI+EIKLTP EL++LI+ IK  TISGKIGKE+L E++AKGG
Sbjct  374  MAANWIMGDIAAFLKSEKLSISEIKLTPLELADLIALIKDGTISGKIGKEVLVELLAKGG  433

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            +VK +I+EK LVQI DP  IE MVDK++A+NPKQLEQYRGGKTKLQG+F GQVMK SKGK
Sbjct  434  SVKALIEEKGLVQISDPDVIESMVDKILAENPKQLEQYRGGKTKLQGFFVGQVMKASKGK  493

Query  195  ANPKMLNKILLEKLNAKR  142
            ANP +L+KILL+KLNAK+
Sbjct  494  ANPTLLSKILLDKLNAKQ  511



>dbj|BAJ94910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T +Y+D + NS+PELPE KRRRYE MGLSMQDV+FL ND  +A FFD+T+ RGAD K
Sbjct  357  VVLTSEYIDEIRNSMPELPEAKRRRYENMGLSMQDVIFLANDDIVAHFFDSTLERGADAK  416

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDI AYLKNEKLSI+EIKLTP ELSELI+ IK  TISGKIGKEIL E++ KGG
Sbjct  417  LAANWIMGDITAYLKNEKLSIDEIKLTPLELSELIAFIKNGTISGKIGKEILVELITKGG  476

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVDKV+A+NPKQLEQYR GKTKLQG+FAGQVMK SKGK
Sbjct  477  TVKSVIEEKDLVQIADPAAIEAMVDKVLAENPKQLEQYRAGKTKLQGFFAGQVMKASKGK  536

Query  195  ANPKMLNKILLEKL  154
            A+P +LNKIL EKL
Sbjct  537  ASPVLLNKILGEKL  550



>ref|XP_006854350.1| hypothetical protein AMTR_s00039p00150510 [Amborella trichopoda]
 gb|ERN15817.1| hypothetical protein AMTR_s00039p00150510 [Amborella trichopoda]
Length=548

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T++YV+S+ + LPELPEMKRRRYEKMGLSMQDVLFL +D N+A+FFDA +G GADVK
Sbjct  351  VILTEEYVNSLGSGLPELPEMKRRRYEKMGLSMQDVLFLADDFNVADFFDAAVGHGADVK  410

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+M DIAAYLKNEKLSI EIKLTP EL+ELI++IK  TI+GKIGKEILFE++A GG
Sbjct  411  LAANWVMSDIAAYLKNEKLSITEIKLTPMELAELIASIKNGTINGKIGKEILFELIANGG  470

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TV  MI+EKDLVQI+DP  IE M+DK +A+NPKQLEQYRGGKTKLQG+FAGQVMK SKGK
Sbjct  471  TVGAMIEEKDLVQIMDPNVIEAMIDKALAENPKQLEQYRGGKTKLQGFFAGQVMKVSKGK  530

Query  195  ANP  187
            ANP
Sbjct  531  ANP  533



>gb|EMS55713.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Triticum 
urartu]
Length=547

 Score =   287 bits (735),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T +Y+D + N +PELPE KRRRYE MGLSMQDV+FL ND  +A FFD+T+  GAD K
Sbjct  350  VVLTSEYIDEIRNLMPELPEAKRRRYENMGLSMQDVIFLANDDKVAHFFDSTLEHGADAK  409

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDI AYLK+EKLSI+E KLTP ELSE+I+ IK  TISGKI KEI+ +++AKGG
Sbjct  410  LAANWIMGDITAYLKDEKLSIDESKLTPLELSEMIAYIKNGTISGKIAKEIVVDLIAKGG  469

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVD+V+ADNPKQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  470  TVKSVIEEKDLVQITDPAAIEAMVDQVLADNPKQLEQYRAGKTKLQGYFAGQVMKASKGK  529

Query  195  ANPKMLNKILLEKL  154
            A+P +LNKIL EKL
Sbjct  530  ASPVLLNKILGEKL  543



>dbj|BAJ96366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   288 bits (737),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 162/194 (84%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T +Y+D + N +PELPE KRRRYE MGLSMQDV+FL ND  +A FFD+T+  GAD K
Sbjct  404  VVLTSEYIDEIRNLMPELPEAKRRRYENMGLSMQDVIFLANDDKVAHFFDSTLEHGADAK  463

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDI AYLK+EKLSI+E KLTP ELSE+I+ IK  TISGKI KEI+ +++AKGG
Sbjct  464  LAANWIMGDITAYLKDEKLSIDESKLTPLELSEMIAYIKNGTISGKIAKEIVVDLIAKGG  523

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVD+V+ADNPKQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  524  TVKSVIEEKDLVQIADPAAIEAMVDQVLADNPKQLEQYRAGKTKLQGYFAGQVMKASKGK  583

Query  195  ANPKMLNKILLEKL  154
            A+P +LNKIL EKL
Sbjct  584  ASPVLLNKILGEKL  597



>gb|EMT25645.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Aegilops 
tauschii]
Length=550

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T +Y+D + N +PELPE KRRRYE +GLSMQDV+FL ND  +A FFD+T+  G D K
Sbjct  353  VVLTGEYIDEIRNLMPELPEAKRRRYENIGLSMQDVIFLANDDKVAHFFDSTLEHGTDAK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDI AYLK+EKLSI+E KLTP ELSE+I+ IK  TISGKI KEI+ +++AKGG
Sbjct  413  LAANWIMGDITAYLKDEKLSIDESKLTPLELSEMIAYIKNGTISGKIAKEIVVDLIAKGG  472

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            TVK +I+EKDLVQI DP  IE MVD+V+ DNPKQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  473  TVKSVIEEKDLVQIADPAAIEAMVDQVLTDNPKQLEQYRAGKTKLQGYFAGQVMKASKGK  532

Query  195  ANPKMLNKILLEKL  154
            A+P +LNKIL EKL
Sbjct  533  ASPVLLNKILGEKL  546



>ref|XP_010110683.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Morus notabilis]
 gb|EXC27687.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Morus notabilis]
Length=530

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 157/196 (80%), Gaps = 23/196 (12%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT+TQ+YVD++ +SLPELPEMKRRRYE MGLSMQDVLFL +D ++AEFFDATI  GA+VK
Sbjct  356  VTLTQEYVDNIRSSLPELPEMKRRRYENMGLSMQDVLFLAHDMDVAEFFDATIANGAEVK  415

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            L  NW+M DIAAYLKNEKL+I+E+KLTPQELSELI++IKG TISGKIGK           
Sbjct  416  LTANWIMSDIAAYLKNEKLTISEVKLTPQELSELIASIKGGTISGKIGK-----------  464

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
                        QI DP EIEKMVDKV+++NPKQLEQY GGKTKLQG+F GQVMK SKGK
Sbjct  465  ------------QIADPVEIEKMVDKVLSENPKQLEQYCGGKTKLQGFFTGQVMKLSKGK  512

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKILLEKLNA
Sbjct  513  ANPGLLNKILLEKLNA  528



>ref|XP_002311699.2| GLU-TRNA AMIDOTRANSFERASE SUBUNIT B family protein [Populus trichocarpa]
 gb|EEE89066.2| GLU-TRNA AMIDOTRANSFERASE SUBUNIT B family protein [Populus trichocarpa]
Length=538

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 158/196 (81%), Gaps = 23/196 (12%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++YV+S+ NSLPELPEMKRRRYE MGLSMQDVLFL ND N+A+FFDATI +GADVK
Sbjct  364  VILKKEYVNSIQNSLPELPEMKRRRYENMGLSMQDVLFLANDINVAKFFDATIAKGADVK  423

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LATNW+MGDIAAY+KNEK+SIN+IKL P+EL+ELI++IKG TISGKIGKE          
Sbjct  424  LATNWIMGDIAAYMKNEKVSINDIKLIPRELAELIASIKGGTISGKIGKE----------  473

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
                         IVDP EIEKMVDKV+++NP QLEQYR GKTK+QGYFAGQVMK SKGK
Sbjct  474  -------------IVDPAEIEKMVDKVLSENPNQLEQYRAGKTKIQGYFAGQVMKLSKGK  520

Query  195  ANPKMLNKILLEKLNA  148
            ANP +LNKIL +KLNA
Sbjct  521  ANPGLLNKILQQKLNA  536



>ref|XP_009797353.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=480

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  639  MQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAYLKNEKLSINEIKLTPQELS  460
            +Q+       + IAEFFDATI  GADVKLA NW+MGDIAAY+KNEK++INEIKLTPQEL 
Sbjct  315  VQETRLWEEGAQIAEFFDATIAAGADVKLAANWIMGDIAAYMKNEKVTINEIKLTPQELG  374

Query  459  ELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNP  280
            ELI++IK  TISGKIGKEILFE+MAKGGTVKG+IKEKDLVQIVD  EIEK+VDKVIADNP
Sbjct  375  ELIASIKDGTISGKIGKEILFEVMAKGGTVKGLIKEKDLVQIVDTAEIEKLVDKVIADNP  434

Query  279  KQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEKLNA  148
             QLEQYRGGKTKLQG+FAGQVMKESKGKANPK+LNKILLEKLNA
Sbjct  435  MQLEQYRGGKTKLQGFFAGQVMKESKGKANPKLLNKILLEKLNA  478



>gb|AAF79700.1|AC020889_8 T1N15.14 [Arabidopsis thaliana]
Length=618

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 155/197 (79%), Gaps = 23/197 (12%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+FDA IG+GA+VK
Sbjct  444  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFDAVIGKGAEVK  503

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+M DIAAYLKNEKLSIN+IKLTPQEL+ELI+AIK  TISGKIGKE          
Sbjct  504  LAANWIMSDIAAYLKNEKLSINDIKLTPQELAELIAAIKDGTISGKIGKE----------  553

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
                         I DP EIEKMV +V+++NPKQLEQYR GKTKLQGYFAGQVMK SKGK
Sbjct  554  -------------ITDPAEIEKMVIQVVSENPKQLEQYRSGKTKLQGYFAGQVMKMSKGK  600

Query  195  ANPKMLNKILLEKLNAK  145
            ANP +LNKILLEKLNAK
Sbjct  601  ANPGLLNKILLEKLNAK  617



>ref|XP_010936076.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
isoform X2 [Elaeis guineensis]
Length=546

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V + ++Y+D +  SLPELPE KRRRYEK+GLSMQDVLFL ND+N+A+FFDA +  GAD K
Sbjct  355  VVLVKEYIDEIRQSLPELPEAKRRRYEKLGLSMQDVLFLANDNNVADFFDAAVENGADAK  414

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAYLKNE+ +I+EIKLTP+ELSELI+ IK  TISGKIGKEILFE+++KGG
Sbjct  415  LAANWIMGDIAAYLKNERRTIDEIKLTPKELSELIAFIKNGTISGKIGKEILFELISKGG  474

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQV  217
            TVK +I+EKDLVQIVDP  I  +VDKV+A NPKQL+QYRGGKTKLQG+FAGQV
Sbjct  475  TVKSLIEEKDLVQIVDPATIGALVDKVLAANPKQLQQYRGGKTKLQGFFAGQV  527



>gb|KHN16523.1| Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 
[Glycine soja]
Length=434

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  609  SNIAEFFDATIGRGADVKLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGET  430
            + IAEFFDAT+ +GAD KL  NW+M DIAA++KNEKL+INEIKLTP+ELSELI++IKG T
Sbjct  279  TKIAEFFDATLAKGADSKLVANWIMSDIAAFMKNEKLTINEIKLTPEELSELIASIKGGT  338

Query  429  ISGKIGKEILFEIMAKGGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGK  250
            ISGKIGKEILFE++AKGGTVK +I++KDLVQI DP EIEKMVDKVI +NPKQ+EQYRGGK
Sbjct  339  ISGKIGKEILFELLAKGGTVKELIQKKDLVQIADPVEIEKMVDKVIVENPKQVEQYRGGK  398

Query  249  TKLQGYFAGQVMKESKGKANPKMLNKILLEKLNAK  145
            TKLQG+FAGQVMK SKGKANP +LNKILLEKLN+K
Sbjct  399  TKLQGFFAGQVMKLSKGKANPGLLNKILLEKLNSK  433



>ref|XP_001782927.1| predicted protein [Physcomitrella patens]
 sp|A9TWD9.1|GATB_PHYPA RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Physcomitrella patens]
 gb|EDQ52278.1| predicted protein [Physcomitrella patens]
Length=562

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V ++Q+Y+D+   +LPELP+ KRRRYE +GLSMQD L L NDS++A FFD  + +G +VK
Sbjct  367  VVLSQEYIDTTRANLPELPDAKRRRYESLGLSMQDTLVLANDSDVAAFFDEVLEKGTEVK  426

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A NW+MGD+AA+LK+ KL+I E KLTP  L+ELI  IK  TISGKI KEIL E++ KGG
Sbjct  427  QAANWIMGDVAAHLKSIKLTITEAKLTPASLAELIGLIKDGTISGKIAKEILPELIEKGG  486

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            + KG ++ K L QI DP  IE MVDK++ADN KQ+E YRGGKTKLQG+F GQ MK S G+
Sbjct  487  SAKGAVESKGLSQISDPAVIESMVDKILADNVKQVEAYRGGKTKLQGFFVGQAMKASGGR  546

Query  195  ANPKMLNKILLEKLN  151
             NP +LNKIL+ KLN
Sbjct  547  VNPGLLNKILMAKLN  561



>gb|KCW63541.1| hypothetical protein EUGRSUZ_G01176 [Eucalyptus grandis]
Length=476

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+DYVDS+CN LPELPE+KRRRYEKMGLSMQD+LFL ND N+AEFFDATI +GADVK
Sbjct  341  VILTKDYVDSICNCLPELPEVKRRRYEKMGLSMQDILFLANDVNVAEFFDATIAKGADVK  400

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI++IKLTPQEL+ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  401  LAANWIMGDIAAYMKNEKLSIDDIKLTPQELAELIASIKGGTISGKIGKEILFELMAKGG  460

Query  375  TVKGMIKEKDLVQ  337
            TVKGMI+EKDLVQ
Sbjct  461  TVKGMIEEKDLVQ  473



>emb|CBI23733.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +T+DYV S+ +SLPELPE+KRRRYEKMGLSMQDVLFL ND N+A FFDATIG+GADVK
Sbjct  161  VILTEDYVGSIRSSLPELPELKRRRYEKMGLSMQDVLFLANDVNVAGFFDATIGKGADVK  220

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSINEIKLTPQEL+ELI++IKG TISGKIGKEILFE++AKGG
Sbjct  221  LAANWIMGDIAAYMKNEKLSINEIKLTPQELAELIASIKGGTISGKIGKEILFELIAKGG  280

Query  375  TVKGMIKEKDLVQ  337
            TVKG+I+EKDLVQ
Sbjct  281  TVKGLIEEKDLVQ  293



>ref|XP_002972781.1| hypothetical protein SELMODRAFT_441971 [Selaginella moellendorffii]
 gb|EFJ26002.1| hypothetical protein SELMODRAFT_441971 [Selaginella moellendorffii]
Length=528

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            + + Q+ VDS+  +LPELP   RRRYE +GLSMQDVL L +D N++E+FD+T+ +GAD+K
Sbjct  332  LVLKQEQVDSINEALPELPNETRRRYEALGLSMQDVLVLADDKNVSEYFDSTLEQGADMK  391

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            +A NW+MGDI AYLK EKLSI+++K++P  L+EL++ IK  TISGKIGKEIL E++  GG
Sbjct  392  MAANWIMGDITAYLKTEKLSISDVKISPSVLAELVTLIKDGTISGKIGKEILPELIRNGG  451

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            T K +I+ K L QI D  EI  +VDKV+ +NPKQLE ++ GKTKLQG+F GQVM+ + G+
Sbjct  452  TAKEVIEAKGLTQISDEAEIASLVDKVLLENPKQLEAFKKGKTKLQGFFEGQVMRSTNGR  511

Query  195  ANPKMLNKILLEKL  154
             NP ++ KI+ +KL
Sbjct  512  VNPILMKKIVAQKL  525



>emb|CDO99325.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT++++YVD + +SLPELPE+KRRRYE MGLSMQDVLFL ND N+AEFFDATI   ADVK
Sbjct  102  VTLSEEYVDGIRSSLPELPEIKRRRYENMGLSMQDVLFLANDINVAEFFDATIANAADVK  161

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI+EIKLTP EL ELI++IKG TISGKIGKEILFE+MAKGG
Sbjct  162  LAANWIMGDIAAYMKNEKLSISEIKLTPLELGELIASIKGGTISGKIGKEILFELMAKGG  221

Query  375  TVKGMIKEKDLVQ  337
            TV+G+IKEKDLVQ
Sbjct  222  TVQGLIKEKDLVQ  234



>gb|KJB38439.1| hypothetical protein B456_006G255000 [Gossypium raimondii]
Length=502

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+ NSLPELPE KRRRYEKMGLSMQDVLFL ND N+AE+FDAT+  GAD+K
Sbjct  368  VILTQEYVDSISNSLPELPEAKRRRYEKMGLSMQDVLFLANDMNVAEYFDATLSSGADIK  427

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSIN+IKLTPQEL+ELI++IK  TISGKIGKEIL E++AKGG
Sbjct  428  LAANWIMGDIAAYMKNEKLSINDIKLTPQELAELIASIKSGTISGKIGKEILSELLAKGG  487

Query  375  TVKGMIKEKDLVQ  337
            TVKG+I+EKDL+Q
Sbjct  488  TVKGLIEEKDLIQ  500



>ref|NP_973991.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 gb|AEE32308.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
Length=488

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+FDA IG+GA+VK
Sbjct  353  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFDAVIGKGAEVK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+M DIAAYLKNEKLSIN+IKLTPQEL+ELI+AIK  TISGKIGKEILFE++AKGG
Sbjct  413  LAANWIMSDIAAYLKNEKLSINDIKLTPQELAELIAAIKDGTISGKIGKEILFELLAKGG  472

Query  375  TVKGMIKEKDLVQ  337
            TVKGMIK KDLVQ
Sbjct  473  TVKGMIKAKDLVQ  485



>ref|WP_015185138.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase 
subunit B [Microcoleus sp. PCC 7113]
 gb|AFZ21005.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Microcoleus sp. PCC 7113]
Length=494

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 147/196 (75%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++++ ++   + LPELP  KR RYE ++GLS  D   LT+D  +AE+F+A +  GA+ 
Sbjct  298  IEVSKEQLEQWGSELPELPAQKRHRYESELGLSAYDARVLTDDRQVAEYFEAAVATGANA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+MGDIAAYL NEK++I EI L P  L+ELI+ I+  TISGKI KEIL E++A+G
Sbjct  358  KQTANWVMGDIAAYLNNEKVAIAEIALKPTTLAELINLIEDGTISGKIAKEILPELLAQG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L+QI D  ++E ++D+VIA NPK+LEQYR GKTKLQG+F GQVMK+S G
Sbjct  418  GSAKELVERKGLIQISDTSQLEAIIDEVIAANPKELEQYRKGKTKLQGFFVGQVMKKSSG  477

Query  198  KANPKMLNKILLEKLN  151
            +A+PK+ N+IL +KLN
Sbjct  478  RADPKLTNQILGKKLN  493



>ref|WP_006618596.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Arthrospira 
platensis]
 dbj|BAI90533.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Arthrospira platensis 
NIES-39]
 gb|KDR55636.1| glutamyl-tRNA amidotransferase [Arthrospira platensis str. Paraca]
Length=494

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE  +GLS  D   LT+D  +AE+F+AT+  GAD K A NW+MGDI 
Sbjct  310  SELPELPAQKRHRYETDLGLSAYDTRVLTDDRTVAEYFEATVAAGADTKQAANWLMGDIT  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYLKNEKL+IN+I L P EL+ELI+ I   TISGKI K+IL E++ KGG+ K ++++K L
Sbjct  370  AYLKNEKLAINDIPLKPAELAELIALIGDNTISGKIAKDILPELLTKGGSPKQLVEKKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
            +QI D  E+E ++D+VIA +P+++E+++ GKTKL+G+F GQVMK+++G+A+P++ NK++ 
Sbjct  430  IQISDTGELEAIIDEVIASHPQEVEKFKAGKTKLKGFFVGQVMKKTQGRADPQLTNKLIS  489

Query  162  EKL  154
            +KL
Sbjct  490  QKL  492



>ref|WP_015190648.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gloeocapsa 
sp. PCC 7428]
 gb|AFZ32781.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Gloeocapsa 
sp. PCC 7428]
Length=494

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 142/196 (72%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +T + ++   + LPELP  KR RYE ++GLS  D   LT+D  +AE+F+A I  GA  
Sbjct  298  IEVTNEQLEKWRSELPELPAQKRHRYETELGLSPYDARVLTDDRTVAEYFEAVIASGASA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDIAAYL   KLSINEI L P+ L+EL++ I+  TISGKI K+IL E++ KG
Sbjct  358  KQAANWIMGDIAAYLNKNKLSINEIALKPEALAELVTLIEDNTISGKIAKDILPELLTKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++  +L QI D   +E+ +D+VIA NPK+LEQYR GKTKL G+F G+V+KE+ G
Sbjct  418  GSPKAIVERDNLGQISDSSALEQAIDQVIAANPKELEQYRNGKTKLLGFFVGKVLKETGG  477

Query  198  KANPKMLNKILLEKLN  151
            +A+PK+ N++L +KLN
Sbjct  478  RADPKLTNQLLAKKLN  493



>ref|WP_015157951.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Chamaesiphon minutus]
 gb|AFY91757.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Chamaesiphon minutus PCC 6605]
Length=494

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 137/183 (75%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RY E++GLS  D   LT+D ++AE+ +ATI  GAD+K A NW+MGDI AY
Sbjct  312  LPELPVEKRHRYQEELGLSPYDTRVLTDDRSVAEYLEATIAAGADIKQAANWVMGDITAY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LKN+K+SI +I LTP  L+ELI  I   TI+GKI KEIL ++   GG+V+ +I+ K L  
Sbjct  372  LKNQKVSIRDIPLTPTVLAELIGLIDKGTINGKIAKEILPDLFEHGGSVQALIESKGLTS  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP E+EK+VD+++A NPK+LEQY+ GKTKL G+F GQ+MK++ G+A PK+ N+IL +K
Sbjct  432  ISDPAELEKIVDELLAANPKELEQYKAGKTKLLGFFVGQLMKQTGGRAEPKLANQILAKK  491

Query  156  LNA  148
            LN 
Sbjct  492  LNG  494



>ref|WP_011058226.1| glutamyl-tRNA amidotransferase subunit B [Thermosynechococcus 
elongatus]
 ref|NP_683184.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Thermosynechococcus 
elongatus BP-1]
 sp|Q8DGC4.1|GATB_THEEB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC09946.1| Glu-tRNA(Gln) amidotransferase subunit B [Thermosynechococcus 
elongatus BP-1]
Length=500

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 142/196 (72%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +T + + +    LPELP  KRRRYE + GL  QD   LT++  +AE+F+AT+  GA  
Sbjct  302  IEVTAEQLAAWRAELPELPAQKRRRYESEWGLPPQDARVLTDERAVAEYFEATVVAGAPP  361

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+MGDI AYLK +KL+I  + L P EL+ELI  I+  TISGKI KEIL E++++G
Sbjct  362  KLAANWIMGDITAYLKEQKLAIEALPLKPAELAELIQLIEAGTISGKIAKEILPELLSQG  421

