BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028D24

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    330   4e-109   Elaeis guineensis
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    329   1e-108   Oryza brachyantha
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     329   1e-108   Sesamum indicum [beniseed]
gb|KJB54391.1|  hypothetical protein B456_009G074800                    322   1e-108   Gossypium raimondii
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                327   2e-108   Erythranthe guttata [common monkey flower]
ref|NP_001265946.1|  Hop-interacting protein THI032                     327   6e-108   Solanum lycopersicum
gb|AAL47679.1|  aminotransferase 1                                      327   1e-107   Cucumis melo [Oriental melon]
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       327   1e-107   Gossypium arboreum [tree cotton]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    327   2e-107   Cucumis sativus [cucumbers]
gb|KJB83533.1|  hypothetical protein B456_013G252200                    324   2e-107   Gossypium raimondii
gb|KJB54393.1|  hypothetical protein B456_009G074800                    323   2e-107   Gossypium raimondii
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                326   2e-107   Cucumis melo [Oriental melon]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    326   2e-107   Sesamum indicum [beniseed]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    325   4e-107   Solanum tuberosum [potatoes]
gb|AFK37194.1|  unknown                                                 319   5e-107   Medicago truncatula
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     325   6e-107   Nicotiana tomentosiformis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     325   7e-107   Nicotiana sylvestris
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     325   8e-107   Prunus mume [ume]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             325   8e-107   Prunus persica
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    324   1e-106   
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             324   1e-106   Fritillaria agrestis
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     324   1e-106   Gossypium hirsutum [American cotton]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     324   1e-106   Pyrus x bretschneideri [bai li]
gb|AAQ56192.1|  aminotransferase 1                                      324   2e-106   Cucumis melo [Oriental melon]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     323   2e-106   Fragaria vesca subsp. vesca
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         323   2e-106   Ricinus communis
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             318   2e-106   
gb|KJB54389.1|  hypothetical protein B456_009G074800                    323   3e-106   Gossypium raimondii
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     323   4e-106   Malus domestica [apple tree]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      322   7e-106   
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             319   1e-105   
ref|NP_001237048.1|  enzymatic resistance protein                       322   1e-105   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     322   1e-105   Tarenaya hassleriana [spider flower]
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    322   1e-105   Glycine max [soybeans]
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          322   1e-105   Amborella trichopoda
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    322   1e-105   Glycine max [soybeans]
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     322   1e-105   Elaeis guineensis
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     321   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     321   2e-105   Phoenix dactylifera
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     320   2e-105   Peperomia schizandra
ref|NP_001062170.1|  Os08g0502700                                       321   2e-105   
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     321   2e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     321   2e-105   Eucalyptus grandis [rose gum]
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     320   3e-105   
gb|ABQ81924.1|  aminotransferase 2                                      320   3e-105   Cucumis sativus [cucumbers]
dbj|BAJ90006.1|  predicted protein                                      320   3e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAQ56193.1|  aminotransferase 2                                      320   4e-105   Cucumis melo [Oriental melon]
gb|ABQ81922.1|  aminotransferase 2                                      320   4e-105   Cucumis sativus [cucumbers]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           320   4e-105   Cucumis melo [Oriental melon]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    320   4e-105   Cucumis melo [Oriental melon]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    315   4e-105   
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                320   4e-105   Medicago truncatula
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     320   4e-105   Glycine soja [wild soybean]
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    320   5e-105   
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           320   5e-105   Glycine max [soybeans]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            320   5e-105   Cucumis melo [Oriental melon]
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     320   8e-105   Triticum urartu
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         319   9e-105   Jatropha curcas
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       319   1e-104   Gossypium arboreum [tree cotton]
gb|ABQ81925.1|  aminotransferase 2                                      319   1e-104   Cucumis melo [Oriental melon]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     319   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK40703.1|  unknown                                                 319   1e-104   Medicago truncatula
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  319   1e-104   Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    319   1e-104   Citrus sinensis [apfelsine]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             318   2e-104   Phaseolus vulgaris [French bean]
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    318   2e-104   Glycine max [soybeans]
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     317   3e-104   Peperomia bracteata
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             318   3e-104   Populus trichocarpa [western balsam poplar]
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     317   3e-104   Peperomia cerrateae
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     316   4e-104   Peperomia cerrateae
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     316   4e-104   Peperomia cerrateae
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    318   5e-104   Phaseolus vulgaris [French bean]
emb|CBI24214.3|  unnamed protein product                                316   6e-104   Vitis vinifera
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      317   7e-104   Genlisea aurea
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    317   8e-104   Cucumis sativus [cucumbers]
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             317   8e-104   Citrus clementina [clementine]
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     315   8e-104   Peperomia bracteata
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia cavispicata
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia radiatinervosa
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     317   1e-103   Populus euphratica
gb|ACN39798.1|  unknown                                                 317   1e-103   Picea sitchensis
gb|ABK24112.1|  unknown                                                 317   1e-103   Picea sitchensis
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia radiatinervosa
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia bracteata
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia bracteata
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia bracteata
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia bracteata
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia ayacuchoana
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia parvisagittata
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     316   2e-103   Vitis vinifera
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     315   2e-103   Peperomia radiatinervosa
gb|ACN36238.1|  unknown                                                 313   2e-103   Zea mays [maize]
emb|CAN84001.1|  hypothetical protein VITISV_007680                     315   3e-103   Vitis vinifera
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          315   4e-103   Sorghum bicolor [broomcorn]
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     314   4e-103   Peperomia parvisagittata
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     313   8e-103   Peperomia andina
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     313   1e-102   Peperomia pseudoverruculosa
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    314   1e-102   Setaria italica
emb|CDP08481.1|  unnamed protein product                                314   1e-102   Coffea canephora [robusta coffee]