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L QI D   +E M+D+V+A +P +LEQYR GKTKLQG+F GQ+MK+S G
Sbjct  422  GSPKALVERKGLSQISDVATLEAMIDEVLAAHPNELEQYRAGKTKLQGFFVGQLMKKSGG  481

Query  198  KANPKMLNKILLEKLN  151
            +A+PK+ N++L +KLN
Sbjct  482  RADPKLANQLLAQKLN  497



>ref|WP_006621670.1| MULTISPECIES: glutamyl-tRNA amidotransferase subunit B [Arthrospira]
 emb|CCE20446.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT 
subunit B) [Arthrospira sp. PCC 8005]
 gb|EKD10541.1| putative aspartyl/glutamyl-tRNA amidotransferase subunit B [Arthrospira 
platensis C1]
 emb|CDM92993.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT 
subunit B) [Arthrospira sp. PCC 8005]
Length=494

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE  +GLS  D   LT+D  +A++F+AT+  GAD K A NW+MGDI 
Sbjct  310  SELPELPAQKRHRYETDLGLSPYDTRVLTDDRTVAQYFEATVAAGADTKQAANWLMGDIT  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYLKNEKL+I +I L P EL+ELI+ I   TISGKI K+IL E++AKGG+ K M+++K L
Sbjct  370  AYLKNEKLAITDIPLKPAELAELINLIGENTISGKIAKDILPELLAKGGSPKQMVEKKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
            +QI D  E+E ++D+VIA +P+++E+++ GKTKL+G+F GQVMK+++G+A+P++ NK++ 
Sbjct  430  IQISDTGELEAIIDEVIASHPQEVEKFKAGKTKLKGFFVGQVMKKTQGRADPQLTNKLIS  489

Query  162  EKL  154
            +KL
Sbjct  490  QKL  492



>ref|WP_036018373.1| glutamyl-tRNA amidotransferase [Leptolyngbya sp. PCC 7375]
Length=496

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 145/197 (74%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +++  +++   +LPELP  KR RYE ++GLS  D   LT+DS+IA++F+ TI  GAD 
Sbjct  300  IEVSKKQLETWKAALPELPADKRHRYETELGLSAYDTRVLTDDSSIADYFERTIATGADA  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K++ NW+MGDIA YL  EKLSI +I LTP+ L E+++ I   TIS KIGK++L  ++ +G
Sbjct  360  KVSANWVMGDIAGYLNAEKLSIGDIGLTPEGLGEMVTLISSGTISNKIGKDLLPTLLKEG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++EK LVQI DP  IE ++D+V+ADNP +L +YR GK KLQG+F GQVMK S G
Sbjct  420  GSPKAIVEEKGLVQISDPAAIEAIIDEVMADNPDELAKYRAGKKKLQGFFVGQVMKRSGG  479

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KLN 
Sbjct  480  RADPKLTNQLLGKKLNG  496



>gb|EKV00390.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Leptolyngbya sp. PCC 7375]
Length=523

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 138/184 (75%), Gaps = 1/184 (1%)
 Frame = -3

Query  696  SLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAA  520
            +LPELP  KR RYE ++GLS  D   LT+DS+IA++F+ TI  GAD K++ NW+MGDIA 
Sbjct  340  ALPELPADKRHRYETELGLSAYDTRVLTDDSSIADYFERTIATGADAKVSANWVMGDIAG  399

Query  519  YLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            YL  EKLSI +I LTP+ L E+++ I   TIS KIGK++L  ++ +GG+ K +++EK LV
Sbjct  400  YLNAEKLSIGDIGLTPEGLGEMVTLISSGTISNKIGKDLLPTLLKEGGSPKAIVEEKGLV  459

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLE  160
            QI DP  IE ++D+V+ADNP +L +YR GK KLQG+F GQVMK S G+A+PK+ N++L +
Sbjct  460  QISDPAAIEAIIDEVMADNPDELAKYRAGKKKLQGFFVGQVMKRSGGRADPKLTNQLLGK  519

Query  159  KLNA  148
            KLN 
Sbjct  520  KLNG  523



>ref|WP_023076379.1| aspartyl glutamyl-trna(asn gln) amidotransferase subunit b [Leptolyngbya 
sp. Heron Island J]
 gb|ESA32496.1| aspartyl glutamyl-trna(asn gln) amidotransferase subunit b [Leptolyngbya 
sp. Heron Island J]
Length=496

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 143/197 (73%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +++  +++  + LPELP  KR RYE ++GLS  D   LT+D +IA++F+ TI  GAD 
Sbjct  300  IEVSKKQLETWKSELPELPADKRHRYETELGLSAYDTRVLTDDRSIADYFEHTIATGADA  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K + NW+MGDI+ YL  EKLSIN+I LTP+ L E+++ I   TIS KIGK++L  ++  G
Sbjct  360  KTSANWVMGDISGYLNAEKLSINDIALTPEGLGEMVNLITSGTISNKIGKDLLPTLLKDG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++EK LVQI DP  IE ++D+V+ADNP +L +YR GK KLQG+F GQVMK S G
Sbjct  420  GSPKAIVEEKGLVQISDPAAIEAIIDQVMADNPDELAKYRAGKKKLQGFFVGQVMKRSSG  479

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KLN 
Sbjct  480  RADPKLTNQLLGKKLNG  496



>ref|WP_009785353.1| glutamyl-tRNA amidotransferase subunit B [Lyngbya sp. PCC 8106]
 gb|EAW36089.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Lyngbya sp. 
PCC 8106]
Length=494

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 147/197 (75%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D +++    LPELP  KR RYE ++GLS  D   LT+D +I+E+F+  +  GAD 
Sbjct  298  IEVSPDQLEAWKTELPELPAQKRHRYETELGLSPYDTRVLTDDCSISEYFETAVQAGADT  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDI AYLKNEKL+I+EI L P  L+ELI  I   TISGKI K+IL E++ KG
Sbjct  358  KQAVNWVMGDITAYLKNEKLAISEIALKPDGLAELIGLIDAGTISGKIAKDILPELLVKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
             + K ++++K L+QI D  E+E ++D+V+AD+P ++E+Y+ GKTKL+G+F GQ+MK+++G
Sbjct  418  DSPKKLVEKKGLIQISDTGELESIIDEVLADHPSEVEKYKAGKTKLKGFFVGQIMKKTQG  477

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KLNA
Sbjct  478  RADPKLTNQLLEKKLNA  494



>ref|WP_023064119.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Lyngbya 
aestuarii]
 gb|ERT09619.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Lyngbya 
aestuarii BL J]
Length=494

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 141/183 (77%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE ++GLS  D   LT+D +I+E+F+  +  GAD K A NW+MGDI AY
Sbjct  312  LPELPAQKRHRYETELGLSPYDTRVLTDDCSISEYFETAVQAGADTKQAVNWVMGDITAY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LKNEKL+I+EI L P  L+ELI  I   TISGKI K+IL E++ KG + K ++++K L+Q
Sbjct  372  LKNEKLTISEIALKPDGLAELIGLIDAGTISGKIAKDILPELLVKGDSPKKLVEKKGLIQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D  E+E ++D+V+AD+P ++E+Y+GGKTKL+G+F GQ+MK+++G+A+PK+ N++L ++
Sbjct  432  ISDTGELESIIDEVLADHPSEVEKYKGGKTKLKGFFVGQIMKKTQGRADPKLTNQLLEKR  491

Query  156  LNA  148
            LNA
Sbjct  492  LNA  494



>ref|WP_019506831.1| glutamyl-tRNA amidotransferase subunit B [Pleurocapsa sp. PCC 
7319]
Length=496

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 144/195 (74%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ + +++    LPELP  KR RYE ++GLS  D   LT+D N+AE+F+A I  GAD 
Sbjct  300  IEVSPEQLETWKAELPELPVAKRHRYETELGLSAYDTRVLTDDRNVAEYFEAAIAAGADT  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+MGDIAAY+ +  L I E +L P+ L+ELI  I   TISGKIGKEIL E++ KG
Sbjct  360  KQVANWVMGDIAAYINSNNLKITETELKPEILAELIGLIDKGTISGKIGKEILPELLEKG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++++K L+QI D  EIEK++D+VIA +PK+LEQ+R GKTKL+G+F GQVMK++ G
Sbjct  420  GSAKALVEKKGLIQISDTGEIEKIIDEVIAAHPKELEQFRNGKTKLKGFFVGQVMKKTSG  479

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N++L +KL
Sbjct  480  RADPKLTNQLLGKKL  494



>ref|WP_008177699.1| glutamyl-tRNA amidotransferase subunit B [Moorea producens]
 gb|EGJ35636.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Moorea producens 
3L]
Length=495

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 144/195 (74%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ + ++   + L ELP  KR RYE ++GLS  D   LT+D  +AE+F+ ++   A+ 
Sbjct  298  IEVSTEQLEQWRSELAELPAQKRHRYESELGLSAYDARVLTDDRQVAEYFETSVAANANP  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDIAAYLK EKL+I EI L P  L+ELI+ I  +TISGKI KEIL E++++G
Sbjct  358  KQAANWVMGDIAAYLKTEKLAITEIALKPNTLAELINLIDDDTISGKIAKEILPELLSQG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ + +++ K L++I DP ++  ++D+V+A NPK+LEQYR GKTKLQG+F GQVMK++ G
Sbjct  418  GSARELVERKGLIKISDPDQLSTIIDEVLAANPKKLEQYRNGKTKLQGFFVGQVMKKTSG  477

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N+IL +KL
Sbjct  478  RADPKLTNQILGKKL  492



>ref|WP_006667920.1| glutamyl-tRNA amidotransferase subunit B [Arthrospira maxima]
 gb|EDZ97081.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Arthrospira maxima 
CS-328]
Length=494

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 141/183 (77%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE  +GLS  D   LT+D  +A++F+AT+  GAD K A NW+MGDI 
Sbjct  310  SELPELPAQKRHRYETDLGLSPYDTRVLTDDRTVAQYFEATVAAGADTKQAANWLMGDIT  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYLKNEKL+I +I L P EL+ELI+ I   TISGKI K+IL E++AKGG+ K M+++K L
Sbjct  370  AYLKNEKLAITDIPLKPAELAELINLIGENTISGKIAKDILPELLAKGGSPKQMVEKKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
            +QI D  E+E ++D+VIA + +++E+++ GKTKL+G+F GQVMK+++G+A+P++ NK++ 
Sbjct  430  IQISDTGELEAIIDEVIASHSQEVEKFKAGKTKLKGFFVGQVMKKTQGRADPQLTNKLIS  489

Query  162  EKL  154
            +KL
Sbjct  490  QKL  492



>ref|WP_012161547.1| glutamyl-tRNA amidotransferase subunit B [Acaryochloris marina]
 sp|B0BZQ6.1|GATB_ACAM1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Acaryochloris marina 
MBIC11017]
 gb|ABW25982.1| aspartyl/glutamyl-tRNA amidotransferase B subunit [Acaryochloris 
marina MBIC11017]
Length=494

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 133/183 (73%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE+ +GLS  D   LT+D  I ++F+AT+  GA  K A NW+MGDI 
Sbjct  310  SELPELPAAKRHRYEEEIGLSPYDTRILTDDHAITQYFEATLKAGASAKQAANWLMGDIT  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
             YL NE LSI +I LTP+ L+ELI  I+  TISGKI KE+L E++ KGG+ K ++K+K L
Sbjct  370  GYLNNESLSITDIALTPEALAELIELIEANTISGKIAKELLPELLTKGGSPKKLVKKKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
             QI D   +E ++D+V+A +P++LEQYR GKTKLQG+F GQVMK + G+A+PK  N++L 
Sbjct  430  TQISDAATLESLIDEVLAAHPQELEQYRNGKTKLQGFFMGQVMKRTSGRADPKATNQMLA  489

Query  162  EKL  154
            +KL
Sbjct  490  KKL  492



>ref|WP_027248777.1| glutamyl-tRNA amidotransferase [Planktothrix agardhii]
Length=494

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 146/195 (75%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ + + +  + LPELP  KR RYE ++GLS  D   LT+D  I+E+F+ATI  GA++
Sbjct  298  IQVSAEQLKTWKSQLPELPVEKRHRYESELGLSPYDTRILTDDHPISEYFEATIAAGANI  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW++GDI A+LKNEK S+ E+ L P+ L+ELI  I+  TISGKI K++L E++ +G
Sbjct  358  KQAVNWIIGDITAHLKNEKCSVTEVALKPEGLAELIGLIESGTISGKIAKDLLPELLTQG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L+Q+ DP+ + +++D+V+ +NPK+LEQY  GKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKALVEIKGLIQLSDPKALAEIIDQVLVENPKELEQYHAGKTKLQGFFVGQIMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N++L EKL
Sbjct  478  RADPKLTNQLLGEKL  492



>ref|WP_026796286.1| MULTISPECIES: glutamyl-tRNA amidotransferase [Planktothrix]
Length=494

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 146/195 (75%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ + + +  + LPELP  KR RYE ++GLS  D   LT+D  I+E+F+ATI  GA++
Sbjct  298  IQVSAEQLKTWKSQLPELPVEKRHRYESELGLSPYDTRILTDDHPISEYFEATIAAGANI  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW++GDI A+LKNEK S+ E+ L P+ L+ELI  I+  TISGKI K++L E++ +G
Sbjct  358  KQAVNWIIGDITAHLKNEKCSVTEVALKPEGLAELIGLIESGTISGKIAKDLLPELLTQG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L+Q+ DP+ + +++D+V+ +NPK+LEQY  GKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKALVEIKGLIQLSDPKALAEIIDQVLVENPKELEQYHAGKTKLQGFFVGQIMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N++L EKL
Sbjct  478  RADPKLTNQLLGEKL  492



>ref|WP_026785585.1| MULTISPECIES: glutamyl-tRNA amidotransferase [Planktothrix]
Length=494

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 146/195 (75%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ + + +  + LPELP  KR RYE ++GLS  D   LT+D  I+E+F+ATI  GA++
Sbjct  298  IQVSAEQLKTWKSQLPELPVEKRHRYESELGLSPYDTRILTDDHPISEYFEATIAAGANI  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW++GDI A+LKNEK S+ E+ L P+ L+ELI  I+  TISGKI K++L E++ +G
Sbjct  358  KQAVNWIIGDITAHLKNEKCSVTEVALKPEGLAELIGLIESGTISGKIAKDLLPELLTQG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L+Q+ DP+ + +++D+V+ +NPK+LEQY  GKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKALVEIKGLIQLSDPKALAEIIDQVLVENPKELEQYHAGKTKLQGFFVGQIMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N++L EKL
Sbjct  478  RADPKLTNQLLGEKL  492



>ref|WP_015195258.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Stanieria 
cyanosphaera]
 gb|AFZ37604.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Stanieria 
cyanosphaera PCC 7437]
Length=496

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE ++GLS  D   LT+D ++AE+F+  +  GAD K A NW+MGDIAAY
Sbjct  314  LPELPASKRHRYESELGLSAYDARVLTDDRSVAEYFETAVSGGADAKQAANWIMGDIAAY  373

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LKN  L+I EI L P+ L+ELI  I   TISGKIGK+IL E++ KGG+V+ +++ K L+Q
Sbjct  374  LKNSGLNITEIALKPENLAELIQLIDKGTISGKIGKDILPELLTKGGSVQKLVESKGLIQ  433

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D  E+EK++D+VIA NP +L ++R GKT L+G+F GQVMK++ G+A+PK+ N++L +K
Sbjct  434  ISDTGELEKIIDEVIAANPNELAKFRSGKTNLKGFFVGQVMKKTSGRADPKLTNQLLDQK  493

Query  156  L  154
            L
Sbjct  494  L  494



>gb|KEI66792.1| GatB [Planktothrix agardhii NIVA-CYA 126/8]
Length=496

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 146/195 (75%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ + + +  + LPELP  KR RYE ++GLS  D   LT+D  I+E+F+ATI  GA++
Sbjct  300  IQVSAEQLKTWKSQLPELPVEKRHRYESELGLSPYDTRILTDDHPISEYFEATIAAGANI  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW++GDI A+LKNEK S+ E+ L P+ L+ELI  I+  TISGKI K++L E++ +G
Sbjct  360  KQAVNWIIGDITAHLKNEKCSVTEVALKPEGLAELIGLIESGTISGKIAKDLLPELLTQG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L+Q+ DP+ + +++D+V+ +NPK+LEQY  GKTKLQG+F GQ+MK++ G
Sbjct  420  GSPKALVEIKGLIQLSDPKALAEIIDQVLVENPKELEQYHAGKTKLQGFFVGQIMKKTGG  479

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N++L EKL
Sbjct  480  RADPKLTNQLLGEKL  494



>gb|AHB87799.1| aspartyl/glutamyl-tRNA amidotransferase subunit B GatB [Thermosynechococcus 
sp. NK55a]
Length=528

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE + GL  QD   LT++  +AE+F+AT+  GA  KLA NW+MGDI AY
Sbjct  344  LPELPAQKRHRYESEWGLPPQDARVLTDERAVAEYFEATVVAGAPPKLAANWIMGDITAY  403

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK +KL+I  + L P  L+ELI  I+  TISGKI KEIL E++++GG+ K +++ K L Q
Sbjct  404  LKEQKLAIEALPLQPAALAELIQLIEAGTISGKIAKEILPELLSQGGSPKALVERKGLSQ  463

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   +E M+D+V+A +P +LEQYR GKTKLQG+F GQ+MK+S G+A+PK+ N++L +K
Sbjct  464  ISDVATLEAMIDEVLAAHPNELEQYRAGKTKLQGFFVGQLMKKSGGRADPKLANQLLAKK  523

Query  156  LN  151
            LN
Sbjct  524  LN  525



>ref|WP_041429431.1| glutamyl-tRNA amidotransferase [Thermosynechococcus sp. NK55a]
Length=506

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE + GL  QD   LT++  +AE+F+AT+  GA  KLA NW+MGDI AY
Sbjct  322  LPELPAQKRHRYESEWGLPPQDARVLTDERAVAEYFEATVVAGAPPKLAANWIMGDITAY  381

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK +KL+I  + L P  L+ELI  I+  TISGKI KEIL E++++GG+ K +++ K L Q
Sbjct  382  LKEQKLAIEALPLQPAALAELIQLIEAGTISGKIAKEILPELLSQGGSPKALVERKGLSQ  441

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   +E M+D+V+A +P +LEQYR GKTKLQG+F GQ+MK+S G+A+PK+ N++L +K
Sbjct  442  ISDVATLEAMIDEVLAAHPNELEQYRAGKTKLQGFFVGQLMKKSGGRADPKLANQLLAKK  501

Query  156  LN  151
            LN
Sbjct  502  LN  503



>ref|WP_006105433.1| glutamyl-tRNA amidotransferase subunit B [Coleofasciculus chthonoplastes]
 gb|EDX71724.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit subfamily [Coleofasciculus chthonoplastes PCC 7420]
Length=494

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 139/195 (71%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++++ +D   + LPELP  KR  YE K GLS  D   LT D  +AE+F+A +   A+ 
Sbjct  298  IEVSKEQLDQWRSELPELPAEKRHHYEEKFGLSAYDARVLTEDKLVAEYFEAAVTANANP  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+MGDIAAYL  EKL+I EI + P  L+ELI  I+ +TISGKI KEIL E+++KG
Sbjct  358  KQVANWVMGDIAAYLNTEKLAITEIAIKPLVLAELIQLIEDDTISGKIAKEILPELLSKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K + + + L+QI D  ++E ++D VIA NPK+LEQYR GKTKLQG+F GQVMKE+ G
Sbjct  418  GSAKEIAESRGLIQISDVTQLEAIIDDVIAANPKKLEQYRNGKTKLQGFFVGQVMKETNG  477

Query  198  KANPKMLNKILLEKL  154
            +ANPK+ N++L +KL
Sbjct  478  RANPKLTNQLLGKKL  492



>ref|WP_035986170.1| glutamyl-tRNA amidotransferase [Leptolyngbya sp. KIOST-1]
Length=500

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 135/183 (74%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE + GLS  D   L+++  I E+F+AT+  GAD KL +NW+  DIAAY
Sbjct  318  LPELPAQKRTRYESEFGLSPYDARVLSDERAITEYFEATVSAGADPKLTSNWITQDIAAY  377

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L NEKLSI+ + LTP  L+EL+  I+  TIS KIGK++L E++ +GG+ K +++ + L Q
Sbjct  378  LNNEKLSIDALPLTPASLAELVQLIEAGTISNKIGKDLLPELLTQGGSPKALVEARGLSQ  437

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP +IE M+D+V+A +P++LE YRGGK KLQG+F GQ+MK S G+ +PK+ N++L +K
Sbjct  438  ISDPAQIEAMIDEVLAAHPEELEAYRGGKKKLQGFFVGQLMKRSGGRVDPKLSNQLLSQK  497

Query  156  LNA  148
            LN+
Sbjct  498  LNS  500



>ref|WP_017299669.1| glutamyl-tRNA amidotransferase subunit B [Nodosilinea nodulosa]
Length=495

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE+  GLS  D   L+++  I E+F+AT+  GAD KL +NW+  DIAAY
Sbjct  313  LPELPAQKRARYEEDFGLSPYDARVLSDERAITEYFEATVAAGADAKLTSNWITQDIAAY  372

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L NEKLSI+ + LTP  L+EL+  I+  TIS KIGK++L E++ +GG+ K +++ + L Q
Sbjct  373  LNNEKLSIDALPLTPASLAELVQLIEAGTISNKIGKDLLPELLTQGGSPKALVETRGLSQ  432

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP +IE ++D+V+A +P++LE YRGGK KLQG+F GQ+MK S G+ +PK+ N++L +K
Sbjct  433  ISDPAQIEALIDEVLAAHPEELEAYRGGKKKLQGFFVGQLMKRSGGRVDPKLSNQLLSQK  492

Query  156  LN  151
            LN
Sbjct  493  LN  494



>ref|WP_012626901.1| glutamyl-tRNA amidotransferase subunit B [Cyanothece sp. PCC 
7425]
 gb|ACL43810.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. 
PCC 7425]
Length=496

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 141/195 (72%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++++ +D     LPELP  KR RYE ++GLS  D   LT+D  +A +F+AT+ +GA+ 
Sbjct  300  IEVSEEQLDQWQLQLPELPAQKRHRYESELGLSAYDARVLTDDRPVALYFEATVAQGANP  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDI AYLK EKL+I ++ L+P  L+ELI  I+  TIS KI K++L E++A+G
Sbjct  360  KQAANWIMGDITAYLKTEKLAITDLPLSPTGLAELIGLIEAGTISSKIAKDLLPELLAEG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++++K L QI D   +  ++D+V+ D+P++L QYR GKTKLQG+F GQ+MK S G
Sbjct  420  GSPKALVEQKGLTQISDSSALAGLIDQVLQDHPQELAQYRAGKTKLQGFFVGQIMKRSGG  479

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N++L EKL
Sbjct  480  RADPKLTNQLLAEKL  494



>ref|WP_017718972.1| glutamyl-tRNA amidotransferase subunit B [Oscillatoria sp. PCC 
10802]
Length=494

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE ++GLS  D   LT+D  +AE+F+A + +GA  K A NW+MGDIAAY
Sbjct  312  LPELPASKRHRYESELGLSAYDARVLTDDRQVAEYFEAAVAQGAGAKQAANWVMGDIAAY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK  KL I +I LTP  L+ELIS I+  TISGKI K+IL E++AKGG+ + +++ K L+Q
Sbjct  372  LKENKLGIGDIALTPATLTELISLIEAGTISGKIAKDILPELLAKGGSAQELVESKGLIQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   +EK++D+V+A +PK+LEQYR GKTKL G+F GQVMK++ G+A+PK+ N++L  K
Sbjct  432  ISDTGALEKIIDEVLAASPKELEQYRAGKTKLLGFFVGQVMKQTGGRADPKLTNQLLASK  491

Query  156  LN  151
            LN
Sbjct  492  LN  493



>ref|WP_041463524.1| glutamyl-tRNA amidotransferase [Chroococcidiopsis thermalis]
Length=494

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++++ ++     LPELP  KR RYE ++GLS  D   LT++  +AE+F+AT+  GA  
Sbjct  298  IEVSKEQLEKWRAELPELPAQKRHRYESELGLSAYDTRVLTDERAVAEYFEATVAAGASA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDIAAYL + KL+I E+ L P  L+ELI  I+G TISGKI K+IL E++A+G
Sbjct  358  KQAANWIMGDIAAYLNSNKLNITELALKPNTLAELIQLIEGNTISGKIAKDILPELLAQG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L+QI D   IE +V++VIA NPK+LEQYR GKTKL G+F GQV+K++ G
Sbjct  418  GSAKELVERKGLIQISDRSAIEAIVEQVIAANPKELEQYRNGKTKLLGFFVGQVLKQTGG  477

Query  198  KANPKMLNKILLEKLN  151
            +A+PK+ N++L EKLN
Sbjct  478  RADPKLTNQLLAEKLN  493



>ref|WP_009630311.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Synechocystis sp. PCC 7509]
Length=494

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 134/185 (72%), Gaps = 1/185 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE  M LS  D   LT++  +AE+F++ I  GA+ K A NW+MGDIA
Sbjct  310  SQLPELPAAKRHRYESDMQLSAYDARVLTDERAVAEYFESAINAGANAKFAANWIMGDIA  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
             YL   KLSI EI L P  L+ELI  I+  TISGKI K+IL E++ KGG+ K +++ K L
Sbjct  370  GYLNQNKLSITEIALLPTTLAELIGLIESGTISGKIAKDILPELLTKGGSAKELVESKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
            +QI D  E+E ++++V+A NPK+LEQYR GKTKL G+F GQV+K++ G+A+PK+ N+++ 
Sbjct  430  IQISDTGELEAIIEQVVAANPKELEQYRNGKTKLLGFFVGQVIKQTGGRADPKVTNQLMA  489

Query  162  EKLNA  148
            +KLN+
Sbjct  490  KKLNS  494



>ref|WP_008312219.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Leptolyngbya sp. PCC 6406]
Length=494

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 131/181 (72%), Gaps = 0/181 (0%)
 Frame = -3

Query  693  LPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAYL  514
            LPELP  KR  YE+MGLS  D   L +D  + E+F++ I  GAD KLATNW+  DIAAYL
Sbjct  313  LPELPAQKRAHYEEMGLSAYDARVLADDRTVTEYFESAIAAGADAKLATNWITQDIAAYL  372

Query  513  KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQI  334
              EKL+I +I LTP+ L+E++  I   TIS KI K++L E++ +GG+   +I+E+ L QI
Sbjct  373  NAEKLAITDIALTPESLAEMVKLIDAGTISSKIAKDLLPELLTQGGSPNAIIEERGLSQI  432

Query  333  VDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEKL  154
             DP +IE ++D+V+A +P +L +YR GK KLQG+F GQVM+ ++G+ +PK+ N++L++KL
Sbjct  433  SDPAQIEAIIDEVMAAHPDELAKYRAGKKKLQGFFVGQVMQRTQGRVDPKLTNQLLVKKL  492

Query  153  N  151
            N
Sbjct  493  N  493



>ref|WP_039715161.1| glutamyl-tRNA amidotransferase [Scytonema millei]
 gb|KIF17605.1| glutamyl-tRNA amidotransferase [Scytonema millei VB511283]
Length=494

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 137/183 (75%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE ++GLS  D   LT++  ++E+F+AT+  GA  K A NW+MGDIAAY
Sbjct  312  LPELPAQKRHRYESELGLSAYDTRVLTDERAVSEYFEATVAAGASAKQAANWIMGDIAAY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L + KLSI EI L P+ L+ELI  I+G TISGKI K+IL E++ +GG+ K +++ K L+Q
Sbjct  372  LNSNKLSIGEIALKPKTLAELIQLIEGNTISGKIAKDILPELLTQGGSAKELVERKGLIQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   IE +V++VIA NPK+LEQYR GKTKL G+F GQV+K++ G+A+PK+ N++L EK
Sbjct  432  ISDRSAIEAIVEQVIAANPKELEQYRNGKTKLLGFFVGQVLKQTGGRADPKLTNQLLAEK  491

Query  156  LNA  148
            LN 
Sbjct  492  LNG  494



>ref|WP_011613215.1| glutamyl-tRNA amidotransferase subunit B [Trichodesmium erythraeum]
 sp|Q10XY9.1|GATB_TRIEI RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Trichodesmium erythraeum 
IMS101]
 gb|ABG52885.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Trichodesmium 
erythraeum IMS101]
Length=494

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 145/195 (74%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++   +D+    LPELP  KR  YE K+GLS  D   LT+D N+A++F+A +  G + 
Sbjct  298  IEVSTQQLDTWKAELPELPAQKRYLYESKLGLSAYDTRVLTDDFNVAKYFEAAVAAGGNS  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+MGDI A+LKNEK+SIN+I L P  L+EL++ I   TISGKI K+IL E+++KG
Sbjct  358  KQVANWVMGDITAFLKNEKISINDITLKPDNLAELVTIIDDGTISGKIAKDILPELLSKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++++K L+QI D + IE ++D+V+A +P++L +YRGGKTKL+G+F GQVMK+++G
Sbjct  418  GSPKELVEKKGLIQISDIKAIEAIIDEVLAAHPEELAKYRGGKTKLKGFFVGQVMKKTQG  477

Query  198  KANPKMLNKILLEKL  154
            +A+PKM N+++ +KL
Sbjct  478  RADPKMTNQLISKKL  492



>ref|WP_017287840.1| glutamyl-tRNA amidotransferase subunit B [Leptolyngbya boryana]
Length=503

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 135/184 (73%), Gaps = 1/184 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE ++GLS  D   LT D  IA++F+A I   A+ KLA NW+MGDI+
Sbjct  318  SQLPELPNQKRHRYEDELGLSAYDARILTEDKAIADYFEAAIAAKANPKLAANWIMGDIS  377

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYL  E+LSI+++ L P+ L+ELI+ I+  TIS KIGK++L E++  GG+ K +I++K L
Sbjct  378  AYLNQERLSISQLALQPETLAELIALIEDGTISNKIGKDVLPELLTTGGSAKELIEKKGL  437

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
            +QI D   IE  +D V+A NP +LEQYR GKTKL G+F G+VMKE+ G+A+PK+ N++L 
Sbjct  438  IQISDTGAIEAAIDAVLAANPNELEQYRAGKTKLLGFFVGKVMKETGGRADPKLTNQLLA  497

Query  162  EKLN  151
            +KLN
Sbjct  498  KKLN  501



>ref|WP_010477067.1| glutamyl-tRNA amidotransferase subunit B [Acaryochloris sp. CCMEE 
5410]
Length=494

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 131/183 (72%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE+ +GLS  D   LT+D  I ++F+ T+  GA  K A NW+MGDI 
Sbjct  310  SELPELPAAKRHRYEEEIGLSPYDTRILTDDHAITQYFETTLKAGASAKQAANWLMGDIT  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
             YL NE LSI +I L P+ L+ELI  I+  TISGKI KE+L E++ KGG+ K ++++K L
Sbjct  370  GYLNNESLSITDIALNPEALAELIELIEANTISGKIAKELLPELLTKGGSPKKLVEKKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
             QI D   +E ++D+V+A +P++LEQYR GKTKLQG+F GQVMK + G+A+PK  N++L 
Sbjct  430  TQISDAATLESLIDEVLAAHPQELEQYRNGKTKLQGFFMGQVMKRTSGRADPKATNQMLA  489

Query  162  EKL  154
            +KL
Sbjct  490  KKL  492



>ref|XP_002984359.1| hypothetical protein SELMODRAFT_120349 [Selaginella moellendorffii]
 gb|EFJ14409.1| hypothetical protein SELMODRAFT_120349 [Selaginella moellendorffii]
Length=526

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 135/194 (70%), Gaps = 23/194 (12%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            + + Q+ VDS+  +LPELP   RRRYE +GLSMQDVL L +D +++E+FD+T+ +GAD+K
Sbjct  353  LVLKQEQVDSINEALPELPNETRRRYEALGLSMQDVLVLADDKSVSEYFDSTLEQGADMK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            +A NW+MGDI AYLK EKLSI+++K++P  L+EL+S IK  TISGKIGKE          
Sbjct  413  MAANWIMGDITAYLKTEKLSISDVKISPSVLAELVSLIKDGTISGKIGKE----------  462

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
                         I D  EI  +VDKV+ +NPKQLE ++ GKTKLQG+F GQVM+ + G+
Sbjct  463  -------------ISDEAEIASLVDKVLLENPKQLEAFKKGKTKLQGFFEGQVMRSTNGR  509

Query  195  ANPKMLNKILLEKL  154
             NP ++ K++ +KL
Sbjct  510  VNPILMKKVVAQKL  523



>gb|AFY90544.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Chroococcidiopsis 
thermalis PCC 7203]
Length=541

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++++ ++     LPELP  KR RYE ++GLS  D   LT++  +AE+F+AT+  GA  
Sbjct  345  IEVSKEQLEKWRAELPELPAQKRHRYESELGLSAYDTRVLTDERAVAEYFEATVAAGASA  404

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDIAAYL + KL+I E+ L P  L+ELI  I+G TISGKI K+IL E++A+G
Sbjct  405  KQAANWIMGDIAAYLNSNKLNITELALKPNTLAELIQLIEGNTISGKIAKDILPELLAQG  464

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L+QI D   IE +V++VIA NPK+LEQYR GKTKL G+F GQV+K++ G
Sbjct  465  GSAKELVERKGLIQISDRSAIEAIVEQVIAANPKELEQYRNGKTKLLGFFVGQVLKQTGG  524

Query  198  KANPKMLNKILLEKLN  151
            +A+PK+ N++L EKLN
Sbjct  525  RADPKLTNQLLAEKLN  540



>ref|XP_005850490.1| hypothetical protein CHLNCDRAFT_50146 [Chlorella variabilis]
 gb|EFN58388.1| hypothetical protein CHLNCDRAFT_50146 [Chlorella variabilis]
Length=551

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 137/203 (67%), Gaps = 6/203 (3%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            + + Q Y+D +  S+PELP   R RY  +GLS  DVL L+++ ++  +FDA +  GA  K
Sbjct  346  LVLNQAYLDEIQASMPELPRQVRERYLALGLSQYDVLVLSDERDVVAYFDAVLAAGAPPK  405

Query  555  LATNWMMGDIAAYLKNEKLSINEI--KLTPQELSELISAIKGETISGKIGKEILFEIMA-  385
             ATNW+MGD+ AY K  +L  + +  ++ P  L+E+I  I+  TISGKIGKE+L  ++A 
Sbjct  406  PATNWVMGDVMAYCKEARLGWDALAERMAPTALAEMIGLIEDGTISGKIGKEVLPALLAG  465

Query  384  ---KGGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVM  214
                G  V+ M++ + LVQI DP  +  +VD V++ NPKQL+QYR GK KLQG+F G VM
Sbjct  466  EGGSGSGVRAMVETRGLVQISDPAALAAIVDGVLSANPKQLQQYREGKPKLQGFFVGAVM  525

Query  213  KESKGKANPKMLNKILLEKLNAK  145
            KESKG+ANP  LN+IL+E+LNA 
Sbjct  526  KESKGRANPAELNRILMEQLNAS  548



>ref|WP_015205388.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Crinalium 
epipsammum]
 gb|AFZ15297.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Crinalium 
epipsammum PCC 9333]
Length=494

 Score =   197 bits (502),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE ++GLS  D   +T+D  +AE+F+A +   A  K A NW+MGDI  Y
Sbjct  312  LPELPAAKRHRYETELGLSAYDARVITDDRFVAEYFEAALAAKAQPKQAANWVMGDITGY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L NEKL+IN+I   PQ L+ELI+ I+  TISGKI KEIL E++++GG+ + ++  K LVQ
Sbjct  372  LNNEKLNINQIAFKPQHLAELIALIENGTISGKIAKEILPELLSQGGSPQELVNRKGLVQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D  E+EK++D++IA +PK+LEQYR GKTKL G+F GQVMK++ G+A+PK+ N++L +K
Sbjct  432  ISDTAELEKIIDEIIAASPKELEQYRNGKTKLLGFFVGQVMKQTSGRADPKLTNQMLNQK  491

Query  156  LN  151
            LN
Sbjct  492  LN  493



>ref|WP_015173670.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Geitlerinema 
sp. PCC 7407]
 gb|AFY68106.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Geitlerinema 
sp. PCC 7407]
Length=495

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE ++GLS  D   LT+D ++A +F+  +  G+ +K   NW+MGDIA
Sbjct  310  SELPELPAQKRHRYESELGLSAYDTRVLTDDPDVAAYFEGAVIAGSPIKQTANWVMGDIA  369

Query  522  AYLKNEK-LSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKD  346
            AYL ++  LSI  I LTP  L+E++S I+  TISGKI KEIL +++ KGG+VK +I+EK 
Sbjct  370  AYLNSKPGLSIRAIALTPAVLAEMVSLIEDGTISGKIAKEILPDLLEKGGSVKALIEEKG  429

Query  345  LVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKIL  166
            LVQI DP  +  ++D+V+A+NP +LEQYR GKTKLQG+F GQVMK++ G+A+PK+ N++L
Sbjct  430  LVQISDPAALGAIIDEVLAENPTELEQYRNGKTKLQGFFVGQVMKKTSGRADPKLTNQLL  489

Query  165  LEKL  154
              KL
Sbjct  490  GPKL  493



>ref|WP_036479698.1| glutamyl-tRNA amidotransferase [Myxosarcina sp. GI1]
Length=496

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 144/197 (73%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++++ +++    LPELP  KR RYE ++GLS  D   LT+D  +AE+F+A +  G D 
Sbjct  300  IEVSKEQLEAWKAELPELPAQKRNRYESELGLSAYDTRVLTDDRAVAEYFEAAVTAGGDA  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+MGDIAAY+ +  L+I+E  L P+ L+ELI+ +   TISGKIGK+IL E++ KG
Sbjct  360  KQVANWVMGDIAAYVNSNNLTISETALKPETLAELIALVADGTISGKIGKDILPELLTKG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++++K L+QI D  E+E ++D+V+  +PK+LEQ+R GKTKL+G+F GQVMK++ G
Sbjct  420  GSAKKLVEKKGLIQISDTGELETIIDEVLNAHPKELEQFRNGKTKLKGFFVGQVMKKTSG  479

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KL A
Sbjct  480  RADPKLTNQLLGKKLQA  496



>ref|WP_015175041.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Oscillatoria 
nigro-viridis]
 gb|AFZ05715.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Oscillatoria 
nigro-viridis PCC 7112]
Length=496

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP MKR RYE ++GLS  D   LT+D  +AE+F+ +I  GA  K A NW+MGDI AY
Sbjct  312  LPELPAMKRNRYETELGLSPYDARVLTDDKAVAEYFEKSIAAGAVAKQAANWVMGDITAY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LKNEKL+I +I   PQ+L+EL+  I+  TISGKI K+IL E++A GG+ +  ++ K L+Q
Sbjct  372  LKNEKLAIAQIPFQPQDLAELLGLIEAGTISGKIAKDILPELLANGGSPQKFVESKGLIQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I++ +D V+A NPK+LEQYR GKTKL G+F G+VMKE+ G+A+PK+ N++L+ K
Sbjct  432  ISDTGAIDRAIDAVLAANPKELEQYRAGKTKLLGFFVGKVMKETGGRADPKLTNELLVAK  491

Query  156  LNA  148
            LNA
Sbjct  492  LNA  494



>ref|WP_015148859.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase 
subunit B [Oscillatoria acuminata]
 gb|AFY82218.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Oscillatoria acuminata PCC 6304]
Length=494

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 130/185 (70%), Gaps = 1/185 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE   GLS  D   +T+D  +AE+F+AT+  G D K A NW+ GDI 
Sbjct  310  SELPELPAQKRDRYETDFGLSPYDARVITDDRTVAEYFEATLAAGGDAKQAANWIQGDIT  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
             YLK EKL+I +I LTP  L+EL   I   TISGKI K+IL E++ +GG+ K +++ K L
Sbjct  370  GYLKTEKLNITDIALTPVALAELTGLITSGTISGKIAKDILPELLTQGGSPKELVESKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
            +QI D   +EKM+D+ IA +PK++E YR GKTKL+G+F GQVMK S G+A+PK+ N+++ 
Sbjct  430  IQISDTSALEKMIDEAIAAHPKEVESYRSGKTKLKGFFVGQVMKLSGGRADPKLTNQLVE  489

Query  162  EKLNA  148
            +KLN 
Sbjct  490  QKLNG  494



>ref|WP_007356597.1| MULTISPECIES: glutamyl-tRNA amidotransferase subunit B [Kamptonema]
 emb|CBN57397.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [ 
[[Oscillatoria] sp. PCC 6506]
Length=494

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 132/183 (72%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE K+GLS  D   LT+D  +AE+F+A I  G + K   NW+MGDI AY
Sbjct  312  LPELPASKRDRYENKIGLSAYDARVLTDDRAVAEYFEAAIAAGGNPKQVANWVMGDITAY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LKNEKL+I ++   P  L+ELIS I   TISGKI K++L +++++GG+ K  I+   + Q
Sbjct  372  LKNEKLNITQLPFKPDGLAELISLIDAGTISGKIAKDLLPKLLSEGGSPKQAIEAAGVTQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   +E  +D+VIA+NPK+LEQYR GKTKL G+F GQVMK+++G+A+PK+ N++L +K
Sbjct  432  ISDAATLEAAIDRVIAENPKELEQYRSGKTKLLGFFVGQVMKQTEGRADPKLTNQLLNKK  491

Query  156  LNA  148
            LN 
Sbjct  492  LNG  494



>ref|WP_017296048.1| glutamyl-tRNA amidotransferase subunit B [Geminocystis herdmanii]
Length=492

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 135/183 (74%), Gaps = 2/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE + GLS  D   LT+D ++A +F+A +  GA VK + NW+  DIAAY
Sbjct  309  LPELPAQKRTRYEAEFGLSAYDARVLTDDRDVALYFEAVVASGASVKGSANWVTQDIAAY  368

Query  516  L-KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            L  N +L+IN+I L P+ L ELI+ I+  TISGKI K++L E++ KGG+ K +++ K L+
Sbjct  369  LNSNVELTINDIALKPEMLGELITLIENGTISGKIAKDLLPELLVKGGSPKEIVESKGLI  428

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLE  160
             I +P E+ +++DK+IADNP +L Q++ GKTKLQG+F GQ+MKE+ GKA+PK+ NKIL E
Sbjct  429  AISNPDELAEIIDKIIADNPDKLAQFKAGKTKLQGFFVGQIMKETGGKADPKLANKILNE  488

Query  159  KLN  151
            KLN
Sbjct  489  KLN  491



>ref|WP_008277568.1| glutamyl-tRNA amidotransferase subunit B [Cyanothece sp. CCY0110]
 gb|EAZ89323.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Cyanothece 
sp. CCY0110]
Length=495

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 137/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            +++  +++    LPELP  KR+RYE+ +GLS  D   LT+D ++AE+++  + +GAD KL
Sbjct  301  VSEKRLNAWKQELPELPAQKRKRYEEELGLSAYDARVLTDDRDVAEYYETAVKKGADAKL  360

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KLSI EI L P  L EL+  I+  TISGKI KEIL E++ KGG+
Sbjct  361  VANWVTQDIAAYLNNSKLSITEIALKPDSLGELVQLIEKGTISGKIAKEILPELLEKGGS  420

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K +++ K + QI DP EIEK++  ++  NP ++E+YRGGK KL+G+F GQVMKE+ G+A
Sbjct  421  PKQIVESKGMTQISDPGEIEKVIKALMEANPSEVEKYRGGKKKLKGFFVGQVMKETGGRA  480

Query  192  NPKMLNKILLEKLNA  148
            +PK+ N++  + LN 
Sbjct  481  DPKLTNQLAEKLLNG  495



>ref|WP_015230344.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase 
subunit B [Dactylococcopsis salina]
 gb|AFZ51355.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Dactylococcopsis salina PCC 8305]
Length=495

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 137/197 (70%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++Q  ++   + LPELP  KR RY E  GLS  D   LT+D ++AE+F+  +   AD 
Sbjct  299  IQVSQSQLEEWQSELPELPAAKRHRYQEAFGLSAYDTNVLTDDRSVAEYFETAVATDADP  358

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+  DIAA+L   K+ I ++ LTP  L+EL++ I   TISGKI KEIL E+++ G
Sbjct  359  KQVANWVTQDIAAHLNENKIKITDLPLTPDALAELVNLIDQGTISGKIAKEILPELLSNG  418

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K M++EK L QI D  E+E ++D+V+AD+P+++E+YRGGK KLQG+F GQVMK + G
Sbjct  419  GSPKAMVEEKGLTQISDSGELEGIIDQVLADHPEEVEKYRGGKKKLQGFFVGQVMKRTSG  478

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KLN 
Sbjct  479  RADPKLTNQLLGKKLNG  495



>ref|WP_039727104.1| MULTISPECIES: glutamyl-tRNA amidotransferase [Oscillatoriophycideae]
 gb|KIF15161.1| glutamyl-tRNA amidotransferase [Aphanocapsa montana BDHKU210001]
 gb|KIF40073.1| glutamyl-tRNA amidotransferase [Lyngbya confervoides BDU141951]
Length=495

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE  +GLS  D   LT++  +AE+F+  +  GAD KLA NW+  DIAAY
Sbjct  313  LPELPAEKRSRYETDLGLSAYDARVLTDERIVAEYFETVVESGADAKLAANWITQDIAAY  372

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L  EKLSINEI L P+ L+E+I  I   TIS KI K+IL +++ +GG+ K +++ + L Q
Sbjct  373  LNAEKLSINEIALKPEMLAEMILMITEGTISTKIAKDILLDLLTEGGSPKAIVESRGLSQ  432

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP++IE ++D+V+A +P++LE+YR GK KLQG+F GQVMK + G+ +PK+ N++L++K
Sbjct  433  ISDPKQIEAIIDEVLAAHPEELEKYRAGKKKLQGFFVGQVMKRTSGRVDPKLTNQLLIKK  492