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     312   1e-102   Peperomia questionis
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     316   2e-102   Brachypodium distachyon [annual false brome]
ref|NP_001148339.1|  LOC100281949                                       314   2e-102   Zea mays [maize]
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     312   2e-102   Peperomia verruculosa
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     312   2e-102   Peperomia verruculosa
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      313   3e-102   Spirodela polyrhiza
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    314   3e-102   
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    313   3e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002313371.1|  aminotransferase 2 family protein                  313   3e-102   
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     311   5e-102   Peperomia bracteata
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     311   7e-102   Peperomia parvifolia
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     310   7e-102   Peperomia peruviana
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    311   1e-101   Populus euphratica
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     310   1e-101   Peperomia rupiseda
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     309   3e-101   Peperomia chutanka
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     309   3e-101   Peperomia sp. JN-2011
gb|ABK96624.1|  unknown                                                 310   5e-101   Populus trichocarpa x Populus deltoides
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             310   5e-101   
emb|CDX81443.1|  BnaC09g08540D                                          309   7e-101   
emb|CDY37208.1|  BnaA09g08290D                                          309   8e-101   Brassica napus [oilseed rape]
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     309   8e-101   Brassica rapa
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     308   8e-101   Peperomia cyclaminoides
dbj|BAJ33858.1|  unnamed protein product                                310   1e-100   Eutrema halophilum
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     307   1e-100   Peperomia aff. gracillima JN-2011
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     307   1e-100   Peperomia putlaensis
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    307   7e-100   Brassica rapa
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     305   1e-99    Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     304   2e-99    Peperomia pugnicaudex
emb|CDX89604.1|  BnaC03g45180D                                          305   3e-99    
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     303   6e-99    Peperomia polycephala
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    304   7e-99    Camelina sativa [gold-of-pleasure]
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     303   8e-99    Peperomia peruviana
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    304   1e-98    Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  303   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      302   4e-98    Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             301   1e-97    
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     296   2e-97    
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             298   2e-96    Capsella rubella
gb|AEA48973.1|  glyoxylate aminotransferase                             289   3e-96    Rosa roxburghii [chestnut rose]
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     291   2e-94    Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     290   4e-94    Peperomia putlaensis
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     289   9e-94    Peperomia cyclaminoides
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     289   9e-94    Peperomia cyclaminoides
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    292   1e-93    Camelina sativa [gold-of-pleasure]
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     288   2e-93    Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     288   2e-93    Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     288   3e-93    Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     286   6e-93    Peperomia aff. ovatopeltata JN-2011
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     286   8e-93    Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     286   1e-92    Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     286   2e-92    Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     284   8e-92    Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     283   2e-91    Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     281   2e-90    Peperomia sp. JN-2011
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    282   3e-90    Cicer arietinum [garbanzo]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                282   4e-90    Medicago truncatula
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     280   5e-90    Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     280   5e-90    Peperomia exclamationis
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              270   9e-89    
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             273   7e-87    Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             272   2e-86    
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     268   5e-86    Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     269   7e-86    Peperomia aff. pinoi JN-2011
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     265   2e-84    Peperomia jalcaensis
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     265   3e-84    Peperomia elatior
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     265   3e-84    Peperomia parvisagittata
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      258   4e-84    Oryza sativa Indica Group [Indian rice]
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     263   1e-83    Peperomia wernerrauhii
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     261   4e-83    Peperomia schizandra
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     261   6e-83    Peperomia cerrateae
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     261   6e-83    Peperomia basiradicans
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     259   2e-82    Peperomia dolabella
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     259   4e-82    Peperomia cerrateae
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     258   1e-81    Peperomia klopfensteinii
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             260   2e-81    Selaginella moellendorffii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     257   2e-81    Peperomia wernerrauhii
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             258   6e-81    Selaginella moellendorffii
ref|XP_001755667.1|  predicted protein                                  254   2e-79    
ref|XP_001783551.1|  predicted protein                                  250   8e-78    
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                245   2e-76    
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     244   2e-76    Peperomia sp. JN-2011
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                241   6e-75    Morus notabilis
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                243   8e-75    
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     240   9e-75    Peperomia aff. ovatopeltata JN-2011
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              233   3e-73    
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             238   4e-73    
gb|ABR16109.1|  unknown                                                 236   9e-73    Picea sitchensis
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  234   9e-72    Citrus sinensis [apfelsine]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              231   8e-71    
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                225   1e-68    
ref|XP_001763095.1|  predicted protein                                  221   2e-66    
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     196   1e-59    Phaseolus vulgaris [French bean]
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     194   6e-59    Phaseolus vulgaris [French bean]
gb|AGN53915.1|  glyoxylate aminotransferase                             190   1e-57    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             189   4e-57    Silene latifolia
gb|AGN53914.1|  glyoxylate aminotransferase                             188   6e-57    Silene latifolia
gb|AGN53916.1|  glyoxylate aminotransferase                             187   9e-57    Silene latifolia
gb|AGN53897.1|  glyoxylate aminotransferase                             187   1e-56    Silene latifolia
gb|AGN53923.1|  glyoxylate aminotransferase                             187   2e-56    Silene latifolia
gb|AGN54050.1|  glyoxylate aminotransferase                             187   2e-56    Silene vulgaris [maiden's-tears]
gb|AGN53921.1|  glyoxylate aminotransferase                             187   2e-56    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             186   3e-56    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             186   3e-56    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             186   3e-56    Silene latifolia