Query  156  LN  151
            LN
Sbjct  493  LN  494



>ref|WP_006508067.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Xenococcus sp. PCC 7305]
 gb|ELS04845.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Xenococcus sp. PCC 7305]
Length=496

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 141/195 (72%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ + +++    LPELP  KR RY+   GLS  D+  LT+D  +AE+F+A I  G D 
Sbjct  300  IEVSPEQLETWKAELPELPIAKRHRYQADYGLSAYDIRILTDDRALAEYFEAAISTGVDG  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW++GDIAAYLKN  L I+EI L P+ L+EL+  I   TISGKI K+IL E++ KG
Sbjct  360  KQVANWLIGDIAAYLKNNNLKIDEIALKPEILAELVGLISKGTISGKIAKDILPELLTKG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++++K L+QI D  EIEK++D+V+A +P +LE++R GKTKL+G+F GQVMK+S G
Sbjct  420  GSAKELVEKKGLIQISDTGEIEKIIDEVLAAHPDELEKFRNGKTKLRGFFVGQVMKKSGG  479

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N++L +KL
Sbjct  480  KADPKLTNQLLGKKL  494



>ref|WP_017327770.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. PCC 
7336]
Length=493

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP+ KR RY  + GLS+ D  +L++D + A +F+AT+  GAD K A NW+M DIA Y
Sbjct  307  LPELPQAKRNRYINEYGLSVYDARYLSDDRDTAAYFEATVAVGADPKAAANWIMSDIAKY  366

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L + KL   +I L P+ L+ELI  I   TIS KI KEIL E++ +GGT KG++  K L Q
Sbjct  367  LNDRKLGYPDIALKPETLAELIGLIDTGTISSKIAKEILPELLERGGTAKGLVAAKGLTQ  426

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   +E  +D+++A NPKQ+EQYR GKTKL G+F GQ+MK+++G+A+P++ N+++ EK
Sbjct  427  ISDVGALESQIDEIVAANPKQVEQYRAGKTKLLGFFVGQLMKQTQGRADPQLANQLIAEK  486

Query  156  LNAK  145
            L A+
Sbjct  487  LKAQ  490



>ref|WP_015220988.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Cyanobacterium 
aponinum]
 gb|AFZ55270.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Cyanobacterium 
aponinum PCC 10605]
Length=494

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 139/197 (71%), Gaps = 2/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + I +  ++ +  +LPELP  KR RYE + GLS  D   L++D ++A +F+A +  GA V
Sbjct  297  LVINEAQLEEISKTLPELPANKRSRYEAEFGLSAYDARVLSDDKDVALYFEAVVANGASV  356

Query  558  KLATNWMMGDIAAYL-KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAK  382
            K A NW+  DIAAYL  N  L IN+I L P+ L+ELI  I+  TISGKI KEIL E++ K
Sbjct  357  KGAANWITQDIAAYLNSNPDLDINKIALKPEMLAELIKLIEEGTISGKIAKEILPELLEK  416

Query  381  GGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESK  202
            GG+ K +++ K LV I +P E+  ++DK++++NP +LEQYR GKTKLQG+F GQ+MK + 
Sbjct  417  GGSPKEIVESKGLVAISNPDELSTIIDKILSENPDKLEQYRAGKTKLQGFFVGQIMKATS  476

Query  201  GKANPKMLNKILLEKLN  151
            G+A+PK+ N+IL +KLN
Sbjct  477  GRADPKLANQILNQKLN  493



>ref|WP_009544472.1| MULTISPECIES: glutamyl-tRNA amidotransferase subunit B [Cyanothece]
 sp|B1WYK7.1|GATB_CYAA5 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Cyanothece sp. ATCC 
51142]
 gb|ACB51024.1| glutamyl-tRNA (Gln) amidotransferase subunit B [Cyanothece sp. 
ATCC 51142]
Length=495

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++++ +++    LPELP  KR+RYE+ +GLS  D   LT+D  +AE+++  +  GAD KL
Sbjct  301  VSEEKLNAWKQELPELPAQKRKRYEEALGLSAYDARVLTDDREVAEYYETAVNTGADAKL  360

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KLSI EI L P  L EL+  I+  TISGKI KEIL E++ KGG+
Sbjct  361  VANWVTQDIAAYLNNSKLSIIEIALKPDSLGELVQLIEKGTISGKIAKEILPELLEKGGS  420

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K +++ K + QI DP EIEK+++ ++  NP ++E+YRGGK KL+G+F GQVMKE+ G+A
Sbjct  421  PKKIVESKGMTQISDPAEIEKVIEALMEANPSEVEKYRGGKKKLKGFFVGQVMKETGGRA  480

Query  192  NPKMLNKILLEKLN  151
            +PK+ N++  + LN
Sbjct  481  DPKLTNQLAEKLLN  494



>ref|WP_043738443.1| glutamyl-tRNA amidotransferase [Synechococcus sp. RCC307]
Length=488

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +  D   +  N LPELP  KR RY + +GLS  D   LT++  +AE+F+A +  GAD 
Sbjct  292  IEVKADQRQAWLNELPELPAAKRHRYADALGLSQYDARVLTDERLMAEYFEAVVASGADA  351

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAAY+ +++LS +E+   P++L+E++  I G  ISGKI KEIL E++ KG
Sbjct  352  KLAANWITGDIAAYVNSQRLSFSELPFRPEQLAEMVQLIDGGKISGKIAKEILPELLEKG  411

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  I  +VD+++A +P ++E +RGGK KLQG+F GQ+MK++ G
Sbjct  412  GSPKAIVDERGLGMISDPAAITAIVDELLAAHPDEVEAFRGGKNKLQGFFVGQLMKKTGG  471

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  472  KADPKLANQILSQKL  486



>emb|CAK29278.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Synechococcus 
sp. RCC307]
Length=491

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +  D   +  N LPELP  KR RY + +GLS  D   LT++  +AE+F+A +  GAD 
Sbjct  295  IEVKADQRQAWLNELPELPAAKRHRYADALGLSQYDARVLTDERLMAEYFEAVVASGADA  354

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAAY+ +++LS +E+   P++L+E++  I G  ISGKI KEIL E++ KG
Sbjct  355  KLAANWITGDIAAYVNSQRLSFSELPFRPEQLAEMVQLIDGGKISGKIAKEILPELLEKG  414

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  I  +VD+++A +P ++E +RGGK KLQG+F GQ+MK++ G
Sbjct  415  GSPKAIVDERGLGMISDPAAITAIVDELLAAHPDEVEAFRGGKNKLQGFFVGQLMKKTGG  474

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  475  KADPKLANQILSQKL  489



>ref|WP_015125954.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase 
subunit B [Synechococcus sp. PCC 6312]
 gb|AFY62417.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Synechococcus sp. PCC 6312]
Length=497

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 136/183 (74%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE ++GLS  D   LT++   AE+F+A +  GA+ K A NW+MGDI AY
Sbjct  315  LPELPAQKRHRYESELGLSAYDTRVLTDERTTAEYFEAVVAAGANPKQAANWIMGDITAY  374

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            +K EK ++ +I LTP  L+ELI  I+  TIS KI K+IL E++  GG+ + ++++K LVQ
Sbjct  375  IKTEKRTLVDIPLTPAGLAELIGLIEKGTISSKIAKDILPELLLNGGSPQALVEKKGLVQ  434

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            + D  E+EK++D+V+A +P++L QYR GKTKLQG+F GQ+MK++ G+A+PK+ N++L +K
Sbjct  435  MSDTGELEKLIDEVLAAHPEELAQYRAGKTKLQGFFVGQMMKKTGGRADPKLTNQLLQKK  494

Query  156  LNA  148
            LNA
Sbjct  495  LNA  497



>ref|WP_035996347.1| glutamyl-tRNA amidotransferase [Leptolyngbya sp. JSC-1]
Length=498

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 140/196 (71%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D + +    LPELP  KR RYE ++GLS  D   LT+D  IAE+F+A +  GA  
Sbjct  302  IEVSPDQLATWKAELPELPAQKRHRYESELGLSAYDARVLTDDRAIAEYFEAVVAAGAGA  361

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDI+AYL NEKLSI+EI L P+ L+E+I  I+  TIS KIGK+IL E++ KG
Sbjct  362  KPAANWIMGDISAYLNNEKLSISEIPLKPESLAEMIKLIEANTISNKIGKDILPELLTKG  421

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++++K L+QI DP  IE  +DKVIA NP +LE+YR GK  L G+F GQVMK + G
Sbjct  422  GSAKQLVEQKGLIQISDPNLIEAEIDKVIAANPNELEKYRSGKKNLLGFFVGQVMKATGG  481

Query  198  KANPKMLNKILLEKLN  151
            KA+PK+ N++L +KL+
Sbjct  482  KADPKLTNQLLQKKLD  497



>dbj|GAL91402.1| aspartyl-tRNA(Asn) amidotransferase subunit B [Microcystis aeruginosa 
NIES-44]
Length=490

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPAHKRRRYEEEFGLSAYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL+I EI L   +L+EL+  I+  TISGKI KEIL E++++GG+
Sbjct  356  VANWISQDIAAYLNNNKLTITEIALQASDLAELVKLIETGTISGKIAKEILPELLSQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDTSAIEKLIEEIIAAHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>emb|CCQ64937.1| Aspartyl-tRNA(Asn) amidotransferase subunit B @ Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Crocosphaera watsonii WH 0402]
Length=359

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++++ ++S    LPELP  KR+RYE+  GLS  D   L++D  +AE++++ +  GAD KL
Sbjct  165  VSKERLNSWKEELPELPAEKRQRYEEAFGLSAYDARVLSDDREVAEYYESAVNTGADAKL  224

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KLSI EI L P  L EL+  I+ +TISGKI KEIL E++ KGG+
Sbjct  225  VANWVTQDIAAYLNNNKLSITEIALKPDSLGELVQLIEKKTISGKIAKEILPELLEKGGS  284

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K +++ K + QI DP EI K++  ++  NP ++E+YRGGK KL+G+F GQVMK++ G A
Sbjct  285  PKKIVESKGMTQISDPAEIAKVITALMEANPSEVEKYRGGKKKLKGFFVGQVMKQTGGCA  344

Query  192  NPKMLNKILLEKLNA  148
            +PK+ N+++ + LN 
Sbjct  345  DPKLTNQLVEKLLNG  359



>gb|AII44721.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. KORDI-100]
Length=474

 Score =   192 bits (487),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 137/197 (70%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +S    LPELP  KR RY + +GLS  D   LT++  +A++F+A +  GAD 
Sbjct  278  IEVSADQRESWRAELPELPAAKRHRYADVLGLSQYDARVLTDERPMADYFEAVVSAGADA  337

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAA++ + +LS  E+   P++L+E++  I+   ISGKI KEIL E++ KG
Sbjct  338  KLAANWITGDIAAHVNSNRLSYAELPFRPEQLAEMVQLIEAGKISGKIAKEILPELLEKG  397

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  IE +VD+++A +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  398  GSPKAIVDERGLGMISDPAAIEAIVDELLAAHPAEVEAFRGGKTKLQGFFVGQLMKKTGG  457

Query  198  KANPKMLNKILLEKLNA  148
            KA+PK+ NKIL  KL A
Sbjct  458  KADPKLANKILSSKLKA  474



>ref|WP_015227247.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Halothece 
sp. PCC 7418]
 gb|AFZ45375.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Halothece 
sp. PCC 7418]
Length=495

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +++  ++   + LPELP  KR RY E++GLS  D   LT+D  +AE+F+  +   AD 
Sbjct  299  IKVSKPQLEQWQSELPELPAQKRHRYQEELGLSAYDTNVLTDDRAVAEYFETAVSHQADP  358

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+  DIAAYL   KL I E+ L P  L+EL++ I   TISGKI KEIL E++ +G
Sbjct  359  KQVANWVTQDIAAYLNENKLKITELPLKPDALAELVNLIDQGTISGKIAKEILPELLTQG  418

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L QI D  E+E ++D+V+AD+P+++E+YRGGK KLQG+F GQVMK + G
Sbjct  419  GSPKALVESKGLTQISDSSELEGIIDQVLADHPEEVEKYRGGKKKLQGFFVGQVMKRTSG  478

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KLN 
Sbjct  479  RADPKLTNQLLGKKLNG  495



>ref|WP_038547345.1| glutamyl-tRNA amidotransferase [Synechococcus sp. KORDI-100]
Length=492

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 137/197 (70%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +S    LPELP  KR RY + +GLS  D   LT++  +A++F+A +  GAD 
Sbjct  296  IEVSADQRESWRAELPELPAAKRHRYADVLGLSQYDARVLTDERPMADYFEAVVSAGADA  355

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAA++ + +LS  E+   P++L+E++  I+   ISGKI KEIL E++ KG
Sbjct  356  KLAANWITGDIAAHVNSNRLSYAELPFRPEQLAEMVQLIEAGKISGKIAKEILPELLEKG  415

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  IE +VD+++A +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  416  GSPKAIVDERGLGMISDPAAIEAIVDELLAAHPAEVEAFRGGKTKLQGFFVGQLMKKTGG  475

Query  198  KANPKMLNKILLEKLNA  148
            KA+PK+ NKIL  KL A
Sbjct  476  KADPKLANKILSSKLKA  492



>ref|WP_002797759.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCI26116.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9809]
Length=490

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSAYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL+I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLTITEISLQASDLAELVKLIETGTISGKIAKEILPELLTEGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDTSAIEKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_015143331.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase 
subunit B [Pleurocapsa minor]
 gb|AFY77026.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Pleurocapsa sp. PCC 7327]
Length=495

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 135/182 (74%), Gaps = 1/182 (1%)
 Frame = -3

Query  696  SLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAA  520
            ++PELP  KRRRYE ++GLS  D   LT+D N+AE+F+A +  GA+ KL  NW+  DIAA
Sbjct  312  AIPELPAQKRRRYESELGLSAYDARVLTDDRNVAEYFEAAVAAGANPKLVANWVTQDIAA  371

Query  519  YLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            YL N KLSI EI L P+ L+EL++ I   TIS KI K+IL E++  GG+ K ++++K L 
Sbjct  372  YLNNNKLSIGEIALKPEILAELVNLIAKGTISNKIAKDILPELLTTGGSAKDLVEKKGLT  431

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLE  160
             + DP ++EK++D++IA NPK++E++R GK  ++G+F GQVMK++ G+A+PK+ N+++ +
Sbjct  432  TLFDPAKLEKIIDEIIAANPKEVEKFRSGKGNIKGFFVGQVMKKTSGRADPKLTNQLIDK  491

Query  159  KL  154
            KL
Sbjct  492  KL  493



>ref|WP_006635745.1| glutamyl-tRNA amidotransferase subunit B [Microcoleus vaginatus]
 gb|EGK83838.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcoleus 
vaginatus FGP-2]
Length=496

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE ++GLS  D   LT+D  +AE+F+ +I  GA  K A NW+MGDI AY
Sbjct  312  LPELPAQKRNRYETELGLSPYDARVLTDDKAVAEYFEKSIAAGAVAKQAANWVMGDITAY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LKNEKL+I EI   PQ+L+EL+  I   TISGKI K+IL E++A GG+ +  ++ K L+Q
Sbjct  372  LKNEKLAIAEIPFQPQDLAELLGLIDAGTISGKIAKDILPELLANGGSPQKFVESKGLIQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I++ +D V+A NPK+LEQYR GKTKL G+F G+VMKE+ G+A+PK+ N++L  K
Sbjct  432  ISDTGAIDQAIDAVLAANPKELEQYRAGKTKLLGFFVGKVMKETGGRADPKLTNELLTAK  491

Query  156  LNA  148
            LN 
Sbjct  492  LNG  494



>ref|WP_008205758.1| glutamyl-tRNA amidotransferase subunit B [Microcystis sp. T1-4]
 emb|CCI33914.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
sp. T1-4]
Length=490

 Score =   191 bits (486),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSAYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL+I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLTITEIALQASDLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDTSAIEKLIEEIIAAHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>gb|AHF64902.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Synechococcus 
sp. WH 8109]
Length=493

 Score =   191 bits (486),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 139/195 (71%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +S    LPELP +KR RY +++GLS  D   LT++  +A++F+A +G GAD 
Sbjct  297  IEVSADQRESWRAELPELPAVKRHRYADELGLSQYDARVLTDERPMADYFEAVVGAGADA  356

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAA++ + +LS  E+   P++L+E++  I G  ISGKI KEIL E++ +G
Sbjct  357  KLAANWITGDIAAHVNSNRLSYAELPFRPEQLAEMVQLIGGGKISGKIAKEILPELLEEG  416

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  IE +VD+++  +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  417  GSPKAIVDERGLGMISDPAAIEAIVDELLGGHPDEVEAFRGGKTKLQGFFVGQLMKKTGG  476

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  477  KADPKLANQILSKKL  491



>ref|WP_015167360.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase 
subunit B [Synechococcus sp. PCC 7502]
 gb|AFY72701.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Synechococcus sp. PCC 7502]
Length=488

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 130/183 (71%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAA  520
            + LPELP  KR++Y  +GL+  D   + +D ++AE+F+A I  GAD K A NW+MGDI +
Sbjct  306  SELPELPAAKRQKYRNLGLTAYDAQLIADDRSVAEYFEAAIALGADPKQAFNWIMGDITS  365

Query  519  YLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            YLK +KL I +I L P  L+EL+S I   TIS KI K+IL E++  GG+VK ++K K+L 
Sbjct  366  YLKEQKLKIADIPLNPTVLAELVSLITDGTISSKIAKDILPELLVNGGSVKALVKAKNLT  425

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLE  160
             ++    +EK++D+VIA NPK+LEQYR GKTKL G+F GQVMK + G+A P+  N++L +
Sbjct  426  -VLSGDALEKIIDQVIAANPKELEQYRAGKTKLLGFFVGQVMKATNGQAAPQATNQLLSQ  484

Query  159  KLN  151
            KLN
Sbjct  485  KLN  487



>ref|WP_002763085.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCH99633.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9717]
Length=490

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 139/194 (72%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL+I EI L   +L+EL+  I+  TISGKI KEIL E++++GG+
Sbjct  356  VANWISQDIAAYLNNNKLTITEIALQAPDLAELVKLIETGTISGKIAKEILPELLSQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDNSAIEKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_011365424.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. CC9605]
 sp|Q3AGQ3.1|GATB_SYNSC RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus sp. 
CC9605]
 gb|ABB36229.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Synechococcus 
sp. CC9605]
Length=494

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 138/195 (71%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +S    LPELP  KR RY +++GLS  D   LT++  +A++F+A +G GAD 
Sbjct  298  IEVSADQRESWRAELPELPAAKRHRYADELGLSQYDARVLTDERPMADYFEAVVGAGADA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAA++ + +LS  E+   P++L+E++  I G  ISGKI KEIL E++ KG
Sbjct  358  KLAANWITGDIAAHVNSNRLSYAELPFRPEKLAEMVQLIDGGKISGKIAKEILPELLEKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  IE +VD+++  +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKAIVDERGLGIISDPAAIEAIVDELLGAHPDEVEAFRGGKTKLQGFFVGQLMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  478  KADPKLANQILSKKL  492



>ref|WP_002801811.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCI35512.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9701]
Length=490

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSAYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL+I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLTITEIALQASDLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKTLVEKKGLIQISDTSAIEKLIEEIIAAHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_002771374.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCI04541.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9443]
Length=490

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIEAGTISGKIAKEILPELLTEGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDSSAIEKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_006042873.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. WH 
7805]
 gb|EAR17320.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Synechococcus 
sp. WH 7805]
Length=495

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +S    LPELP  KR RY E +GLS  D   LT++  +A++F+A +  GAD 
Sbjct  298  IEVSADQRESWRAELPELPAAKRHRYAETLGLSQYDARVLTDEKAMADYFEAVVAAGADA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA+NW+ GDIAAY+   +L  +E+   P++L+E++  I G  ISGKI KEIL E++ KG
Sbjct  358  KLASNWITGDIAAYVNGNRLRFSELPFRPEQLAEMVQLIDGGKISGKIAKEILPELLEKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  I  +V++++A +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKAIVDERGLGMISDPAAITTIVEELLAAHPDEVEAFRGGKTKLQGFFVGQLMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  478  KADPKLANQILSQKL  492



>ref|WP_006530558.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Gloeocapsa sp. PCC 73106]
 gb|ELR96526.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Gloeocapsa sp. PCC 73106]
Length=489

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE+ + LS  D   LT+D  +AE+F+A I  GA+ KL  NW+  DI+A+
Sbjct  306  LPELPAQKRHRYEQELDLSPYDARVLTDDREMAEYFEAAIALGANPKLVANWVTQDISAH  365

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L N KL +++I LTP+ LSEL+  I+ +TISGKI K+IL E++ +GG+ + +++ K L Q
Sbjct  366  LNNNKLELSQIALTPEALSELVKLIEAQTISGKIAKDILPELLTEGGSPQKIVESKGLNQ  425

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DPQ + +++++V+A +P++L  +RGGKTKL+G+F GQ+MK+S+G+A+PK+ N++L EK
Sbjct  426  ISDPQALAQLIEEVLAAHPQELAAFRGGKTKLKGFFVGQIMKKSEGRADPKLTNQLLAEK  485

Query  156  L  154
            L
Sbjct  486  L  486



>ref|WP_016516340.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa]
 gb|EPF19914.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa SPC777]
Length=490

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPAHKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDSSAIEKLIEEIIASHPSELEKFRSGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_024970796.1| glutamyl-tRNA amidotransferase [Microcystis aeruginosa]
Length=490

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPAHKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDTSAIEKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_004161937.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCI29400.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9808]
Length=490

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPAHKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDSSAIEKLIEEIIASHPSELEKFRSGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_002752075.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCH91046.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9432]
Length=490

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDSSAIEKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_006453880.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. PCC 
7335]
 gb|EDX84135.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit subfamily [Synechococcus sp. PCC 7335]
Length=497

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 139/197 (71%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D +    + LPELP  KR+RYE+ +GLS  D   + +D ++AE+F+  I  GA  
Sbjct  301  IEVSADQLSQWKSELPELPAQKRKRYEEEIGLSAYDTRVIADDRSVAEYFERAIATGASS  360

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KL  NW+MGDIA YL  EKLSI + KL+ + L+E++  I+  TIS KIGK++L +++  G
Sbjct  361  KLVANWIMGDIAGYLNAEKLSITDTKLSAEALAEMVKLIEDGTISNKIGKDMLPDLLKTG  420

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L QI +P EIE M+D+VIA +P +L +++ GKTKL+G+F GQVMK + G
Sbjct  421  GSPKAIVESKGLSQISNPAEIEAMIDEVIAAHPDELAKFKAGKTKLKGFFVGQVMKRTGG  480

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KLNA
Sbjct  481  RADPKLTNQLLGKKLNA  497



>ref|WP_002745324.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Microcystis aeruginosa]
 emb|CAO89375.1| gatB [Microcystis aeruginosa PCC 7806]
 gb|ELS47076.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Microcystis aeruginosa DIANCHI905]
Length=490

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTEGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDSSAIEKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_002777996.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCI08256.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 7941]
Length=490

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTEGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDSSAIEKLIEEIIASHPSELEKFRSGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_015163677.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Pseudanabaena 
sp. PCC 7367]
 gb|AFY68703.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Pseudanabaena 
sp. PCC 7367]
Length=489

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 139/183 (76%), Gaps = 2/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELPE KR RY  ++GLS+ D   L ++   A++F+A +  GAD K A NW+MGDI AY
Sbjct  308  LPELPEAKRDRYINELGLSVYDANLLADEHTTADYFEAVLATGADAKQAANWIMGDIMAY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK++K++I+++ LTP+ L ELI+ I  +TI+GKI KEIL E++ KGG+VK ++K+K L  
Sbjct  368  LKDQKINISDLPLTPKVLGELINLIDKKTITGKIAKEILPELLEKGGSVKSLVKKKGLTV  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            +   Q +E+++D+V+A +P ++EQ++GGKTKL G+F GQVMK ++G+A+PK  N++L +K
Sbjct  428  LAGDQ-LEQIIDEVVAAHPNEVEQFKGGKTKLLGFFVGQVMKRTQGRADPKTTNQMLGKK  486

Query  156  LNA  148
            LNA
Sbjct  487  LNA  489



>ref|WP_026103235.1| glutamyl-tRNA amidotransferase [Pseudanabaena sp. PCC 6802]
Length=490

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RY+K +GLS  D   L +D  +AE+F+A +  GAD K A NW+MGDI 
Sbjct  307  DELPELPASKRDRYQKQLGLSAYDANLLADDRGVAEYFEAVLTTGADPKQAFNWIMGDIT  366

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYL   KL I +I LTP  L ELI+ I   TIS KI K+IL E++  GG+VK +I++K+L
Sbjct  367  AYLNEHKLKITDIPLTPSILGELIALIGDGTISSKIAKDILPELLENGGSVKSLIQKKNL  426

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              ++   E+EK++D+++A NPK++EQYRGGKTKL G+F GQVMK+++G+A P++ N++L 
Sbjct  427  T-VLSGAELEKVIDEILAGNPKEVEQYRGGKTKLLGFFVGQVMKKTQGRAAPQVTNEMLT  485

Query  162  EKLNA  148
             KLN 
Sbjct  486  VKLNG  490



>ref|WP_002784358.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa]
 emb|CCI13895.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9806]
Length=490

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSAYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL+I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLTITEIALQASDLAELVKLIETGTISGKIAKEILPELLTEGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE+++ GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDTSAIEKLIEEIIAAHPSELEKFQAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_022606717.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Rubidibacter 
lacunae]
 gb|ERN41619.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Rubidibacter 
lacunae KORDI 51-2]
Length=497

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            IT + +D+    LPELP  KR RY K +GLS+ D   LT+D  +AE+F+  +  GAD K 
Sbjct  301  ITTEQLDTWTAELPELPAKKRDRYAKSLGLSVYDARVLTDDRLVAEYFETAVAAGADAKQ  360

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
            A NW+  D+AAYL N KL+I +I LTP  L+EL+  I   TISGKI KEIL E++ +GG+
Sbjct  361  AANWVTQDVAAYLNNNKLAIADIALTPATLAELVQLIAKGTISGKIAKEILPELLTEGGS  420

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             + +++ K L QI DP E+E++VD+++A NP ++EQ+R GKTKLQG+F GQ+MK + G+A
Sbjct  421  AEKLVESKGLTQISDPSELERVVDELLAANPDKVEQFRNGKTKLQGFFVGQMMKATGGRA  480

Query  192  NPKMLNKILLEKL  154
            +PK+ NKIL  KL
Sbjct  481  DPKLANKILTAKL  493



>ref|WP_002788072.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 emb|CCI18135.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Microcystis 
aeruginosa PCC 9807]
Length=490

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQAADLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDSSAIEKLIEEIIAAHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_002738351.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Microcystis aeruginosa]
 gb|ELP52525.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Microcystis aeruginosa TAIHU98]
Length=490

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 137/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSPYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLMITEIALQASDLAELVKLIETGTISGKIAKEILPELLTQGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   IEK+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKALVEKKGLIQISDTSAIEKLIEEIIAAHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_007306559.1| glutamyl-tRNA amidotransferase subunit B [Crocosphaera watsonii]
 gb|EAM49755.1| Glutamyl-tRNA(Gln) amidotransferase B subunit [Crocosphaera watsonii 
WH 8501]
 emb|CCQ61436.1| Aspartyl-tRNA(Asn) amidotransferase subunit B @ Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Crocosphaera watsonii WH 0401]
 emb|CCQ52318.1| Aspartyl-tRNA(Asn) amidotransferase subunit B @ Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Crocosphaera watsonii WH 8502]
 emb|CCQ59576.1| Aspartyl-tRNA(Asn) amidotransferase subunit B @ Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Crocosphaera watsonii WH 0005]
Length=495

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 136/194 (70%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++++ ++S    LPELP  KR+RYE+  GLS  D   L++D  +AE++++ +  GAD KL
Sbjct  301  VSKERLNSWKEELPELPAEKRQRYEEAFGLSAYDARVLSDDREVAEYYESAVNTGADAKL  360

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KLSI EI L P  L EL+  I+ +TISGKI KEIL E++ KGG+
Sbjct  361  VANWVTQDIAAYLNNNKLSITEIALKPDSLGELVQLIEKKTISGKIAKEILPELLEKGGS  420

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K +++ K + QI DP EI K++  ++  NP ++E+YRGGK KL+G+F GQVMK++ G A
Sbjct  421  PKKIVESKGMTQISDPAEIAKVITALMEANPSEVEKYRGGKKKLKGFFVGQVMKQTGGCA  480

Query  192  NPKMLNKILLEKLN  151
            +PK+ N+++ + LN
Sbjct  481  DPKLTNQLVEKLLN  494



>ref|WP_038552435.1| glutamyl-tRNA amidotransferase [Synechococcus sp. KORDI-52]
 gb|AII48211.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. KORDI-52]
Length=493

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 135/195 (69%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +S    LPELP  KR RY + +GLS  D   LT++  +A++F+A +  GAD 
Sbjct  297  IEVSADQRESWRAELPELPAAKRHRYADDLGLSQYDARVLTDERPMADYFEAAVNAGADP  356

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAA++ + + S  E+   P++L+E++  I G  ISGKI KEIL E++ KG
Sbjct  357  KLAANWITGDIAAHVNSNRFSYTELPFRPEQLAEMVQLIDGAKISGKIAKEILPELLEKG  416

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  IE +VD+++  +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  417  GSPKAIVDERGLGMISDPAAIEAIVDELLGAHPDEVEAFRGGKTKLQGFFVGQLMKKTGG  476

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  477  KADPKLANQILSKKL  491



>ref|WP_012264066.1| glutamyl-tRNA amidotransferase subunit B [Microcystis aeruginosa]
 dbj|BAG00215.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Microcystis aeruginosa 
NIES-843]
Length=490

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++ + + +    LPELP  KRRRYE+  GLS  D   LT+D  +AE+F+  +  GA+ KL
Sbjct  296  VSPEQLKAWAEELPELPARKRRRYEEEFGLSAYDARVLTDDRTVAEYFETAVIAGANAKL  355

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL+I EI L   +L+EL+  I+  TISGKI KEIL E++ +GG+
Sbjct  356  VANWISQDIAAYLNNNKLTITEIALQASDLAELVKLIEMGTISGKIAKEILPELLTEGGS  415

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             K ++++K L+QI D   I+K+++++IA +P +LE++R GKT L+G+F GQVMK+S GKA
Sbjct  416  PKTLVEKKGLIQISDTSAIKKLIEEIIASHPSELEKFRAGKTNLKGFFVGQVMKKSGGKA  475

Query  192  NPKMLNKILLEKLN  151
            +PK+ ++IL +KL+
Sbjct  476  DPKLTSQILDQKLS  489



>ref|WP_011934272.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. WH 
7803]
 sp|A5GPE6.1|GATB_SYNPW RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus sp. 
WH 7803]
 emb|CAK24811.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Synechococcus 
sp. WH 7803]
Length=494

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  DS    LPELP  KR RY + +GLS  D   LT++  +A++F+A +  GAD 
Sbjct  298  IEVSADQRDSWRAELPELPAAKRHRYADTLGLSQYDARVLTDEKPMADYFEAVVVAGADA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAAY+ + +LS   +   P++L+E++  I G  ISGKI KEIL E++  G
Sbjct  358  KLAANWITGDIAAYVNSNRLSYANLPFRPEQLAEMVQLIDGGKISGKIAKEILPELLENG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  IE +VD+++  +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKAIVDERGLGMISDPAAIEAIVDELLGAHPDEVEAFRGGKTKLQGFFVGQLMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  478  KADPKLANQILSKKL  492



>ref|WP_015955550.1| glutamyl-tRNA amidotransferase subunit B [Cyanothece sp. PCC 
7424]
 sp|B7KGN0.1|GATB_CYAP7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Cyanothece sp. PCC 
7424]
 gb|ACK71957.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. 
PCC 7424]
Length=495

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 141/197 (72%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++Q+ +++    +PELP  KR RYE ++GLS  D   LT++  +AE+F+  +  GA+ 
Sbjct  299  IEVSQEQIETWKAQIPELPAQKRTRYETELGLSAYDARVLTDEREVAEYFETAVATGANA  358

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KL  NW+  DIAAYL N KL+I EI L  + L EL++ I+  TISGKI K+IL E++  G
Sbjct  359  KLVANWVTQDIAAYLNNNKLNIGEIALKSEGLGELVNLIEEGTISGKIAKDILPELLTDG  418

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++++K L+QI D  E+EK++D+VIA +PK+LE+YR GK  L+G+F GQV+K++ G
Sbjct  419  GSPKTLVEKKGLIQISDTGELEKIIDEVIASHPKELEKYRSGKKNLKGFFVGQVLKKTGG  478

Query  198  KANPKMLNKILLEKLNA  148
            +A+PK+ N++L +KL A
Sbjct  479  RADPKLTNQLLDKKLEA  495



>ref|WP_017662518.1| glutamyl-tRNA amidotransferase subunit B [Geitlerinema sp. PCC 
7105]
Length=495

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYEK  GLS  D   LT + ++AE+F+A +  GA  K A NW+MGDIA Y
Sbjct  312  LPELPAEKRHRYEKEWGLSAYDARVLTEERDVAEYFEAVVAAGAPAKQAANWVMGDIAGY  371

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
                KLSI EI L P  L+ELI  I+  TISGKI KEIL E++ KGG+ K +++ K + Q
Sbjct  372  TNETKLSITEIALKPAILAELIELIENNTISGKIAKEILPELLEKGGSAKELVESKGMTQ  431

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D  E+EK++D+++A NP ++EQYR GKTKLQG+F GQVMK + G+A+PK+ N++L  K
Sbjct  432  ISDTSELEKIIDELLAANPDKVEQYRNGKTKLQGFFVGQVMKRTSGRADPKLTNQLLAPK  491

Query  156  L  154
            L
Sbjct  492  L  492



>ref|WP_015223186.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Cyanobacterium 
stanieri]
 gb|AFZ47870.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Cyanobacterium 
stanieri PCC 7202]
Length=495

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 136/196 (69%), Gaps = 2/196 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            IT   + ++   LPELP  KR RYE + GLS  D   L +D ++A +F+A +  GA  K 
Sbjct  300  ITDAQLKALEQKLPELPAQKRSRYESEYGLSAYDARVLCDDRDVALYFEAVVSGGASAKG  359

Query  552  ATNWMMGDIAAYL-KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            A NW+  DIAAYL  N  L I +I L P+ L+ELI+ I+  TISGKI KEIL E++ KGG
Sbjct  360  AANWVTQDIAAYLNSNLDLDITKIALKPEMLAELITLIENGTISGKIAKEILPELLEKGG  419

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            + K +++ K LV I DP E+ K++D+V+A+NP +LEQ+R GKTKLQG+F GQ+MK++ G+
Sbjct  420  SPKQIVESKGLVSISDPDELAKIIDEVLAENPDKLEQFRAGKTKLQGFFVGQLMKKTGGR  479

Query  195  ANPKMLNKILLEKLNA  148
            A PK+ N+IL +KLN 
Sbjct  480  AEPKLANQILNKKLNG  495



>ref|WP_013324449.1| glutamyl-tRNA amidotransferase subunit B [Cyanothece sp. PCC 
7822]
 gb|ADN16386.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. 
PCC 7822]
Length=495

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            +PELP  KR RYE+ +GLS  D   LT++  +AE+F+  +  GA+ KL  NW+  DIAAY
Sbjct  313  IPELPAQKRHRYEEELGLSAYDARVLTDEREVAEYFETAVASGANAKLVANWVTQDIAAY  372

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L N KL I +I L P+ L EL++ I+  TISGKI K+IL E++  GG+ K ++++K L+Q
Sbjct  373  LNNNKLKITDIALKPEGLGELVNLIEKGTISGKIAKDILPELLTDGGSPKALVEKKGLIQ  432

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D +E+EK++D+VIA +P++LE+YR GK  L+G+F GQV+K++ G+A+PK+ N+++ +K
Sbjct  433  ISDTKELEKIIDEVIASHPQELEKYRSGKKNLKGFFVGQVLKKTGGRADPKLTNQLIDKK  492

Query  156  LNA  148
            L A
Sbjct  493  LEA  495



>ref|WP_028953064.1| glutamyl-tRNA amidotransferase [Synechococcus sp. CC9616]
Length=495

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ +  +S  + LPELP  KR RY K +GLS  D   LT++  +A++F+A +  GAD 
Sbjct  299  IEVSSEQRESWRSQLPELPAAKRHRYAKALGLSQYDARVLTDERPMADYFEAVVSAGADA  358

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+ GDIAAY+ + +LS  E+    ++L+E++  I+   ISGKI KEIL E++ KG
Sbjct  359  KLAANWITGDIAAYVNSNRLSYTELPFRAEQLAEMVQLIESGKISGKIAKEILPELLEKG  418

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++  + L  I DP  IE +VD+++A +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  419  GSPKAIVDGRGLGMISDPAAIEAIVDELLAAHPAEVEAFRGGKTKLQGFFVGQLMKKTGG  478

Query  198  KANPKMLNKILLEKLNA  148
            KA+PK+ N+IL  KL A
Sbjct  479  KADPKLANRILSTKLKA  495



>ref|WP_018397619.1| glutamyl-tRNA amidotransferase subunit B [filamentous cyanobacterium 
ESFC-1]
Length=497

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 139/185 (75%), Gaps = 3/185 (2%)
 Frame = -3

Query  699  NSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE + GLS  D   LT+D ++A++F+A + +GA+ K   NW+MGDIA
Sbjct  311  SQLPELPAQKRDRYESEYGLSAYDTRILTDDLDVAQYFEAAVAKGANPKTVANWVMGDIA  370

Query  522  AYLKNEKL-SINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG-GTVKGMIKEK  349
            AY+ +EKL SI E+ L  + L+ELI+ I+ +TISGKI KEIL +++ K   +V+ +++ K
Sbjct  371  AYVNSEKLNSITEVVLKAETLAELIALIEDKTISGKIAKEILPDLLTKEVKSVQKLVESK  430

Query  348  DLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKI  169
             L+QI +P E++ ++DKV+A NP ++EQ+R GKTKLQG+F GQVMKE+ G+A+PK+ N+I
Sbjct  431  GLIQISNPDELDAIIDKVLAANPDKVEQFRNGKTKLQGFFVGQVMKETSGRADPKLTNQI  490

Query  168  LLEKL  154
            L +KL
Sbjct  491  LGKKL  495



>ref|WP_009788701.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. BL107]
 gb|EAU71339.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Synechococcus 
sp. BL107]
Length=494

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RY + +GLS  D   LT++  +A++F+A +  GAD KL+ NW+ GD+AAY
Sbjct  311  LPELPAAKRHRYADDLGLSQYDARVLTDERQMADYFEAVVTAGADAKLSANWITGDLAAY  370

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            + + +LS   +   P++LSE++  I G  ISGKI KEIL E++ KGG+ K ++ E+ L  
Sbjct  371  VNSNRLSFAALPFRPEQLSEMVQLIDGGKISGKIAKEILPELLEKGGSPKAIVDERGLGM  430

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP  IE +VD+++  +P+++E +RGGKTKLQG+F GQ+MK++ GKA+PK+ N+IL +K
Sbjct  431  ISDPAAIEAIVDELLGAHPEEVEAFRGGKTKLQGFFVGQLMKKTGGKADPKLANQILSQK  490

Query  156  L  154
            L
Sbjct  491  L  491



>ref|WP_011360908.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. CC9902]
 sp|Q3AVV7.1|GATB_SYNS9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus sp. 
CC9902]
 gb|ABB27127.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Synechococcus 
sp. CC9902]
Length=494

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RY + +GLS  D   LT++  +A++F+A +  GAD KL+ NW+ GD+AAY
Sbjct  311  LPELPAAKRHRYADDLGLSQYDARVLTDERQMADYFEAVVTAGADAKLSANWITGDLAAY  370

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            + + +LS   +   P++LSE++  I G  ISGKI KEIL E++ KGG+ K ++ E+ L  
Sbjct  371  VNSNRLSFAALPFRPEQLSEMVQLIDGGKISGKIAKEILPELLEKGGSPKAIVDERGLGM  430

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP  IE +VD+++  +P+++E +RGGKTKLQG+F GQ+MK++ GKA+PK+ N+IL +K
Sbjct  431  ISDPAAIEAIVDELLGAHPEEVEAFRGGKTKLQGFFVGQLMKKTGGKADPKLANQILSQK  490

Query  156  L  154
            L
Sbjct  491  L  491



>emb|CDP09051.1| unnamed protein product [Coffea canephora]
Length=283

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            VT++++YVD + +SLPELPE+KRRRYE MGLSMQDVLFL ND N+AEFFDATI   ADVK
Sbjct  102  VTLSEEYVDGIRSSLPELPEIKRRRYENMGLSMQDVLFLANDINVAEFFDATIANAADVK  161

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW+MGDIAAY+KNEKLSI+EIKLTP EL ELI++IKG TISGKIGKE+   I+    
Sbjct  162  LAANWIMGDIAAYMKNEKLSISEIKLTPLELGELIASIKGGTISGKIGKEVKLFIIGISW  221

Query  375  T  373
            T
Sbjct  222  T  222



>ref|WP_012308131.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. PCC 
7002]
 sp|B1XKN8.1|GATB_SYNP2 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus sp. 
PCC 7002]
 gb|ACB00513.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Synechococcus 
sp. PCC 7002]
Length=496

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 137/196 (70%), Gaps = 2/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +T   ++     LPE P  KR RYE + GLS  D   LT+D ++AE+F+A +  GAD 
Sbjct  299  IEVTPAQLEKWAAELPETPAQKRERYETEYGLSSYDTRVLTDDRDVAEYFEAAVAAGADP  358

Query  558  KLATNWMMGDIAAYL-KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAK  382
            K  TNW+  DIAA+L KN  L+I E+ L   +L+EL++ I   TISGKI KEIL E++ +
Sbjct  359  KQVTNWVTQDIAAHLNKNVGLTIVELPLKATQLAELVNLIHDGTISGKIAKEILPELLEQ  418

Query  381  GGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESK  202
            GG+ K +++ + L QI D   +E MVD+V+A NP+++EQ+R GKTKLQG+F GQ+MK++ 
Sbjct  419  GGSPKAIVESRGLTQISDTGALEAMVDEVLAANPEKVEQFRAGKTKLQGFFVGQLMKKTS  478

Query  201  GKANPKMLNKILLEKL  154
            G+A+PK+LN+IL +KL
Sbjct  479  GRADPKLLNQILAQKL  494



>ref|WP_011377450.1| MULTISPECIES: glutamyl-tRNA amidotransferase subunit B [Synechococcus]
 sp|Q31S19.1|GATB_SYNE7 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus elongatus 
PCC 7942]
 gb|ABB56150.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Synechococcus 
elongatus PCC 7942]
 gb|AJD56795.1| glutamyl-tRNA amidotransferase [Synechococcus sp. UTEX 2973]
Length=494

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 143/195 (73%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +++   ++  + LPELP  KR RY E+ GLS  D   LT++ + A++++AT+  GAD 
Sbjct  298  IEVSETQRETWRSELPELPAQKRHRYAEQYGLSAYDARVLTDEKSTADYYEATVAAGADA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDIAAY+   KL ++++ L PQ+L+EL++ I+  TISGKI KEIL E++ KG
Sbjct  358  KQAANWLMGDIAAYVNANKLLVSDLPLQPQDLAELVNLIEAGTISGKIAKEILPELLEKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L QI DP +IE +VD+++A +P +LEQ+R GKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKAIVEAKGLTQISDPAQIEALVDELLAAHPTELEQFRAGKTKLQGFFVGQLMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            + +PK+ N+IL +KL
Sbjct  478  RVDPKLSNQILNQKL  492



>ref|WP_011243698.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus elongatus]
 sp|Q5N294.1|GATB_SYNP6 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus elongatus 
PCC 6301]
 dbj|BAD79576.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Synechococcus 
elongatus PCC 6301]
Length=494

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 143/195 (73%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +++   ++  + LPELP  KR RY E+ GLS  D   LT++ + A++++AT+  GAD 
Sbjct  298  IEVSETQRETWRSELPELPAQKRHRYAEQYGLSAYDARVLTDEKSTADYYEATVAAGADA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A NW+MGDIAAY+   KL ++++ L PQ+L+EL++ I+  TISGKI KEIL E++ KG
Sbjct  358  KQAANWLMGDIAAYVNANKLLVSDLPLQPQDLAELVNLIEAGTISGKIAKEILPELLEKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++ K L QI DP +IE +VD+++A +P +LEQ+R GKTKLQG+F GQ+MK++ G
Sbjct  418  GSPKAIVEAKGLTQISDPAQIEALVDELLAAHPTELEQFRAGKTKLQGFFVGQLMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            + +PK+ N+IL +KL
Sbjct  478  RVDPKLSNQILNQKL  492



>ref|WP_030007769.1| glutamyl-tRNA amidotransferase [Synechococcus sp. NKBG042902]
Length=496

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 136/196 (69%), Gaps = 2/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +T   ++     LPE P  KR RYE + GLS  D   LT+D ++AE+F+A +  GAD 
Sbjct  299  IEVTPAQLEKWAAELPETPAQKRERYETEYGLSSYDTRVLTDDRDVAEYFEAAVAAGADP  358

Query  558  KLATNWMMGDIAAYL-KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAK  382
            K  TNW+  DIAA+L KN  L+I E+ L   +L+EL++ I   TISGKI KEIL E++ +
Sbjct  359  KQVTNWVTQDIAAHLNKNVGLTIVELPLKATQLAELVNLIHDGTISGKIAKEILPELLEQ  418

Query  381  GGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESK  202
            GG+ K ++  + L QI D   +E MVD+V+A NP+++EQ+R GKTKLQG+F GQ+MK++ 
Sbjct  419  GGSPKAIVDSRGLTQISDTGALEAMVDEVLAANPEKVEQFRAGKTKLQGFFVGQLMKKTS  478

Query  201  GKANPKMLNKILLEKL  154
            G+A+PK+LN+IL +KL
Sbjct  479  GRADPKLLNQILAQKL  494



>ref|WP_044105934.1| glutamyl-tRNA amidotransferase [cyanobacterium endosymbiont of 
Epithemia turgida]
 dbj|BAP17253.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=495