gb|AGN54049.1|  glyoxylate aminotransferase                             186   5e-56    Silene vulgaris [maiden's-tears]
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    190   2e-54    Methylocystaceae
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                189   2e-54    Methylosinus sp. LW4
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                189   2e-54    Methylosinus
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                188   6e-54    
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      187   2e-53    Hyphomicrobium nitrativorans NL23
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                187   2e-53    Hyphomicrobium nitrativorans
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                186   4e-53    Methylosinus
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                186   6e-53    Methylobacterium sp. MB200
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                186   8e-53    Methylorubrum populi
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    185   1e-52    Methylobacterium aquaticum
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                185   1e-52    Methylocella silvestris
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     184   1e-52    Methylorubrum extorquens DM4
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                185   2e-52    Methylobacteriaceae
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                184   2e-52    Methylorubrum extorquens
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                184   2e-52    Methylobacteriaceae
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     181   3e-51    Methyloceanibacter caenitepidi
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                181   4e-51    Methylocapsa aurea
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 179   1e-50    Auxenochlorella protothecoides
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                179   1e-50    Methylobacterium
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                179   1e-50    Methylocaldum szegediense
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                178   5e-50    Methylobacterium sp. 88A
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    178   6e-50    Hyphomicrobium methylovorum
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                178   7e-50    Hyphomicrobium denitrificans
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                177   1e-49    Hyphomicrobium zavarzinii
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                177   1e-49    Methylocapsa acidiphila
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                177   2e-49    Hyphomicrobium denitrificans
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                176   2e-49    Methylobacterium sp. 77
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                176   3e-49    Methylocystis parvus
ref|XP_005709273.1|  serine--glyoxylate transaminase                    176   4e-49    Galdieria sulphuraria
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                175   6e-49    Methylobacterium sp. B34
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                175   7e-49    Methylobacterium
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    175   8e-49    Methylobacterium
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                174   1e-48    Methylobacterium
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   1e-48    Methylobacterium
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                174   1e-48    Methylocystis sp. ATCC 49242
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                174   1e-48    Methylobacterium
ref|WP_010687105.1|  Aminotransferase class V                           174   2e-48    Methylobacterium mesophilicum
gb|AIQ91949.1|  Aminotransferase class V                                174   5e-48    Methylobacterium oryzae CBMB20
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    173   5e-48    Hyphomicrobium
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                173   7e-48    Paraburkholderia sacchari
gb|AID30749.1|  serine--glyoxylate aminotransferase                     167   1e-47    Mesorhizobium huakuii 7653R
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                172   2e-47    Caballeronia glathei
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                171   2e-47    Granulibacter bethesdensis
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                171   2e-47    Granulibacter bethesdensis
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                171   3e-47    Ferrovum
gb|AEW08188.1|  hypothetical protein 2_2585_01                          163   3e-47    Pinus lambertiana
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                171   3e-47    Methylobacterium nodulans
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     171   3e-47    Granulibacter bethesdensis
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        171   3e-47    Granulibacter bethesdensis CGDNIH4
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                170   4e-47    Methylococcus capsulatus
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                170   5e-47    Methylopila sp. M107
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                170   6e-47    Rhizobium leucaenae
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                170   7e-47    Methyloversatilis universalis
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                169   9e-47    Granulibacter bethesdensis
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                169   1e-46    Methylocystis sp. SC2
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                169   1e-46    Hoeflea sp. 108
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                169   1e-46    Methylocystis rosea
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        170   1e-46    Granulibacter bethesdensis
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                169   1e-46    Ensifer sojae
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                165   2e-46    
gb|KIZ03753.1|  serine--glyoxylate transaminase                         169   2e-46    Monoraphidium neglectum
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                169   2e-46    Methylocystis sp. SB2
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                165   2e-46    Sinorhizobium fredii
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                165   2e-46    Sinorhizobium fredii
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                169   2e-46    Paraburkholderia terrae
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                165   2e-46    Sinorhizobium fredii
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                169   2e-46    Methylobacterium sp. 4-46
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                165   2e-46    Sinorhizobium fredii
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              169   2e-46    Volvox carteri f. nagariensis
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                169   2e-46    Methylobacterium sp. WSM2598
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                169   2e-46    Paraburkholderia phymatum
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                168   4e-46    Paraburkholderia hospita
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                168   4e-46    Paraburkholderia caribensis
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    167   4e-46    Methylobacter
gb|AFG57258.1|  hypothetical protein 2_2585_01                          160   5e-46    
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                168   5e-46    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                167   5e-46    
gb|AEW08187.1|  hypothetical protein 2_2585_01                          159   7e-46    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                167   7e-46    
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                167   8e-46    
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                167   9e-46    
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                167   9e-46    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_020188076.1|  hypothetical protein                               166   1e-45    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                165   3e-45    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                165   3e-45    
ref|WP_020592928.1|  hypothetical protein                               165   3e-45    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                165   4e-45    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                165   4e-45    
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                165   4e-45    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                165   4e-45    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                165   4e-45    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                165   5e-45    
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                164   6e-45    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                164   7e-45    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                164   8e-45    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                164   8e-45    