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 137/193 (71%), Gaps = 1/193 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            I+ + +++   ++PELP  KR+RYEK +G+S  D   +T+D NIA+F++  +  GAD KL
Sbjct  301  ISPEQLENWRKTIPELPAQKRKRYEKKLGISAYDARVITDDLNIADFYEKAVETGADAKL  360

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+  DIAAYL N KL I EI L P  L ELI  I+ E ISGKI KEIL E++ KGG+
Sbjct  361  VANWVTQDIAAYLNNSKLDITEIALKPVNLGELIRLIEKEIISGKIAKEILPELLEKGGS  420

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             + ++K K + QI D +EIEK++D+++  NP +LE++R GK KL+ +F GQVMK++ G+A
Sbjct  421  PEKLVKAKGITQISDIKEIEKIIDEILLANPNELEKFRNGKPKLKSFFIGQVMKKTGGRA  480

Query  192  NPKMLNKILLEKL  154
            +PK+ N+++ +KL
Sbjct  481  DPKLTNQLVEKKL  493



>ref|WP_043327225.1| glutamyl-tRNA amidotransferase [Cyanobium gracile]
Length=481

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ +  +S    LPELP  KR RY E +GLS+ D   LT++  +AE+F+A +  G D 
Sbjct  285  IEVSPEQRESWRAELPELPAAKRHRYAESLGLSIYDARVLTDERPMAEYFEAAVAAGGDP  344

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+ GDIAA++   +LSI E+ L P++L+E++  I+G TISGKI K++L E++ KG
Sbjct  345  KAVANWVTGDIAAHVNANRLSIAELPLKPEQLAEMVQLIEGGTISGKIAKDLLPELLEKG  404

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+V  +++ + L  I DP  I  +VD+++A +P+++  +RGGKTKLQG+F GQ+MK + G
Sbjct  405  GSVAAIVEARGLGMISDPAAITAIVDELLAAHPEEVAAFRGGKTKLQGFFVGQLMKRTGG  464

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N+IL E+L
Sbjct  465  RADPKLANRILSEQL  479



>ref|WP_036531366.1| glutamyl-tRNA amidotransferase [Neosynechococcus sphagnicola]
 gb|KGF73565.1| glutamyl-tRNA amidotransferase [Neosynechococcus sphagnicola 
sy1]
Length=496

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 130/184 (71%), Gaps = 1/184 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE  +GLS  D   LT+D  +AE+F+ATI   A+ K A NW+MGDIA
Sbjct  312  SELPELPAQKRHRYETHLGLSAYDARVLTDDRTVAEYFEATIAASANAKSAANWIMGDIA  371

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            A+L  EKL I EI L P  L+EL++ I+  TIS KI K++L E++ +GG+   ++++K L
Sbjct  372  AHLNTEKLRITEIPLQPTALAELVTLIENNTISSKIAKDLLPELLTQGGSPLALVEQKGL  431

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
             QI D   +E  +D V+A NPK+L QYR GKTKL G+F GQVMK++ G+A+PK+ N++L 
Sbjct  432  TQISDTGALETAIDTVMAANPKELAQYRNGKTKLLGFFVGQVMKQTGGRADPKLTNQLLT  491

Query  162  EKLN  151
            +KLN
Sbjct  492  QKLN  495



>gb|AFY29834.1| glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, 
B subunit [Cyanobium gracile PCC 6307]
Length=498

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ +  +S    LPELP  KR RY E +GLS+ D   LT++  +AE+F+A +  G D 
Sbjct  302  IEVSPEQRESWRAELPELPAAKRHRYAESLGLSIYDARVLTDERPMAEYFEAAVAAGGDP  361

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+ GDIAA++   +LSI E+ L P++L+E++  I+G TISGKI K++L E++ KG
Sbjct  362  KAVANWVTGDIAAHVNANRLSIAELPLKPEQLAEMVQLIEGGTISGKIAKDLLPELLEKG  421

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+V  +++ + L  I DP  I  +VD+++A +P+++  +RGGKTKLQG+F GQ+MK + G
Sbjct  422  GSVAAIVEARGLGMISDPAAITAIVDELLAAHPEEVAAFRGGKTKLQGFFVGQLMKRTGG  481

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N+IL E+L
Sbjct  482  RADPKLANRILSEQL  496



>ref|WP_028947219.1| glutamyl-tRNA amidotransferase [Synechocystis sp. PCC 6714]
 gb|AIE75407.1| Aspartyl-tRNA(Asn) amidotransferase subunit B / Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Synechocystis sp. PCC 6714]
Length=495

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 125/178 (70%), Gaps = 1/178 (1%)
 Frame = -3

Query  696  SLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAA  520
            SLPELP  KR RYE+  GLS  D   LT D  +A +F+  +  GAD K  TNW+  DIAA
Sbjct  311  SLPELPSAKRNRYEQEFGLSAYDARVLTEDREVALYFEEAVAAGADPKAVTNWVTQDIAA  370

Query  519  YLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            YL N +L++ E+ L P  L++LI+ I   TISGKI K+IL E++ KGG+ + +I+ + L+
Sbjct  371  YLNNNRLTVGELALKPTALADLIALITKGTISGKIAKDILPELLEKGGSPQKIIEARGLI  430

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKIL  166
            QI DP+E+  ++  VIAD+PK+LE++R GK  +QG+F GQVMK S GKA+PK+ N+++
Sbjct  431  QISDPEELTTIIKAVIADHPKELEKFRSGKGNMQGFFVGQVMKRSGGKADPKLTNQLI  488



>ref|WP_016648124.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Facklamia 
hominis]
 gb|EPH11793.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Facklamia 
hominis ACS-120-V-Sch10]
Length=476

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 137/197 (70%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            VTI+Q+++D V  S+PE+PE +R+RY K   L   D + LT   ++++FFDAT+  GAD 
Sbjct  279  VTISQEWMDQVRASMPEMPEERRQRYTKDYDLPEYDAMVLTLQKDLSDFFDATVAEGADP  338

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A+NW+MG+++AYL  +++S+ E  L P  L+++I  I   TIS KI K++   +  KG
Sbjct  339  KQASNWLMGEVSAYLNAQQVSLKETGLNPHNLAQMIRLIDNGTISSKIAKQVFKHLAQKG  398

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G  + +++EK L QI DP  ++ M+D +I  +PK +E Y+ GK +  G+F GQVMK+++G
Sbjct  399  GDAEVIVEEKGLAQISDPSVLKPMIDTIIEGDPKSVEDYKNGKDRALGFFVGQVMKQTRG  458

Query  198  KANPKMLNKILLEKLNA  148
            KANP+++N+++L+KL +
Sbjct  459  KANPQVVNQLILDKLQS  475



>ref|WP_043693520.1| glutamyl-tRNA amidotransferase [Synechococcus sp. KORDI-49]
 gb|AII46404.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. KORDI-49]
Length=492

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +S    LPELP  KR RY +++GLS  D   LT++  +A++F+A +  GAD 
Sbjct  295  IEVSADQRESWRAELPELPAAKRHRYADELGLSQYDARVLTDERPMADYFEAVVAAGADA  354

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KL+ NW+ GDIAA++ + +L  +++   P++L+E++  I G  ISGKI KEIL +++ KG
Sbjct  355  KLSANWITGDIAAHVNSNRLGYDDLPFRPEQLAEMVKLIDGGKISGKIAKEILPDLLEKG  414

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  IE +V+ ++A +P ++E +RGGKTKLQG+F GQ+MK++ G
Sbjct  415  GSPKALVDERGLGMISDPAAIEAIVNDLLAAHPGEVEAFRGGKTKLQGFFVGQLMKKTGG  474

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL  +L
Sbjct  475  KADPKLANQILSRRL  489



>ref|WP_024545250.1| glutamyl-tRNA amidotransferase [Synechococcus sp. NKBG15041c]
Length=496

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 137/196 (70%), Gaps = 2/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +TQ  ++     LPE P  KR RYE + GLS  D   LT+D ++AE+F+A +  GAD 
Sbjct  299  IEVTQAQLEKWAAELPETPAQKRARYETEYGLSGYDTRVLTDDRDVAEYFEAAVAAGADP  358

Query  558  KLATNWMMGDIAAYL-KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAK  382
            K  TNW+  DIAA+L K+  L+I ++ LT   L+EL++ I   TISGKI KEIL E++ K
Sbjct  359  KQVTNWVTQDIAAHLNKSVGLTIGDLPLTAVHLAELVNLINDGTISGKIAKEILPELLEK  418

Query  381  GGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESK  202
            GG+ K +++ + L QI D   +E M+D+++A NP ++EQ+R GKTKLQG+F GQ+MK++ 
Sbjct  419  GGSPKAIVESRGLTQISDTGALEAMIDEILAANPDKVEQFRAGKTKLQGFFVGQLMKKTS  478

Query  201  GKANPKMLNKILLEKL  154
            G+A+P++LN++L +KL
Sbjct  479  GRADPQLLNQLLAQKL  494



>ref|WP_015783514.1| glutamyl-tRNA amidotransferase subunit B [Cyanothece sp. PCC 
8802]
 gb|ACV00117.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. 
PCC 8802]
Length=495

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE + GLS  D   LT+D ++A +++A +  GAD KL  NW+  DIA
Sbjct  311  HQLPELPAQKRSRYEAEFGLSAYDARVLTDDRDVANYYEAAVAAGADAKLVANWVTQDIA  370

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYL N KL+I EI LTPQ L EL+  I+  TISGKI KEIL E++ KGG+ K ++ +K +
Sbjct  371  AYLNNNKLAIAEIVLTPQSLGELVQLIETGTISGKIAKEILPELLEKGGSPKELVAKKGM  430

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
             QI D  E+EK++D++IA NPK+LE++R GKT L+G+F GQVMK++ G+A+PK+ N+++ 
Sbjct  431  TQISDLGELEKIIDEIIAANPKELEKFRSGKTNLKGFFVGQVMKQTGGRADPKLTNQLVD  490

Query  162  EKL  154
            +KL
Sbjct  491  QKL  493



>ref|WP_012594503.1| glutamyl-tRNA amidotransferase subunit B [Cyanothece sp. PCC 
8801]
 sp|B7K293.1|GATB_CYAP8 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Cyanothece sp. PCC 
8801]
 gb|ACK65229.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Cyanothece sp. 
PCC 8801]
Length=495

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RYE + GLS  D   LT+D ++A +++A +  GAD KL  NW+  DIA
Sbjct  311  HQLPELPAQKRSRYEAEFGLSAYDARVLTDDRDVANYYEAAVAAGADAKLVANWVTQDIA  370

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYL N KL+I EI LTPQ L EL+  I+  TISGKI KEIL E++ KGG+ K ++ +K +
Sbjct  371  AYLNNNKLAIAEIVLTPQSLGELVQLIETGTISGKIAKEILPELLEKGGSPKELVAKKGM  430

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
             QI D  E+EK++D++IA NPK+LE++R GKT L+G+F GQVMK++ G+A+PK+ N+++ 
Sbjct  431  TQISDLGELEKIIDEIIAANPKELEKFRSGKTNLKGFFVGQVMKQTGGRADPKLTNQLVD  490

Query  162  EKL  154
            +KL
Sbjct  491  QKL  493



>ref|WP_011129209.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. WH 
8102]
 sp|Q7U3S3.1|GATB_SYNPX RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus sp. 
WH 8102]
 emb|CAE08871.1| glutamyl-tRNA (Gln) amidotransferase subunit B [Synechococcus 
sp. WH 8102]
Length=491

 Score =   184 bits (466),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 138/195 (71%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  ++  + LPELP +KR RY + +GLS  D   LT++  +A++F+A +  GAD 
Sbjct  295  IEVSVDQREAWRSELPELPAVKRHRYADDLGLSQYDARVLTDERPMADYFEAVVAAGADA  354

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KL+ NW+ GDIAA++ + +LS  E+   P++L+E++  I G  ISGKI KEIL E++ KG
Sbjct  355  KLSANWITGDIAAHVNSNRLSYAELPFRPEQLAEMVQLIDGGKISGKIAKEILPELLEKG  414

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  ++ +VD+++A +P +++ +RGGK KLQG+F GQ+MK++ G
Sbjct  415  GSPKAIVDERGLGMISDPAALQAIVDELLAAHPDEVKAFRGGKNKLQGFFVGQLMKKTGG  474

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  475  KADPKLANQILSKKL  489



>ref|WP_015134085.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Leptolyngbya 
sp. PCC 7376]
 gb|AFY38320.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Leptolyngbya 
sp. PCC 7376]
Length=495

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 138/195 (71%), Gaps = 2/195 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            ++++ ++++  +LPE P  KR RY  + GLS  D   LT+D ++AE+F+  +  GAD K 
Sbjct  300  VSKEQLEAIAAALPETPAQKRARYLSEYGLSSYDTRVLTDDRDVAEYFETAVASGADPKQ  359

Query  552  ATNWMMGDIAAYL-KNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             TNW+  DIAA+L KN  L+IN++ LT   L+EL++ I   TISGKI KEIL E++ KGG
Sbjct  360  VTNWVTQDIAAHLNKNVDLTINDLPLTAASLAELVNLINDGTISGKIAKEILPELLEKGG  419

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
            + K +++ K L QI D  E+E M+D+++  NP ++E +R GK KLQG+F GQ+MK++ G+
Sbjct  420  SPKKIVESKGLTQISDTGELEAMIDELLTANPDKVEAFRAGKKKLQGFFVGQMMKKTSGR  479

Query  195  ANPKMLNKILLEKLN  151
            A+PK++N++L +KLN
Sbjct  480  ADPKLVNQLLAKKLN  494



>ref|WP_011620631.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. CC9311]
 gb|ABI47887.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Synechococcus 
sp. CC9311]
Length=494

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 131/183 (72%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RY + +GLS  D   LT++ ++A++F++ +  GAD KL+ NW+ GDIA
Sbjct  310  SELPELPSAKRHRYADALGLSQYDARVLTDERSMAQYFESVVADGADAKLSANWITGDIA  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AY+ + +L+  E+   P++L+E++  I G  ISGKI KEIL E++ KGG+ K ++ E+ L
Sbjct  370  AYVNSNRLTFAELAFRPEQLAEMVKLIDGGKISGKIAKEILPELLEKGGSPKAIVDERGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              I DP  I  +V++++A +P ++E +RGGK KLQG+F GQ+MK++ GKA+PK+ N+IL 
Sbjct  430  GMISDPAAITAIVEELLAAHPDEVEAFRGGKNKLQGFFVGQLMKKTGGKADPKLANQILS  489

Query  162  EKL  154
            +KL
Sbjct  490  QKL  492



>ref|WP_017711578.1| glutamyl-tRNA amidotransferase subunit B [Prochlorothrix hollandica]
Length=503

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 125/184 (68%), Gaps = 2/184 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + +PELP  KR RYE  +GLS  D   LT+D   A +F+ TI  GA+ K A NW+MGDIA
Sbjct  317  SEVPELPAQKRHRYEDDLGLSAYDARVLTDDQATAAYFETTIAAGAEPKQAANWIMGDIA  376

Query  522  AYLKNEK-LSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKD  346
            AYL   K L+I  + LTP  L+EL+  I   TISGKI K++L +++  GG+ K M+  + 
Sbjct  377  AYLNGHKDLTITTLPLTPPVLAELVDLITSGTISGKIAKDLLPQLLESGGSPKAMVASQG  436

Query  345  LVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKIL  166
            L QI DP  IE +V +VI  +P++LEQ+R GKTKLQG+F GQ+MK++ G+ +PK+ N+IL
Sbjct  437  LTQISDPAAIEALVLEVINAHPQELEQFRAGKTKLQGFFVGQLMKKTGGRVDPKLTNQIL  496

Query  165  LEKL  154
            +  L
Sbjct  497  IRHL  500



>ref|WP_022482493.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:729]
 emb|CDE88971.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:729]
Length=480

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 133/193 (69%), Gaps = 0/193 (0%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLA  550
            I++++V  + + +PELP+ KR RY  +GLS  D   +     +A FFD  +  GA+ K+A
Sbjct  288  ISREWVQEIKDKMPELPQAKRERYMSLGLSEYDACVIVEQMGLALFFDEVLKAGANPKIA  347

Query  549  TNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTV  370
             N++MG+IAAYLK EK+ IN+ KLTP+ L+ELI+ I+  TIS  IGK+I+ ++M  G   
Sbjct  348  VNFIMGEIAAYLKEEKIEINDTKLTPENLAELIAMIEKNTISNNIGKQIILDMMKDGAKA  407

Query  369  KGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKAN  190
              +++++ L QI D   I+ +V K++  NP Q+E Y+GGKT+L G+F GQVMKE+KG+AN
Sbjct  408  SKIVEDRGLSQISDEGAIKSIVQKIVDANPNQVEAYKGGKTQLLGFFVGQVMKETKGRAN  467

Query  189  PKMLNKILLEKLN  151
            PK +N +L E L+
Sbjct  468  PKTVNDLLKEILD  480



>dbj|BAM54977.1| aspartyl/glutamyl-tRNA amidotransferase subunitB [Synechocystis 
sp. PCC 6803]
Length=439

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -3

Query  696  SLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAA  520
            +LPELP  KR RYE K+GLS  D   LT D ++A +F+  +  GAD K   NW+  DIAA
Sbjct  255  TLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGADPKAVANWVTQDIAA  314

Query  519  YLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            YL N +L+I+ + L P  L+ELI  I   TISGKI K+IL E++ KGG+ + +I+ + LV
Sbjct  315  YLNNNRLTISGLALKPSALAELIDLITKGTISGKIAKDILPELLEKGGSPQKIIEARGLV  374

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKIL  166
            QI DP E+  ++  VIAD+PK+LE++R GK  +QG+F GQVMK + GKA+PK+ N+++
Sbjct  375  QISDPDELTAIIQAVIADHPKELEKFRSGKGNMQGFFVGQVMKRTGGKADPKLTNQLI  432



>ref|WP_017305024.1| glutamyl-tRNA amidotransferase subunit B [Spirulina subsalsa]
Length=500

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 132/182 (73%), Gaps = 2/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RYE+ + LS  D   LT+D  IAE+F++ I + A+ K   NW+MGDIAAY
Sbjct  317  LPELPAQKRHRYEEELELSAYDARVLTDDREIAEYFESAIAQNANPKQVANWLMGDIAAY  376

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG-GTVKGMIKEKDLV  340
            L +EKLSI EI L P  L+EL++ I   TISGKI KEIL E++     +++  ++ K ++
Sbjct  377  LNSEKLSIGEIALKPSILAELVNLIDQGTISGKIAKEILPELLTTPIDSLQKFVESKGMI  436

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLE  160
            QI D  E+EK++DK++++N  ++EQ+R GKTKLQG+F GQ+MKE+ G+A+PK+ N++L +
Sbjct  437  QISDTGELEKIIDKILSENADKVEQFRNGKTKLQGFFVGQIMKETSGRADPKLTNQLLGK  496

Query  159  KL  154
            KL
Sbjct  497  KL  498



>ref|WP_011429268.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. JA-3-3Ab]
 sp|Q2JXB3.1|GATB_SYNJA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus sp. 
JA-3-3Ab]
 gb|ABC98579.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Synechococcus 
sp. JA-3-3Ab]
Length=490

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEKM-GLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP +KRRRY+++ GLS+ D  +L+++ N AE+F+A +  GAD K A NWMM DIA+Y
Sbjct  308  LPELPSVKRRRYQQVYGLSVYDSRYLSDERNTAEYFEAVVAAGADPKAAANWMMSDIASY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L   KL   +I L P+ L+ELI  I+  TIS KI KEIL E++ KGG+ + +++ K L Q
Sbjct  368  LNTHKLDYPDIALKPETLAELIGLIEQGTISSKIAKEILPELLEKGGSARALVEAKGLTQ  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   +E M+ +V+A+NP+QL+QYR GKTKL GYF GQ+MK+++G+A+PK+ N++L   
Sbjct  428  ISDSSLLEPMIAEVLAENPEQLQQYREGKTKLFGYFVGQLMKKTQGRADPKLANELLKRH  487

Query  156  LN  151
            L+
Sbjct  488  LD  489



>ref|WP_011432351.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. JA-2-3B'a(2-13)]
 sp|Q2JNH3.1|GATB_SYNJB RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechococcus sp. 
JA-2-3B'a(2-13)]
 gb|ABD01693.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Synechococcus 
sp. JA-2-3B'a(2-13)]
Length=490

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEKM-GLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP +KRRRY+++ GLS+ D  +L+++ N AE+F+A I  GAD K A NWMM DIA+Y
Sbjct  308  LPELPGVKRRRYQEVYGLSVYDARYLSDERNTAEYFEAVIAAGADPKAAANWMMSDIASY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            L   KL   +I L P+ L+ELI  I+  TIS KI KEIL E++ KGG+ + +++ K + Q
Sbjct  368  LNTHKLDYPDIALKPETLAELIGLIEQGTISSKIAKEILPELLEKGGSARALVEAKGMTQ  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   + +M+ +V+A+NP+QL+QYRGGKTKL GYF GQ+MK+++G+A+PK+ N +L + 
Sbjct  428  ISDSALLGQMIAEVLAENPEQLQQYRGGKTKLFGYFVGQLMKKTQGRADPKLANDLLKQH  487

Query  156  LN  151
            L+
Sbjct  488  LD  489



>ref|WP_006908174.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Facklamia 
hominis]
 gb|EKB54663.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Facklamia 
hominis CCUG 36813]
Length=476

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            VTI+Q+++D V  S+PE+PE +R RY K   L   D + LT   ++++FFDAT+  GAD 
Sbjct  279  VTISQEWMDQVRASMPEMPEERRLRYTKDYDLPEYDAMVLTLQKDLSDFFDATVAEGADP  338

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A+NW+MG+++AYL  +++S+ E  L P  L+++I  I   TIS KI K++  ++   G
Sbjct  339  KQASNWLMGEVSAYLNAQQVSLKETGLNPHNLAQMIRLIDNGTISSKIAKQVFKDLAQNG  398

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G  + +++EK L QI DP  ++ M+D +I  +PK +E Y+ GK +  G+F GQVMK+++G
Sbjct  399  GDAEVIVEEKGLAQISDPSVLKPMIDTIIEGDPKSVEDYKNGKDRALGFFVGQVMKQTRG  458

Query  198  KANPKMLNKILLEKLNA  148
            KANP+++N+++L+KL +
Sbjct  459  KANPQVVNQLILDKLQS  475



>ref|WP_014407113.1| glutamyl-tRNA amidotransferase subunit B [Synechocystis sp. PCC 
6803]
 sp|P74215.2|GATB_SYNY3 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Synechocystis sp. 
PCC 6803 substr. Kazusa]
 dbj|BAK50482.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Synechocystis 
sp. PCC 6803]
 dbj|BAL29481.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Synechocystis 
sp. PCC 6803 substr. GT-I]
 dbj|BAL32650.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Synechocystis 
sp. PCC 6803 substr. PCC-N]
 dbj|BAL35819.1| glutamyl-tRNA(Gln) amidotransferase subunit B [Synechocystis 
sp. PCC 6803 substr. PCC-P]
Length=495

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -3

Query  696  SLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAA  520
            +LPELP  KR RYE K+GLS  D   LT D ++A +F+  +  GAD K   NW+  DIAA
Sbjct  311  TLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGADPKAVANWVTQDIAA  370