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                165   8e-45    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    164   1e-44    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                164   1e-44    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                164   1e-44    
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                164   1e-44    
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                163   2e-44    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                163   2e-44    
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                163   2e-44    
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                163   2e-44    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                163   2e-44    
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    163   2e-44    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                163   2e-44    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                163   3e-44    
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      163   3e-44    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                162   4e-44    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                162   4e-44    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                162   4e-44    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                162   6e-44    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   6e-44    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   6e-44    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                162   6e-44    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                162   6e-44    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   6e-44    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   6e-44    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                162   6e-44    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   7e-44    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   8e-44    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                162   9e-44    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    161   9e-44    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    160   2e-43    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    160   2e-43    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    160   4e-43    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                159   5e-43    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                159   6e-43    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                159   6e-43    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                159   7e-43    
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                159   8e-43    
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                159   9e-43    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                159   9e-43    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                159   9e-43    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                158   1e-42    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                158   1e-42    
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 159   1e-42    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                158   1e-42    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    157   2e-42    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                157   3e-42    
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                157   3e-42    
ref|WP_020058450.1|  hypothetical protein                               157   3e-42    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             159   3e-42    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                157   4e-42    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                157   4e-42    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                157   4e-42    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                156   9e-42    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                156   1e-41    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                155   1e-41    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                155   2e-41    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         155   3e-41    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                154   3e-41    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                155   3e-41    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                154   5e-41    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                154   6e-41    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                154   8e-41    
ref|WP_005670252.1|  serine-glyoxylate aminotransferase                 148   9e-41    
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                153   9e-41    
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                153   1e-40    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    154   1e-40    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_016841706.1|  hypothetical protein                               151   2e-40    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                153   2e-40    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_027528516.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_044591882.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_044541799.1|  serine--glyoxylate aminotransferase                152   3e-40    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            152   4e-40    
ref|WP_023263325.1|  serine--glyoxylate aminotransferase                152   4e-40    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                152   4e-40    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                152   4e-40    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                152   4e-40    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    151   5e-40    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                151   9e-40    
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                151   1e-39    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_012045640.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    150   1e-39    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 151   1e-39    
ref|WP_038386888.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_018272711.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 151   2e-39    
gb|EEE42985.1|  aminotransferase, class V superfamily                   150   2e-39    
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_039523955.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_028337735.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_020084034.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_035632551.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_028149694.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_021080443.1|  alanine-glyoxylate transaminase/serine-glyox...    149   5e-39    
ref|WP_011872107.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                149   6e-39    
ref|WP_027555031.1|  serine--glyoxylate aminotransferase                149   6e-39    
ref|WP_007205927.1|  serine--glyoxylate aminotransferase                149   6e-39    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 149   6e-39    
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                149   6e-39    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                148   7e-39    
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     149   7e-39    
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    141   7e-39    
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                148   7e-39    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    148   7e-39    
emb|CEG09072.1|  Soluble hydrogenase 42 kDa subunit                     148   8e-39    
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      148   8e-39    
emb|CEG08573.1|  Soluble hydrogenase 42 kDa subunit                     148   9e-39    
ref|WP_012078301.1|  serine--glyoxylate aminotransferase                148   9e-39    
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                148   9e-39    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                148   9e-39    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    148   9e-39    
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    141   9e-39    
ref|WP_010686651.1|  serine--glyoxylate transaminase                    148   9e-39    
ref|WP_042299583.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_014493792.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_039152510.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                148   1e-38    
ref|WP_029167381.1|  hypothetical protein                               142   2e-38    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   330 bits (847),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHTR
Sbjct  222  ASKTAKSVRVFFDWADYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHTR  281

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLNK
Sbjct  282  LGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLNK  341

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  342  VAGKVFRIGHLGHLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSR  401

Query  78   I  76
            I
Sbjct  402  I  402



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   329 bits (844),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHTR
Sbjct  221  ATKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHTR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   322 bits (826),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR
Sbjct  35   ASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTR  94

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            +G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNK
Sbjct  95   MGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNK  154

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSR
Sbjct  155  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSR  214

Query  78   I  76
            I
Sbjct  215  I  215



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA SVRVFFDW DYLKFYK+G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHTR
Sbjct  179  ASKTATSVRVFFDWNDYLKFYKLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHTR  238

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  ATRLAV AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  239  LAKATRLAVDAWGLKNCTQKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNK  298

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPSR
Sbjct  299  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPSR  358

Query  78   I  76
            I
Sbjct  359  I  359



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   327 bits (839),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH R
Sbjct  221  ASKTAKSVRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+R
Sbjct  221  ATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+R
Sbjct  162  ATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSR  221

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNK
Sbjct  222  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNK  281

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSR
Sbjct  282  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSR  341

Query  78   I  76
            I
Sbjct  342  I  342



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR
Sbjct  126  ASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTR  185

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            +G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNK
Sbjct  186  MGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNK  245

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSR
Sbjct  246  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSR  305

Query  78   I  76
            I
Sbjct  306  I  306



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAVQAWGLKNCTQKEEW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVQAWGLKNCTQKEEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   325 bits (834),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH R
Sbjct  221  ASKTAKSVRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPSR
Sbjct  341  VAGKVFRIGHLGSLNELQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   319 bits (818),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  58   ASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNR  117

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNK
Sbjct  118  LGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNK  177

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  178  VAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  237

Query  78   I  76
            I
Sbjct  238  I  238



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   325 bits (833),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH R
Sbjct  221  AAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH R
Sbjct  221  AAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   325 bits (832),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            +AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSR
Sbjct  341  IAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   325 bits (832),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            +AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPSR
Sbjct  341  IAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+S RVFFDW DYLKFYK+GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+R
Sbjct  221  ASKTAQSARVFFDWNDYLKFYKIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+R
Sbjct  221  ATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            +AGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSR
Sbjct  341  IAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVF IGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFSIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            +AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPSR
Sbjct  341  IAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPSR  400

Query  78   I  76
            +
Sbjct  401  V  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/181 (91%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDYLKFYKMGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  221  ASKTAKSVRVFFDWKDYLKFYKMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGL NCTQKEEWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLNNCTQKEEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH R
Sbjct  64   ASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHAR  123

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  124  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNK  183

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SR
Sbjct  184  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASR  243

Query  78   I  76
            I
Sbjct  244  I  244



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   323 bits (828),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHTR
Sbjct  221  ASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHTR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            +G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNK
Sbjct  281  MGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+R
Sbjct  221  ASKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            +AGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPSR
Sbjct  341  IAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+R
Sbjct  221  ASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH R
Sbjct  131  ASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHAR  190

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  191  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNK  250

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SR
Sbjct  251  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASR  310

Query  78   I  76
            I
Sbjct  311  I  311



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+R
Sbjct  221  ASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ASKTAKSVRVFFDWSDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAVQAWGLKNCTQKEEW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVQAWGLKNCTQKEEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+R
Sbjct  221  ASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYL+FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+R
Sbjct  221  ASKSAKSVRVFFDWNDYLRFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIASR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+R
Sbjct  221  ASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+R
Sbjct  222  ASKMAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSR  281

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQK+EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLNK
Sbjct  282  LGKATRLAVEAWGLKNCTQKDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLNK  341

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGN+NELQLLGCL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPSR
Sbjct  342  VAGKVFRIGHLGNVNELQLLGCLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPSR  401

Query  78   I  76
            I
Sbjct  402  I  402



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+R
Sbjct  221  ASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ASKMAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   320 bits (819),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHSR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH R
Sbjct  222  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHNR  281

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNK
Sbjct  282  LGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNK  341

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQL+G L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  342  VAGKVFRIGHLGHLNELQLMGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSR  401

Query  78   I  76
            I
Sbjct  402  I  402



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+R
Sbjct  221  ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGN+NELQLLG LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI SR
Sbjct  341  VAGKVFRIGHLGNINELQLLGALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS +VFFDWKDYLKFY+MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ASKTAKSYKVFFDWKDYLKFYQMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L T TRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LATGTRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIASR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTR
Sbjct  221  AAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV AWGLKNCT+KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNK
Sbjct  281  LGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH R
Sbjct  82   ASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNR  141

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGL NC QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNK
Sbjct  142  LGTATRLAVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNK  201

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  202  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSR  261

Query  78   I  76
            I
Sbjct  262  I  262



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   320 bits (821),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKS+RVFFDWKD+LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+R
Sbjct  221  ASKHAKSLRVFFDWKDHLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+R
Sbjct  221  ASKSAKSLRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ EEW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQSEEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+R
Sbjct  221  ASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   320 bits (819),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTR
Sbjct  221  AAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNK
Sbjct  281  LGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   319 bits (818),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+SVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ASKTARSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH R
Sbjct  221  ASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            +G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLNK
Sbjct  281  MGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+R
Sbjct  221  AAKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLNK
Sbjct  281  LGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH R
Sbjct  221  ASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH R
Sbjct  221  ASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGTATRLAVEAWGLKNCTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG LNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSR
Sbjct  341  VAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+R
Sbjct  221  ASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   318 bits (815),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH R
Sbjct  221  ASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIASR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   317 bits (811),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   318 bits (814),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCT+KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGTATRLAVEAWGLKNCTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG LNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPSR
Sbjct  341  VAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   316 bits (810),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+A+SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+R
Sbjct  194  ASKSAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSR  253