Query  519  YLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            YL N +L+I+ + L P  L+ELI  I   TISGKI K+IL E++ KGG+ + +I+ + LV
Sbjct  371  YLNNNRLTISGLALKPSALAELIDLITKGTISGKIAKDILPELLEKGGSPQKIIEARGLV  430

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKIL  166
            QI DP E+  ++  VIAD+PK+LE++R GK  +QG+F GQVMK + GKA+PK+ N+++
Sbjct  431  QISDPDELTAIIQAVIADHPKELEKFRSGKGNMQGFFVGQVMKRTGGKADPKLTNQLI  488



>ref|XP_005645477.1| B subunit of glutamyl-tRNA amidotransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20933.1| B subunit of glutamyl-tRNA amidotransferase [Coccomyxa subellipsoidea 
C-169]
Length=499

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 131/194 (68%), Gaps = 2/194 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            + ++   +D    ++PE+P   R RY  + L   DV+ L ++  I+ +FDA +  GA  K
Sbjct  296  LHVSDALIDEEKENMPEVPRAVRGRYVDLNLPAADVVILADEKPISGYFDAVVAAGASPK  355

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
            LA NW++GD+ A+ K  K S +++ LTP  L+EL++AI+   ISGKIGK++L +++  G 
Sbjct  356  LAANWVLGDLMAFTKESKCSFDDLLLTPATLAELVNAIEEGVISGKIGKQVLPKLLKDG-  414

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
             VK  +KE+ L+QI DP  IE +VD V+A NPKQL+ Y  GK KLQG+F GQVMK  KG 
Sbjct  415  -VKAFLKEQGLIQISDPAAIESIVDSVLAANPKQLQDYCAGKKKLQGFFVGQVMKAFKGL  473

Query  195  ANPKMLNKILLEKL  154
            ANP+MLN++L++KL
Sbjct  474  ANPEMLNQLLMKKL  487



>ref|WP_007099233.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. RS9916]
 gb|EAU75136.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Synechococcus 
sp. RS9916]
Length=495

 Score =   181 bits (459),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  ++  + LPELP  KR RY + +GLS  D   LT++  +A++F++ +  GAD 
Sbjct  298  IEVSVDQREAWRSELPELPAAKRHRYADTLGLSQYDARVLTDERPMADYFESVVAAGADA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KL+ NW+ GDIAAY+ + +L   E+   P++L+E++  I G  ISGKI KEIL E++ +G
Sbjct  358  KLSANWITGDIAAYVNSNRLHYAELPFRPEQLAEMVKMIDGGAISGKIAKEILPELLEQG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  I  +VD+++A +P ++  +RGGK KLQG+F GQ+MK++ G
Sbjct  418  GSPKAIVDERGLGMISDPAAITAIVDELLAAHPDEVAAFRGGKNKLQGFFVGQLMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  478  KADPKLANQILSKKL  492



>ref|WP_010872929.1| glutamyl-tRNA amidotransferase subunit B [Synechocystis sp. PCC 
6803]
 ref|NP_441629.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Synechocystis 
sp. PCC 6803]
 dbj|BAA18309.1| PET112 protein [Synechocystis sp. PCC 6803]
 gb|AGF51997.1| PET112 protein [Synechocystis sp. PCC 6803]
Length=519

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -3

Query  696  SLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAA  520
            +LPELP  KR RYE K+GLS  D   LT D ++A +F+  +  GAD K   NW+  DIAA
Sbjct  335  TLPELPSAKRARYEQKLGLSAYDARVLTEDRDVALYFEEAVNAGADPKAVANWVTQDIAA  394

Query  519  YLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLV  340
            YL N +L+I+ + L P  L+ELI  I   TISGKI K+IL E++ KGG+ + +I+ + LV
Sbjct  395  YLNNNRLTISGLALKPSALAELIDLITKGTISGKIAKDILPELLEKGGSPQKIIEARGLV  454

Query  339  QIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKIL  166
            QI DP E+  ++  VIAD+PK+LE++R GK  +QG+F GQVMK + GKA+PK+ N+++
Sbjct  455  QISDPDELTAIIQAVIADHPKELEKFRSGKGNMQGFFVGQVMKRTGGKADPKLTNQLI  512



>ref|WP_010313542.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. CB0205]
Length=490

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 129/183 (70%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RY E +GLS  D   LT++  +AEFF+A +  GAD K   NW+ GDIA
Sbjct  306  SELPELPAAKRHRYAEDLGLSQYDARVLTDERPMAEFFEAAVASGADPKGVANWITGDIA  365

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AY+   +LS +E+   P++++E++  I G  ISGKI KEIL E++ KGG+   ++ E+ L
Sbjct  366  AYVNANRLSYSELAFRPEQVAEMVKLIDGGKISGKIAKEILPELLEKGGSPAKIVDERGL  425

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              I DP  I  +V++++A +P+++E +RGGK KLQG+F GQ+MK++ GKA+PK++N+IL 
Sbjct  426  GMISDPAAITAIVEELLAAHPEEVEAFRGGKNKLQGFFVGQLMKKTGGKADPKLVNQILS  485

Query  162  EKL  154
            +KL
Sbjct  486  QKL  488



>ref|XP_002952066.1| hypothetical protein VOLCADRAFT_81690 [Volvox carteri f. nagariensis]
 gb|EFJ46857.1| hypothetical protein VOLCADRAFT_81690 [Volvox carteri f. nagariensis]
Length=519

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 132/196 (67%), Gaps = 2/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            +T++ ++V+ V  S+PELP  KR RY  +GLS  DV  LT++   ++ FDA +  GA VK
Sbjct  321  LTVSDEFVEQVKASMPELPAAKRARYLSLGLSRGDVAVLTDEIATSQLFDAVLALGAPVK  380

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A NW+ GDI AY K  K+ ++ + ++P  L+E+IS I+  TISGKI KE+L E++   G
Sbjct  381  PAANWIQGDIMAYCKESKVGMDGLSISPGALAEMISLIEDGTISGKIAKEVLPELLQGKG  440

Query  375  T--VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESK  202
               V+  I+ + L+ I D   I  M+DKV+  N KQL+++R GKTKLQGYF GQVMKESK
Sbjct  441  NEGVRPYIENRGLLMISDEAAIGAMIDKVLEANQKQLQEFRSGKTKLQGYFEGQVMKESK  500

Query  201  GKANPKMLNKILLEKL  154
            G+ NP ++ ++LL KL
Sbjct  501  GRVNPGLMKEMLLRKL  516



>ref|WP_025925749.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. scB241_528J8]
Length=490

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 128/183 (70%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR +Y  + GLS  D   ++++ N+A FF+ T+  GA+ KLA+NW+  DI  Y
Sbjct  308  LPELPSKKRNKYVSEFGLSAYDARVISDEINMANFFEETVANGAEAKLASNWVTSDIVGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK  KLS +++KL+P+ LSE+IS I   TISGKI KEIL E++ K  + K ++KEK L  
Sbjct  368  LKANKLSFSDLKLSPENLSEMISLISNNTISGKIAKEILPELIQKNISPKKLVKEKGLAM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I  ++D++I ++P +++ +R GKTKL G+F GQ+MK +KGKA+PK+ NK+L EK
Sbjct  428  ISDSSSILPIIDELITEHPDEVQAFRNGKTKLLGFFVGQLMKRTKGKADPKLANKLLAEK  487

Query  156  LNA  148
            L +
Sbjct  488  LKS  490



>ref|NP_973990.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
 gb|AEE32307.1| Glutamyl-tRNA(Gln) amidotransferase subunit B [Arabidopsis thaliana]
Length=475

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V +TQ+YVDS+  SLPELPE KRRRYE MGL MQDVLFL ND ++AE+FDA IG+GA+VK
Sbjct  353  VILTQEYVDSIRASLPELPEAKRRRYEAMGLGMQDVLFLANDVSVAEYFDAVIGKGAEVK  412

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEI  403
            LA NW+M DIAAYLKNEKLSIN+IKLTPQEL+ELI+AIK  TISGKIGKE+
Sbjct  413  LAANWIMSDIAAYLKNEKLSINDIKLTPQELAELIAAIKDGTISGKIGKEV  463



>ref|WP_022247523.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:306]
 emb|CDC20150.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:306]
Length=483

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 133/195 (68%), Gaps = 0/195 (0%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVK  556
            V I++++V+ V   +PELPE KR+RYE +GLS  D   +      A F+D  +  GAD +
Sbjct  288  VEISREWVEEVRAKMPELPEAKRKRYESLGLSAYDANVMVEQMETALFYDEVLKLGADYR  347

Query  555  LATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGG  376
             A N ++GDI AYLK   ++INE KLTP+ L+EL+  I   TIS  I K+IL +++  G 
Sbjct  348  TANNLLVGDITAYLKENNININETKLTPKALAELVDLITKGTISNNIAKKILPQMLETGA  407

Query  375  TVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGK  196
              K +++++ L  I D   I+++V KV+A+NP Q++ Y+GGKT L G+F GQ+MKE+KG+
Sbjct  408  QPKEIVEKEGLSVISDEGAIKELVQKVVANNPAQVQAYKGGKTNLMGFFVGQIMKETKGR  467

Query  195  ANPKMLNKILLEKLN  151
            ANP+++NK+L E+LN
Sbjct  468  ANPQVINKLLSEELN  482



>ref|WP_035833664.1| glutamyl-tRNA amidotransferase [Cyanobium sp. CACIAM 14]
Length=481

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RY E +GLS+ D   LT++  +AE+F+A +  G D K   NW+ GDIAA+
Sbjct  299  LPELPAAKRHRYAEALGLSIYDARVLTDERPMAEYFEAAVAAGGDPKAVANWVTGDIAAH  358

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            +   +LSI E+ L P++L+E++  I+  TISGKI KEIL E++ KGG+ + +++ + L  
Sbjct  359  VNANRLSIAELPLRPEQLAEMVRLIEDGTISGKIAKEILPELLEKGGSPQAIVEARGLGM  418

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP  I  +V +++A +P+++  +RGGKTKLQG+F GQ+MK + G+A+PK+ N+IL E+
Sbjct  419  ISDPAAIGTIVAELLAAHPEEVAAFRGGKTKLQGFFVGQLMKRTGGRADPKLANRILSEQ  478

Query  156  L  154
            L
Sbjct  479  L  479



>ref|WP_021945712.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:967]
 emb|CCY62576.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Clostridium 
sp. CAG:967]
Length=480

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 132/192 (69%), Gaps = 0/192 (0%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLA  550
            I++++V  + + +PELP+ KR RY  +GLS  D   +     +A FFD  +  GA+ K+A
Sbjct  288  ISREWVQEIKDKMPELPQAKRERYMSLGLSEYDACVIVEQMGLALFFDEVLKSGANPKIA  347

Query  549  TNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTV  370
             N++MG+IAAYLK EK+ I + KLTP+ L+ELI+ I+  TIS  IGK+I+ ++M  G   
Sbjct  348  VNFIMGEIAAYLKEEKIEICDTKLTPENLAELIAMIEKNTISNNIGKQIILDMMKDGTKA  407

Query  369  KGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKAN  190
              +++++ L QI D   I+++V KV+  NP Q+E Y+GGKT+L G+F GQVMKE+KG+AN
Sbjct  408  SKIVEDRGLSQISDEGAIKEIVQKVVDANPNQVEAYKGGKTQLLGFFVGQVMKETKGRAN  467

Query  189  PKMLNKILLEKL  154
            PK +N +L E L
Sbjct  468  PKTVNDLLKEIL  479



>ref|WP_011124207.1| MULTISPECIES: glutamyl-tRNA amidotransferase subunit B [Prochlorococcus]
 ref|NP_874446.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 sp|Q7VEG1.1|GATB_PROMA RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|AAP99098.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit [Prochlorococcus 
marinus subsp. marinus str. CCMP1375]
 gb|KGG11643.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
LG]
 gb|KGG22349.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
SS2]
 gb|KGG22684.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
SS35]
 gb|KGG32894.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
SS51]
 gb|KGG36589.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus sp. SS52]
Length=492

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 131/183 (72%), Gaps = 1/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RY E++GLS+ D   LT+D  +A +F+  +  GAD KLA+NW+ GDIA
Sbjct  307  SELPELPSSKRHRYAEELGLSVYDARVLTDDYQMARYFEIVVLEGADPKLASNWITGDIA  366

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            A++   K S   + LTP++L+E++  I    ISGKI KEIL E++ KGG+ K +++E+ L
Sbjct  367  AHINANKKSFENLLLTPKQLAEMLLLISQGKISGKIAKEILPELLEKGGSPKELVEERGL  426

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              I DP+ +  +VD++++D P ++E YRGGK KLQG+F GQ+MK++ GKA+PK+ N+IL 
Sbjct  427  GMISDPKVLGAIVDQLLSDYPNEVESYRGGKNKLQGFFVGQLMKKTSGKADPKLGNQILT  486

Query  162  EKL  154
            +KL
Sbjct  487  KKL  489



>ref|WP_025943159.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. scB241_526B19]
Length=490

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 132/183 (72%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR +Y  + GLS  D   ++++ ++A FF+ T+  GA+VKLA+NW+  DI  Y
Sbjct  308  LPELPSKKRNKYVSQFGLSAYDARVISDEISMANFFEETVANGAEVKLASNWVTSDIVGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK+ KLS +E+KL+P+ L+E+IS I    ISGKI KEIL E++ K  + K +++EK L  
Sbjct  368  LKSNKLSFSELKLSPENLAEMISMISKNIISGKIAKEILPELIQKNISPKKLVEEKGLAM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I  ++D++I ++P +++ ++ GKTKL G+F GQ+MK +KGKA+PK++NK+L+EK
Sbjct  428  ISDSSSILPIIDELINEHPNEVQAFKNGKTKLLGFFVGQLMKRTKGKADPKLVNKLLMEK  487

Query  156  LNA  148
            LN+
Sbjct  488  LNS  490



>gb|KEF40891.1| glutamyl-tRNA amidotransferase [Cyanobium sp. CACIAM 14]
Length=505

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR RY E +GLS+ D   LT++  +AE+F+A +  G D K   NW+ GDIAA+
Sbjct  323  LPELPAAKRHRYAEALGLSIYDARVLTDERPMAEYFEAAVAAGGDPKAVANWVTGDIAAH  382

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            +   +LSI E+ L P++L+E++  I+  TISGKI KEIL E++ KGG+ + +++ + L  
Sbjct  383  VNANRLSIAELPLRPEQLAEMVRLIEDGTISGKIAKEILPELLEKGGSPQAIVEARGLGM  442

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP  I  +V +++A +P+++  +RGGKTKLQG+F GQ+MK + G+A+PK+ N+IL E+
Sbjct  443  ISDPAAIGTIVAELLAAHPEEVAAFRGGKTKLQGFFVGQLMKRTGGRADPKLANRILSEQ  502

Query  156  L  154
            L
Sbjct  503  L  503



>ref|WP_017867288.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Lactobacillus 
pobuzihii]
Length=477

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + I+ D++  V +S+PE+PE +R RY  + G++  D   LT    +++FF+AT+  GAD 
Sbjct  280  IHISDDWIKEVKDSIPEMPEQRRARYVNEWGVTEYDANVLTQTMEMSDFFEATVAAGADP  339

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA NW+MGD++AY+ ++KL + ++ LTP+ L+++I  IK ETIS KI K++  +I+A  
Sbjct  340  KLAANWLMGDVSAYMNDKKLELADLALTPEHLAQMIGLIKDETISSKIAKKVFKQIVAND  399

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
               K  ++EK +VQ+ DPQ ++ ++D+V+ +N K +E ++ GK +  G+  G +MK+++G
Sbjct  400  TDPKAWVEEKGMVQLSDPQTLQPIIDEVLDNNAKSIEDFKNGKDRAVGFLVGNIMKQTRG  459

Query  198  KANPKMLNKILLEKL  154
            KANPK++NK+L+  L
Sbjct  460  KANPKVVNKLLMASL  474



>ref|WP_021916640.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Brachyspira 
sp. CAG:484]
 emb|CCY23514.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Brachyspira 
sp. CAG:484]
Length=480

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 134/192 (70%), Gaps = 0/192 (0%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLA  550
            I++++V+ + + +PELPE KR+RY  +GLS  D   +    ++A FFD  +  GA+ K+A
Sbjct  288  ISREWVEEIRSKMPELPEAKRQRYMSLGLSEYDAGVIVEQMSLALFFDKVLELGANPKIA  347

Query  549  TNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTV  370
             N+MMG+IAAYLKNEKL I+E KLTP+ L ELI+ I+  TIS  IGK+I+ ++M  G   
Sbjct  348  VNFMMGEIAAYLKNEKLDISETKLTPENLVELIALIEKNTISNNIGKQIIIDMMKDGTKA  407

Query  369  KGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKAN  190
              +++++ L QI D   I+++  KV   NP+Q+E+Y+ GK +L G+F GQVMKE+KG+AN
Sbjct  408  SEIVEKRGLSQISDEGAIKEICQKVADANPEQVEKYKNGKVQLLGFFVGQVMKETKGRAN  467

Query  189  PKMLNKILLEKL  154
            PK +N ++ E L
Sbjct  468  PKAVNDLMKEIL  479



>ref|WP_006854108.1| glutamyl-tRNA amidotransferase subunit B [Synechococcus sp. WH 
8016]
 gb|EHA61901.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Synechococcus 
sp. WH 8016]
Length=494

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 133/195 (68%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  ++  + LPELP  KR RY   +GLS  D   LT++ ++A++F+  +  GAD 
Sbjct  298  IEVSIDQREAWRSELPELPSAKRHRYANALGLSQYDARVLTDERSMAQYFETVVAAGADA  357

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KL+ NW+ GDIAAY+ + +L+ + +   P++L+E++  I    ISGKI KEIL E++ KG
Sbjct  358  KLSANWITGDIAAYVNSNRLNFDALAFRPEQLAEMVKLIDSGKISGKIAKEILPELLEKG  417

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  I  +V++++A +P ++E +RGGK KLQG+F GQ+MK++ G
Sbjct  418  GSPKAIVDERGLGMISDPAAITAIVEELLAAHPDEVEAFRGGKNKLQGFFVGQLMKKTGG  477

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL  KL
Sbjct  478  KADPKLANQILSMKL  492



>ref|XP_001420207.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 sp|A4S450.1|GATB_OSTLU RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit B, 
chloroplastic/mitochondrial; Short=Glu-AdT subunit B; Flags: 
Precursor [Ostreococcus lucimarinus CCE9901]
 gb|ABO98500.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=499

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 129/196 (66%), Gaps = 3/196 (2%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGA--DVK  556
            ++++++ +V  S+PELP M R RY  +GL   DV  L  D  +  +FDA +   A    K
Sbjct  297  LSEEFISNVVASMPELPSMVRARYAALGLPPADVQVLVEDKELVTYFDAALSSSAKPSAK  356

Query  555  LATNWMMGDIAAYLKNEKL-SINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
               NW+ GDI A+LKN K+ +++++ L+P+ L E  + I    ISGKIGK++L E++ KG
Sbjct  357  QVANWLTGDIMAHLKNSKMENVSQLPLSPEALGEFCAMIDAGEISGKIGKDLLPELLEKG  416

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ ++ L Q+ DP+EIE +VD V+  N  QLEQYR GKTKL+G+F G  +K S G
Sbjct  417  GSAKKLVADRGLSQVSDPREIEALVDGVLEANAGQLEQYRAGKTKLKGFFVGACLKASGG  476

Query  198  KANPKMLNKILLEKLN  151
            +ANP ++++IL  KL+
Sbjct  477  RANPSLVDRILQAKLD  492



>ref|WP_009629416.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Pseudanabaena 
biceps]
 gb|ELS30524.1| Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Pseudanabaena 
biceps PCC 7429]
Length=493

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LP LP   R RY ++ GL+  D   + +D +IAEFFDATI  GAD K   NW+MGD+ 
Sbjct  310  SELPTLPMANRHRYRDEFGLTPYDAALIADDRSIAEFFDATIVAGADPKQVFNWVMGDVT  369

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AYL   KL I +I LTP  L+E+I+ I   TIS KI K+IL E++ KGG+VK ++  K L
Sbjct  370  AYLNENKLKIGDIALTPVILAEMIALIADGTISSKIAKDILPELITKGGSVKELVASKGL  429

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              ++   E+EK++D++IA NPK++EQY+ GKTKL G+F GQ MK+++G+A P+  NK++ 
Sbjct  430  T-VLAGAELEKIIDEIIAANPKEVEQYKAGKTKLLGFFVGQTMKKTQGRAEPQSTNKLIA  488

Query  162  EKL  154
            +KL
Sbjct  489  DKL  491



>ref|WP_036901802.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. MIT 0601]
 gb|KGG13339.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus sp. MIT 0601]
Length=491

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 131/185 (71%), Gaps = 1/185 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP MKR RY K +GLS  D   LT++ ++A++F+  +  G D K+A+NW+ GD+A
Sbjct  307  SELPELPSMKRHRYAKELGLSTYDARVLTDELSMAQYFEEVVSEGVDPKMASNWITGDLA  366

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AY+   K ++ ++   P++L+E++  I    ISGKI K+IL E++  GG+ K ++++K L
Sbjct  367  AYVNANKKNLLQLPFQPKQLAEMVQMIDSGKISGKIAKDILPELLKSGGSPKDIVEKKGL  426

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              I DP+ I  MV +++  NP+++E +RGGKTKLQG+F GQ+MK++ GK +PK+ NKILL
Sbjct  427  GMISDPKLITSMVIELLESNPQEVEAFRGGKTKLQGFFVGQLMKKTSGKIDPKLANKILL  486

Query  162  EKLNA  148
            EKL A
Sbjct  487  EKLQA  491



>ref|WP_037981155.1| glutamyl-tRNA amidotransferase [Synechococcus sp. WH 5701]
Length=493

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +T +  +     LPELP  KR RY +++GLS+ D   LT++  +AE+F+A +  GA+ 
Sbjct  297  IEVTSERREGWRAELPELPAAKRHRYADQLGLSIYDARVLTDERAMAEYFEAAVAAGAEA  356

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+ GDIAAYL   KLSI E+ L P+EL+EL+  I   TISGKI KEIL E++ +G
Sbjct  357  KGVANWVTGDIAAYLNAGKLSITELPLKPEELAELVQLIDNGTISGKIAKEILPELLEQG  416

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  I+++V +++A +P ++E +RGGKTKLQG+F GQ+MK + G
Sbjct  417  GSAKTIVAERGLGMISDPAAIKEVVQELLAAHPAEVEAFRGGKTKLQGFFVGQLMKRTGG  476

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N+IL E+L
Sbjct  477  RADPKLANRILSEQL  491



>gb|EAQ76587.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Synechococcus 
sp. WH 5701]
Length=496

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 136/195 (70%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + +T +  +     LPELP  KR RY +++GLS+ D   LT++  +AE+F+A +  GA+ 
Sbjct  300  IEVTSERREGWRAELPELPAAKRHRYADQLGLSIYDARVLTDERAMAEYFEAAVAAGAEA  359

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K   NW+ GDIAAYL   KLSI E+ L P+EL+EL+  I   TISGKI KEIL E++ +G
Sbjct  360  KGVANWVTGDIAAYLNAGKLSITELPLKPEELAELVQLIDNGTISGKIAKEILPELLEQG  419