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  254  LGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNK  313

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSR
Sbjct  314  VAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSR  373

Query  78   I  76
            I
Sbjct  374  I  374



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   317 bits (812),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+K+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ EEW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQSEEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   317 bits (812),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVEAWGLKNCTQKEEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   317 bits (812),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH R
Sbjct  221  ASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   315 bits (808),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  166  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  225

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  226  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  285

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  286  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  174  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  233

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  234  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  293

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  294  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH R
Sbjct  221  ASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTR
Sbjct  221  ATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASR  400

Query  78   I  76
            +
Sbjct  401  V  401



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   317 bits (811),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHTR
Sbjct  221  ATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHTR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIASR  400

Query  78   I  76
            +
Sbjct  401  V  401



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  177  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  236

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  237  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  296

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  297  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  175  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  234

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  235  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  294

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  295  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+A+SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+R
Sbjct  221  ASKSAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSR
Sbjct  341  VAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   315 bits (806),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGRATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH R
Sbjct  148  ASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNR  207

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNK
Sbjct  208  LGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNK  267

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  268  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSR  327

Query  78   I  76
            I
Sbjct  328  I  328



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   315 bits (808),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK A+SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+R
Sbjct  221  ASKXAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPSR
Sbjct  341  VAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK A+SVRVFFDWKDYL+FY+MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH R
Sbjct  222  ASKAARSVRVFFDWKDYLRFYEMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHNR  281

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATR AV+AWGLKNC QKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNK
Sbjct  282  LGTATRFAVEAWGLKNCCQKEECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNK  341

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  342  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSR  401

Query  78   I  76
            I
Sbjct  402  I  402



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   314 bits (804),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH R
Sbjct  222  ASKTAKSVRVFFDWNDYLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKR  281

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNK
Sbjct  282  LGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNK  341

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  342  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSR  401

Query  78   I  76
            I
Sbjct  402  I  402



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDYLK YK+GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH R
Sbjct  221  ASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  ATRLA++AWGLKNCTQKEEW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   312 bits (800),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  94
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHTR
Sbjct  281  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHTR  340

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATR+AV+AWGLKNCTQKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLNK
Sbjct  341  LGTATRMAVEAWGLKNCTQKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLNK  400

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPSR
Sbjct  401  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPSR  460

Query  78   I  76
            I
Sbjct  461  I  461



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   314 bits (804),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH R
Sbjct  223  ASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNR  282

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNK
Sbjct  283  LGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNK  342

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  343  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSR  402

Query  78   I  76
            I
Sbjct  403  I  403



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  175  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  234

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  235  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNK  294

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  295  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   313 bits (802),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+R
Sbjct  221  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLNK
Sbjct  281  LGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPSR
Sbjct  341  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH R
Sbjct  257  ASKTAKSVRVFFDWNDYLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHKR  316

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLNK
Sbjct  317  LGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLNK  376

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  377  VAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSR  436

Query  78   I  76
            I
Sbjct  437  I  437



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   313 bits (801),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+K+AKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+R
Sbjct  221  AAKSAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLN+LQLLGCL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI SR
Sbjct  341  VAGKVFRIGHLGNLNDLQLLGCLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   313 bits (801),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R
Sbjct  221  ASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASR  400

Query  78   I  76
            +
Sbjct  401  V  401



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  175  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  234

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+A GLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  235  LGKATRLAVEARGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  294

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  295  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   311 bits (796),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW D LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDNLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   310 bits (795),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   311 bits (798),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R
Sbjct  221  ASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASR  400

Query  78   I  76
            +
Sbjct  401  V  401



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   309 bits (791),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   309 bits (791),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH R
Sbjct  221  ASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
             G ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  281  PGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I SR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIASR  400

Query  78   I  76
            +
Sbjct  401  V  401



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   310 bits (793),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   309 bits (792),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   309 bits (792),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   309 bits (792),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   308 bits (788),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGEATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  258  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  317

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  318  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLNK  377

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSR
Sbjct  378  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPSR  437

Query  78   I  76
            I
Sbjct  438  I  438



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  97
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   303 bits (776),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   304 bits (779),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            +AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPSR
Sbjct  341  IAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   303 bits (775),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/173 (89%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            +AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPSR
Sbjct  341  IAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   302 bits (773),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+R
Sbjct  214  ASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSR  273

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATR AV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  274  LGKATRPAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNK  333

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  103
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  334  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPSR
Sbjct  341  VAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   296 bits (759),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHTR
Sbjct  110  AAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHTR  169

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLNK
Sbjct  170  LGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLNK  229

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPSR
Sbjct  230  VAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPSR  289

Query  78   I  76
            I
Sbjct  290  I  290



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I SR
Sbjct  341  VAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   289 bits (740),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -3

Query  576  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  397
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  396  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  217
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  216  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  76
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  121
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   290 bits (743),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  127
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   289 bits (739),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  166  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  225

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  226  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNK  285

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  124
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  286  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   289 bits (740),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  174  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  233

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  234  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLNK  293

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  124
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  294  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  94
            +AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  341  IAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/166 (89%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  165  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHAR  224

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  225  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  284

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  121
            V GKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  285  VXGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  124
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  174  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  233

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  234  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  293

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  124
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  294  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  166  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  225

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  226  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  285

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSG  133
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSG
Sbjct  286  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   286 bits (732),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  165  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHAR  224

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  225  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  284

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  127
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  285  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  169  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  228

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  229  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  288

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  127
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  289  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  127
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   284 bits (727),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  139
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  175  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  234

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  235  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  294

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  139
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  295  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVK  145
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVK  343



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK A S+R +FDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH R
Sbjct  221  ASKHATSLRSYFDWNGYLKCYNLGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  ATRLAV+AWGLKNC Q +E +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLNK
Sbjct  281  LAKATRLAVEAWGLKNCCQNKESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLGN+NELQLLGCLAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPSR
Sbjct  341  VAGKVFRIGHLGNINELQLLGCLAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+K+A SVR FFDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH R
Sbjct  221  ATKSATSVRSFFDWNGYLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHKR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  ATRLAV+AWGLKNC QKEEW+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLNK
Sbjct  281  LAKATRLAVEAWGLKNCCQKEEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGH+G+LNELQLLGCLAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPSR
Sbjct  341  VAGKVFRIGHVGHLNELQLLGCLAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPSR  400

Query  78   I  76
            I
Sbjct  401  I  401



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  148
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 142/157 (90%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  148
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   270 bits (690),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -3

Query  552  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  373
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  372  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  193
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  192  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  76
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTA S RVFFDW DYLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH R
Sbjct  221  AAKTATSPRVFFDWADYLKFYKLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV AWGLK CT++ EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLNK
Sbjct  281  LGEATRLAVAAWGLKLCTKRPEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG +NELQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR
Sbjct  341  VAGKVFRIGHLGFVNELQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSR  400

Query  78   I  76
            +
Sbjct  401  L  401



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTA S RVFFDW DYLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH R
Sbjct  221  AAKTATSPRVFFDWADYLKFYKVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV AWGLK CT++ EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLNK
Sbjct  281  LGEATRLAVAAWGLKLCTKRPEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG +NELQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I SR
Sbjct  341  VAGKVFRIGHLGFVNELQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISSR  400

Query  78   I  76
            +
Sbjct  401  L  401



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  162  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  221

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  222  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  281

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLK  166
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVLK
Sbjct  282  VAGKVFRIGHLGNVNELQLLGCLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   269 bits (687),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVL  169
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  174  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  233

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  234  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  293

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVL  169
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  294  VAGKVFRIGHLGNVNELQLLGCLSGVEMVL  323



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVL  169
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVL  169
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   258 bits (658),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  531  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  352
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  351  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  172
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  171  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  76
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVL  169
            VAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   261 bits (668),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGV  181
            VAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVE  178
            VAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   261 bits (667),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVE  178
            VAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  165  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  224

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  225  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  284

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVE  178
            VAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  285  VAGKVFRIGHLGNVNELQLLGCLSGVE  311



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGV  181
            VAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAG  184
            VAGKVFRIGHLGN+NELQLLGCL+G
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSG  330



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+A+S R FFDW  YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH R
Sbjct  221  ASKSARSPRGFFDWSAYLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  ATRLAV+AWGL+ C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNK
Sbjct  281  LAHATRLAVKAWGLELCVKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG LNELQL+  LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPSR
Sbjct  341  VAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPSR  400

Query  78   I  76
            +
Sbjct  401  L  401



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  246  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGV  181
            VAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  306  VAGKVFRIGHLGNVNELQLLGCLSGV  331



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   258 bits (660),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+A+S R FFDW  YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH R
Sbjct  221  ASKSARSPRGFFDWSAYLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHHR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  ATRLAV+AWGL+ C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLNK
Sbjct  281  LAHATRLAVKAWGLELCIKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG LNELQL+  LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPSR
Sbjct  341  VAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPSR  400

Query  78   I  76
            +
Sbjct  401  L  401



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHT  442
            A+K +KS RVFFDW DYLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH 
Sbjct  221  AAKQSKSTRVFFDWGDYLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHC  280

Query  441  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  262
            RLG ATR AV+AWGL  CTQ  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLN
Sbjct  281  RLGEATRQAVKAWGLTLCTQDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLN  340

Query  261  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  82
            KVAGKVFRIGHLGN+NELQ+LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I S
Sbjct  341  KVAGKVFRIGHLGNVNELQMLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISS  400

Query  81   RI  76
            RI
Sbjct  401  RI  402



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   250 bits (639),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 1/182 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHT  442
            A+K +KS RVFFDW DYLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH 
Sbjct  221  AAKRSKSTRVFFDWGDYLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHC  280

Query  441  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  262
            RL  ATR AV+AWGL  CT+  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLN
Sbjct  281  RLAEATRQAVRAWGLTLCTKDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGLN  340

Query  261  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  82
            KVAGKVFRIGHLGN+NELQLLG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I S
Sbjct  341  KVAGKVFRIGHLGNVNELQLLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIVS  400