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K ++ E+ L  I DP  I+++V +++A +P ++E +RGGKTKLQG+F GQ+MK + G
Sbjct  420  GSAKTIVAERGLGMISDPAAIKEVVQELLAAHPAEVEAFRGGKTKLQGFFVGQLMKRTGG  479

Query  198  KANPKMLNKILLEKL  154
            +A+PK+ N+IL E+L
Sbjct  480  RADPKLANRILSEQL  494



>ref|WP_032516877.1| glutamyl-tRNA amidotransferase [Prochlorococcus marinus]
 gb|KGG05850.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9321]
 gb|KGG06124.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9322]
 gb|KGG06697.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9401]
Length=490

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 134/197 (68%), Gaps = 1/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            V IT+   +     LPELP  KR +Y  + GLS  D   ++++ ++A FF+ T+  GAD 
Sbjct  294  VEITKAQQEIWFKELPELPSKKRNKYVSQFGLSAYDARVISDEISMANFFEDTVANGADA  353

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA+NW+  DI  YLK+ KLS +E+KL+P+ L+E+I  I    ISGKI KEIL E++ K 
Sbjct  354  KLASNWVTSDIVGYLKSNKLSFSELKLSPENLAEMIGMISKNIISGKIAKEILPELIKKN  413

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
             + K +++EK L  I D   I  ++D++I ++P +++ ++ GKTKL G+F GQ+MK +KG
Sbjct  414  ISPKKLVEEKGLAMISDSSSIVPIIDELIHEHPNEVQAFKNGKTKLLGFFVGQLMKRTKG  473

Query  198  KANPKMLNKILLEKLNA  148
            KA+PK+ NK+L+EKLN+
Sbjct  474  KADPKLANKLLMEKLNS  490



>emb|CEG00947.1| Aspartyl/Glutamyl-tRNA(Gln) amidotransferase,subunit B/E, catalytic 
[Ostreococcus tauri]
Length=514

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 123/197 (62%), Gaps = 2/197 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGA--D  562
            +T+++ ++  V +++PELP   R RY  +GL   DV  L  D  +  +FDA +   +   
Sbjct  312  LTLSEKFIQDVVSTMPELPAAVRARYSDLGLPQADVQVLVEDKELVAYFDAAMNSPSKPS  371

Query  561  VKLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAK  382
             K   NW+ GDI A++KN KL I  + L P+ L E    I    ISGKIGK+IL E++  
Sbjct  372  AKQIANWLTGDIMAHMKNAKLDIKSLPLGPEALGEFCGLIDSGEISGKIGKDILPELLET  431

Query  381  GGTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESK  202
            GG+ K ++KE+ L QI DP EIE ++D V+  N  QLEQYR GKTKL+G+F G  +K S 
Sbjct  432  GGSAKALVKERGLSQISDPAEIEALIDGVLEANGSQLEQYRSGKTKLKGFFVGACLKASG  491

Query  201  GKANPKMLNKILLEKLN  151
            G+ANP +++KIL  KL+
Sbjct  492  GRANPTLVDKILQAKLD  508



>ref|WP_025958674.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. scB241_527G5]
Length=490

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 130/183 (71%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR +Y  K GLS  D   ++++ ++A FF+ T+  GA+ KLA+NW+  DI  Y
Sbjct  308  LPELPSQKRNKYVSKFGLSAYDARVISDEISMANFFEETVANGAEAKLASNWVTSDIVGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK+ KLS +E+KL+P+ L+E+I+ I    ISGKI KEIL E++ K  + K +++EK L  
Sbjct  368  LKSNKLSFSELKLSPENLAEMINLISKNIISGKIAKEILPELIQKNISPKKLVEEKGLAM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I  ++D++I ++P +++ ++ GKTKL G+F GQ+MK +KGKA+PK+ NK+L+EK
Sbjct  428  ISDSSSILPIIDELINEHPNEVQAFKNGKTKLLGFFVGQLMKRTKGKADPKLANKLLMEK  487

Query  156  LNA  148
            LN+
Sbjct  488  LNS  490



>ref|WP_006418596.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Eremococcus 
coleocola]
 gb|EFR31393.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit [Eremococcus 
coleocola ACS-139-V-Col8]
Length=476

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 135/195 (69%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            V I++D+V+ V   LPE+P+ +R+RY EK  L   D + LT    +++FFD T+  GAD 
Sbjct  279  VHISRDWVEKVKAELPEMPDQRRQRYVEKYELPEYDAMVLTQTKLMSDFFDQTVAEGADP  338

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A+NW+MG+++A+L   ++S+NE +LTP  LS++I  I   TIS KI K++   ++ +G
Sbjct  339  KQASNWLMGEVSAHLNKAQVSLNETELTPHNLSQMIQLIDKGTISSKIAKKLFKILVTEG  398

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G  + +++ + + QI DP +++ M+D+ IA+NP+ +E Y+ GK +  G+F GQ+MK SKG
Sbjct  399  GDAEEVVEAQGMAQISDPAKLQPMIDEAIANNPQSVEDYKNGKGRALGFFVGQIMKASKG  458

Query  198  KANPKMLNKILLEKL  154
            +ANP+++N++L E L
Sbjct  459  QANPQVINQLLEETL  473



>ref|WP_042849535.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. MIT 0604]
 gb|AIQ94090.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus sp. MIT 0604]
Length=490

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 129/183 (70%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP MKR +Y  + GLS  D   ++++ ++A FF+ T+  GA+ KLA+NW+  DI  Y
Sbjct  308  LPELPSMKRNKYVLQFGLSAYDARVISDEISMANFFEETVANGAEAKLASNWVTSDIVGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK+ KLS  E+KLTP+ L+E+IS I    ISGKI KEIL E++ K  + K +++EK L  
Sbjct  368  LKSNKLSFRELKLTPENLAEMISMISKNIISGKIAKEILPELIQKNISPKKLVEEKGLAM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I  ++D++I + P +++ ++ GK+KL G+F GQ+MK +KGKA+PK+ NK+L+EK
Sbjct  428  ISDSSSILPIIDELINEYPNEVQAFKNGKSKLLGFFVGQLMKRTKGKADPKLANKLLMEK  487

Query  156  LNA  148
            LN+
Sbjct  488  LNS  490



>ref|WP_011294013.1| glutamyl-tRNA amidotransferase subunit B [Prochlorococcus marinus]
 sp|Q46I09.1|GATB_PROMT RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Prochlorococcus marinus 
str. NATL2A]
 gb|AAZ58869.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Prochlorococcus 
marinus str. NATL2A]
Length=491

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 132/185 (71%), Gaps = 1/185 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RY  ++GLS+ D   LT++S++A +F+  +  G   K + NW+ GD+A
Sbjct  307  SELPELPAAKRNRYSTELGLSIYDARVLTDESSMATYFEKVVNEGGAAKSSANWITGDLA  366

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            AY+K+ +L+ +++   P EL+E++  I    ISGKI KEIL E+++KGG+ K +++E+ L
Sbjct  367  AYIKSNRLTFDQLHFQPSELAEMLKMIDTGEISGKIAKEILPELLSKGGSPKQLVQERGL  426

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              I DP+ IE+++D++I  +P ++E +R GK KL G+F GQ+MKE+KGKA+PK+ N+IL 
Sbjct  427  GMIGDPKVIEEIIDQLILKHPNEVESFRSGKKKLLGFFVGQLMKETKGKADPKLANQILN  486

Query  162  EKLNA  148
            +KL A
Sbjct  487  KKLQA  491



>ref|WP_022458628.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Fusobacterium 
sp. CAG:439]
 emb|CDE59015.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Fusobacterium 
sp. CAG:439]
Length=480

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 130/193 (67%), Gaps = 0/193 (0%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRYEKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLA  550
            I++++V  + + +PELP+ KR RY  +GLS  D   +     +A FFD  +  GA  K+A
Sbjct  288  ISREWVQQIKDKMPELPQAKRERYMSLGLSEYDASVIVEQMGLALFFDEVLKLGASPKIA  347

Query  549  TNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTV  370
             N++MG+IAAYLK EKL IN+ KLTP+ L+ELI+ I+  TIS  IGK+I+ ++M  G   
Sbjct  348  VNFIMGEIAAYLKEEKLEINDTKLTPENLAELITLIEKNTISNNIGKQIIIDMMKDGTKA  407

Query  369  KGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKAN  190
              ++++K L QI D   I+++  KV+  NP Q+  Y+ GK +L G+F GQVMKE+KG+AN
Sbjct  408  SKIVEDKGLSQISDTSAIKEIAQKVVDANPNQVTAYKNGKVQLLGFFVGQVMKETKGRAN  467

Query  189  PKMLNKILLEKLN  151
            PK +N+IL E L+
Sbjct  468  PKAVNEILKELLD  480



>ref|WP_025915357.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. scB245a_520K10]
Length=490

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 130/183 (71%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR +Y  + GLS  D   ++++ ++A FF+ T+  GA+ KLA+NW+  DI  Y
Sbjct  308  LPELPSKKRNKYVSQFGLSAYDARVISDEISMANFFEETVANGAEAKLASNWVTSDIVGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK+ KLS +E+KL+P+ L+E+IS I    ISGKI KEIL E++ K  + K +++EK L  
Sbjct  368  LKSNKLSFSELKLSPENLAEMISMIAKNIISGKIAKEILPELIQKNISPKKLVEEKGLAM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I  ++D++I ++P +++ ++ GKTKL G+F GQ+MK +KGKA+PK+ NK+L+EK
Sbjct  428  ISDSSSILPIIDELINEHPNEVQAFKNGKTKLLGFFVGQLMKRTKGKADPKLANKLLMEK  487

Query  156  LNA  148
            LN+
Sbjct  488  LNS  490



>ref|WP_028118977.1| glutamyl-tRNA amidotransferase [Facklamia sourekii]
Length=476

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 138/199 (69%), Gaps = 2/199 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            +T++Q+++D V   LPE+P  +R RY ++  L   D + LT    +++FFD T+  GAD 
Sbjct  279  MTVSQEWIDQVAERLPEMPTARRERYTQEFDLPDYDAMVLTQTREMSDFFDETVAEGADP  338

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K A+NW+MG+++AYL  E++ + + +LTP  L+++I  I   TIS KI K++   ++ KG
Sbjct  339  KQASNWLMGELSAYLNKEQIELADTQLTPSNLAQMIQLISDGTISSKIAKKLFQILVTKG  398

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G    +++++ + QI DP +++ M+D+V+ +NP+ +E ++ GK +  G+F GQ+MK++KG
Sbjct  399  GDANEVVEKEGMAQISDPAKLQPMIDEVLDNNPESIEDFKNGKDRAVGFFVGQIMKQTKG  458

Query  198  KANPKMLNKILLEKLNAKR  142
            +ANP+++NK+L+E L AKR
Sbjct  459  QANPQVVNKLLMEAL-AKR  476



>gb|AIQ96157.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus sp. MIT 0801]
Length=474

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 135/195 (69%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +   + LPELP  KR RY  ++GLS+ D   LT++S++A++F+  +  G   
Sbjct  278  IEVSNDLKEKWRSELPELPAAKRNRYSAELGLSIYDARVLTDESSMAKYFEKVVNEGGAA  337

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K + NW+ GDIAAY+K+ KLS +++   P EL+E++  I    ISGKI K+IL E++  G
Sbjct  338  KSSANWITGDIAAYIKSNKLSFDQLTFKPNELAEMLKMIDSGEISGKIAKDILPELLNNG  397

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++E+ L  I DP+ IE+++D++I  +P ++E +R GK KL G+F GQ+MKE+KG
Sbjct  398  GSPKQLVQERGLGMIGDPKVIEEIIDQLIVRHPNEVESFRAGKKKLLGFFVGQLMKETKG  457

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  458  KADPKLANQILNKKL  472



>ref|WP_028124912.1| glutamyl-tRNA amidotransferase [Eremococcus coleocola]
Length=476

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 134/195 (69%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            V I++D+V+ V   LPE+P+ +R+RY EK  L   D + LT    +++FFD T+  GAD 
Sbjct  279  VHISRDWVEKVKAELPEMPDQRRQRYVEKYELPEYDAMVLTQTKLMSDFFDQTVAEGADP  338

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K  +NW+MG+++A+L   ++S+NE +LTP  LS++I  I   TIS KI K++   ++ +G
Sbjct  339  KQTSNWLMGEVSAHLNKAQVSLNETELTPHNLSQMIQLIDKGTISSKIAKKLFKILVTEG  398

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G  + +++ + + QI DP +++ M+D+ IA+NP+ +E Y+ GK +  G+F GQ+MK SKG
Sbjct  399  GDAEEVVEAQGMAQISDPAKLQPMIDEAIANNPQSVEDYKNGKGRALGFFVGQIMKASKG  458

Query  198  KANPKMLNKILLEKL  154
            KANP+++N++L E L
Sbjct  459  KANPQVINQLLEETL  473



>ref|WP_038650511.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. MIT 0801]
Length=491

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 135/195 (69%), Gaps = 1/195 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRYE-KMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + ++ D  +   + LPELP  KR RY  ++GLS+ D   LT++S++A++F+  +  G   
Sbjct  295  IEVSNDLKEKWRSELPELPAAKRNRYSAELGLSIYDARVLTDESSMAKYFEKVVNEGGAA  354

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            K + NW+ GDIAAY+K+ KLS +++   P EL+E++  I    ISGKI K+IL E++  G
Sbjct  355  KSSANWITGDIAAYIKSNKLSFDQLTFKPNELAEMLKMIDSGEISGKIAKDILPELLNNG  414

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
            G+ K +++E+ L  I DP+ IE+++D++I  +P ++E +R GK KL G+F GQ+MKE+KG
Sbjct  415  GSPKQLVQERGLGMIGDPKVIEEIIDQLIVRHPNEVESFRAGKKKLLGFFVGQLMKETKG  474

Query  198  KANPKMLNKILLEKL  154
            KA+PK+ N+IL +KL
Sbjct  475  KADPKLANQILNKKL  489



>ref|WP_032523030.1| glutamyl-tRNA amidotransferase [Prochlorococcus marinus]
 gb|KGF94743.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9201]
Length=490

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 130/183 (71%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR +Y  + GLS  D   ++++ ++A FF+ T+  GA+ KLA+NW+  DI  Y
Sbjct  308  LPELPSKKRNKYVSQFGLSAYDARVISDEISMANFFEETVAYGAEPKLASNWITSDIVGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK+ KLS +E+KL+P+ L+E+IS I  +TISGKI KEIL E++ K  + K +++EK L  
Sbjct  368  LKSNKLSFSELKLSPENLAEMISMISNKTISGKIAKEILPELVQKNISPKNLVEEKGLAM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I  +++++I + P +++ ++ GKTKL G+F GQ+MK +KGKA+PK+ NK+L+EK
Sbjct  428  ISDSSSILPIINELITEYPNEVQAFKNGKTKLLGFFVGQLMKRTKGKADPKLANKLLVEK  487

Query  156  LNA  148
            LN 
Sbjct  488  LNG  490



>ref|WP_025937846.1| glutamyl-tRNA amidotransferase [Prochlorococcus sp. scB245a_519A13]
Length=490

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 131/183 (72%), Gaps = 1/183 (1%)
 Frame = -3

Query  693  LPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR +Y  + GLS  D   ++++ ++A FF+ T+  GA+ KLA+NW+  DI  Y
Sbjct  308  LPELPSKKRNKYVSQFGLSAYDARVISDEISMANFFEETVANGAEAKLASNWVTSDIVGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK+ KL+ +E+KL+P+ L+E+I+ I    ISGKI KEIL E++ K  + K +++EK L  
Sbjct  368  LKSNKLTFSELKLSPENLAEMINMISKNIISGKIAKEILPELIQKNISPKKLVEEKGLAM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I DP  I  +++++I ++P +++ ++ GKTKL G+F GQ+MK +KGKA+PK+ NK+L+EK
Sbjct  428  ISDPSSILPIINELINEHPNEVQAFKNGKTKLLGFFVGQLMKRTKGKADPKLANKLLMEK  487

Query  156  LNA  148
            LN+
Sbjct  488  LNS  490



>ref|WP_032514114.1| glutamyl-tRNA amidotransferase [Prochlorococcus marinus]
 gb|KGF89380.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9107]
 gb|KGF91130.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9116]
 gb|KGF94429.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9123]
Length=490

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 128/184 (70%), Gaps = 1/184 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            N LPELP  KR +Y  + GLS  D   ++++ N+A FF+ T+  GA+ KLA+NW+  DI 
Sbjct  306  NELPELPSKKRNKYVNEFGLSAYDARVISDEINMANFFEETVANGAEPKLASNWVTSDIV  365

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
             YLK  KLS +++KL+PQ L+E+I+ I  +TISGKI KEIL E++    + + +++EK L
Sbjct  366  GYLKANKLSFSQLKLSPQNLAEMINMISKKTISGKIAKEILPELIQNNISPQNLVEEKGL  425

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              I D   I  ++++++A  P ++E +R GKTKL G+F GQ+MK +KGKA+PK+ NK+L 
Sbjct  426  AMISDSASILPIINELLAQYPNEVEAFRNGKTKLIGFFVGQLMKRTKGKADPKLANKLLA  485

Query  162  EKLN  151
            EKLN
Sbjct  486  EKLN  489



>ref|WP_036916354.1| MULTISPECIES: glutamyl-tRNA amidotransferase [Prochlorococcus]
 gb|KGG16899.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus sp. MIT 0602]
 gb|KGG18126.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus sp. MIT 0603]
Length=492

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 126/185 (68%), Gaps = 1/185 (1%)
 Frame = -3

Query  699  NSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIA  523
            + LPELP  KR RY +++ LS  D   LT+D+ +A++F+  +  GAD KLA NW+ GD+A
Sbjct  307  SELPELPSAKRHRYVQELALSAYDARVLTDDAQMAQYFETAVLSGADAKLAANWITGDLA  366

Query  522  AYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDL  343
            A +   + +   +  TPQEL+EL+  I    ISGKI KEIL E++  GG+ K ++  K L
Sbjct  367  ASVNANRKTFGNLVFTPQELAELVQLIVEGKISGKIAKEILPELLKHGGSPKELVDSKGL  426

Query  342  VQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILL  163
              I DP  I +++D +I+++P +++ YRGGK KLQG+F GQ+MK + GKA+PK+ N+IL 
Sbjct  427  GMISDPTLIAEIIDTLISNHPNEVKAYRGGKKKLQGFFIGQIMKMTSGKADPKLANQILS  486

Query  162  EKLNA  148
            EKLN+
Sbjct  487  EKLNS  491



>ref|WP_019475029.1| glutamyl-tRNA amidotransferase subunit B [Prochlorococcus sp. 
W2]
Length=490

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 126/181 (70%), Gaps = 1/181 (1%)
 Frame = -3

Query  693  LPELPEMKRRRYEK-MGLSMQDVLFLTNDSNIAEFFDATIGRGADVKLATNWMMGDIAAY  517
            LPELP  KR +Y K +GLS  D   L+++  +A FF+ T+  GAD KLA NW+ GDIA Y
Sbjct  308  LPELPGQKRNKYVKELGLSAYDARVLSDEIFMANFFETTVNNGADAKLAANWITGDIAGY  367

Query  516  LKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGTVKGMIKEKDLVQ  337
            LK  KL+ N IKLTP+ L+E+I  I    ISGKI KEIL EI+    + K ++ E++L  
Sbjct  368  LKANKLNFNNIKLTPENLAEMIQLITSNIISGKIAKEILPEIIENNLSPKKLVDERNLGM  427

Query  336  IVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKANPKMLNKILLEK  157
            I D   I  +V++VI +NP +++ ++ GKTKL G+F GQ+MK++KGKA+PK++N+++ EK
Sbjct  428  ISDSSSILPLVEEVINNNPNEVQAFKNGKTKLLGFFVGQLMKKTKGKADPKLVNQLIAEK  487

Query  156  L  154
            L
Sbjct  488  L  488



>ref|WP_022793697.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Marinococcus 
halotolerans]
Length=478

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 130/196 (66%), Gaps = 1/196 (1%)
 Frame = -3

Query  729  ITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADVKL  553
            I +D+   + + +PELP+ +++RY E  GLS  D   L     IA+FF  T+  GAD KL
Sbjct  283  INEDWKSRIRSLIPELPDARKKRYIEDFGLSEYDASVLVQSKAIADFFQETVDAGADSKL  342

Query  552  ATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKGGT  373
              NW+MG+++ YL N  + I E  LTPQ L++LI  I+  TIS KI K++  ++M +GG 
Sbjct  343  TANWLMGEVSGYLNNNDMDIEETALTPQSLAKLIELIEKGTISSKIAKQVFADVMEQGGD  402

Query  372  VKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKGKA  193
             + ++K+K L+QI D  E++++VD ++ +NP+ +E Y+ GK K  G+  GQVMKE+KGKA
Sbjct  403  PEQIVKDKGLMQISDEGELKQVVDGILDNNPQSIEDYKNGKDKALGFLVGQVMKETKGKA  462

Query  192  NPKMLNKILLEKLNAK  145
            NP+M+N ++LE +  +
Sbjct  463  NPQMVNSLILEGMEQR  478



>ref|WP_011375614.1| glutamyl-tRNA amidotransferase subunit B [Prochlorococcus marinus]
 sp|Q31DD5.1|GATB_PROM9 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase 
subunit B; Short=Asp/Glu-ADT subunit B [Prochlorococcus marinus 
str. MIT 9312]
 gb|ABB49110.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B [Prochlorococcus 
marinus str. MIT 9312]
 gb|KGF99653.1| Aspartyl-tRNA(Asn) amidotransferase subunit B Glutamyl-tRNA(Gln) 
amidotransferase subunit B [Prochlorococcus marinus str. 
MIT 9311]
Length=490

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 133/196 (68%), Gaps = 1/196 (1%)
 Frame = -3

Query  735  VTITQDYVDSVCNSLPELPEMKRRRY-EKMGLSMQDVLFLTNDSNIAEFFDATIGRGADV  559
            + IT+   +   N LPELP  KR +Y  + GLS  D   ++++ N+A FF+ T+  GA+ 
Sbjct  294  IEITKAQKEIWFNELPELPSKKRNKYVNEFGLSAYDARVISDEINMANFFEETVANGAEA  353

Query  558  KLATNWMMGDIAAYLKNEKLSINEIKLTPQELSELISAIKGETISGKIGKEILFEIMAKG  379
            KLA+NW+  DI  YLK  KLS +E+KL+P+ L+E+I+ I   TISGKI KEIL E++ K 
Sbjct  354  KLASNWVTSDIVGYLKANKLSFSELKLSPENLAEMINMILKNTISGKIAKEILPELIKKN  413

Query  378  GTVKGMIKEKDLVQIVDPQEIEKMVDKVIADNPKQLEQYRGGKTKLQGYFAGQVMKESKG  199
             + K +++EK L  I D   I  +++++I + P +++ +R GKTKL G+F GQ+MK +KG
Sbjct  414  ISPKKLVEEKGLAMISDSSSILPIINELINEYPNEVQAFRNGKTKLLGFFIGQLMKRTKG  473

Query  198  KANPKMLNKILLEKLN  151
            KA+PK+ NK+L EKLN
Sbjct  474  KADPKLANKLLAEKLN  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500