Query  81   RI  76
            RI
Sbjct  401  RI  402



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -3

Query  570  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  391
            YLK Y +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKN
Sbjct  185  YLKCYNLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKN  244

Query  390  CTQKEE-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  214
            C Q+EE W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLN
Sbjct  245  CCQQEEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLN  304

Query  213  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  76
            ELQLLGCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  305  ELQLLGCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  163  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  222

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  223  LGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLNK  282

Query  258  VAGKVFRIGHLGNLNELQL  202
            VAGKVFRIGHLGN+NELQL
Sbjct  283  VAGKVFRIGHLGNVNELQL  301



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   241 bits (616),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+R
Sbjct  221  ASKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNEL  208
            VAGKVFRIGHLGNLNE+
Sbjct  341  VAGKVFRIGHLGNLNEV  357



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   243 bits (620),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH R
Sbjct  221  ASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHNR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLL  199
            VAGKVFRIGHLGNLNE+ L+
Sbjct  341  VAGKVFRIGHLGNLNEVTLI  360



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   240 bits (612),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH R
Sbjct  186  ASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHAR  245

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRL V+AWGLKNCT KEE FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLNK
Sbjct  246  LGKATRLXVEAWGLKNCTPKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLNK  305

Query  258  VAGKVFRIGHLGNLNELQLLG  196
            VAGKVFRIGHLGN+NELQLLG
Sbjct  306  VAGKVFRIGHLGNVNELQLLG  326



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH R
Sbjct  82   ASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNR  141

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGL NC QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNK
Sbjct  142  LGTATRLAVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNK  201

Query  258  VAGKVFRIGHLGNLNEL  208
            VAGKVFRIGHLGNLNE+
Sbjct  202  VAGKVFRIGHLGNLNEV  218



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH R
Sbjct  221  ASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHAR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQLL  199
            VAGKVFRIGHLGNLNE+  +
Sbjct  341  VAGKVFRIGHLGNLNEVTFI  360



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   236 bits (602),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+R
Sbjct  221  ATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHSR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLNK
Sbjct  281  LGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNE  211
            VAGKVFRIGHLGNLNE
Sbjct  341  VAGKVFRIGHLGNLNE  356



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH R
Sbjct  221  ASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHRR  280

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLNK  340

Query  258  VAGKVFRIGHLGNLNELQL  202
            VAGKVFRIGHLG+LNE+  
Sbjct  341  VAGKVFRIGHLGHLNEVMF  359



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH R
Sbjct  223  ASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNR  282

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLNK
Sbjct  283  LGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLNK  342

Query  258  VAGKVFRIGHLGNLNEL  208
            VAGKVFRIGHLGNLNE+
Sbjct  343  VAGKVFRIGHLGNLNEV  359



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   221 bits (563),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -3

Query  447  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  268
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  267  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  87   PSRI  76
            PSRI
Sbjct  121  PSRI  124



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 140/181 (77%), Gaps = 19/181 (10%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASK+A S+R FFDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH  
Sbjct  182  ASKSATSLRSFFDWNGYLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH--  239

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
                 +L V            EW+S +VTA+V P  IDS EIV RAWKR NLSLG GLNK
Sbjct  240  -----KLVV------------EWYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLNK  282

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGH+G+LNELQLLGCLAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPSR
Sbjct  283  VAGKVFRIGHVGHLNELQLLGCLAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPSR  342

Query  78   I  76
            I
Sbjct  343  I  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = -3

Query  615  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTR  439
            SK AK  R +FDW +YLK YK GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH R
Sbjct  222  SKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARHLR  281

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  ATR AV+AWGL  C +K +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL +
Sbjct  282  LAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGLGE  341

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            V GKVFRIGHLG +NELQLLG LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I SR
Sbjct  342  VNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIASR  401

Query  78   I  76
            +
Sbjct  402  L  402



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH R
Sbjct  35   ASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNR  94

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  274
            LGTATRLAV+AWGLKNCT+KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  95   LGTATRLAVEAWGLKNCTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   194 bits (492),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH R
Sbjct  35   ASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHNR  94

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  274
            LGTAT LAV+AWGLKNCTQKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  95   LGTATGLAVEAWGLKNCTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVKRAWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKRAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKRYN  141



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDSS+IVK+AWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSSDIVKKAWKRYN  141



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   187 bits (476),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVKRAWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWK+YN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWK+YN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YI+SSEIVK AWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYINSSEIVKMAWKRYN  141



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DY+KFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYMKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWK+YN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVK+AWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI+RH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVISRHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVKRAWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVK+AWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKKAWKRYN  141



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   186 bits (471),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  31   ATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHGR  90

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  286
            L  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YI+S+EIVK AWKRYN
Sbjct  91   LAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYINSAEIVKMAWKRYN  141



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  
Sbjct  221  AGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHH  279

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNK
Sbjct  280  LAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNK  339

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  115
            VAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  340  VAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  
Sbjct  221  AGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHH  279

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNK
Sbjct  280  LAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNK  339

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  115
            VAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  340  VAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  
Sbjct  221  AGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHH  279

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLNK
Sbjct  280  LAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNK  339

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  115
            VAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  340  VAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 129/177 (73%), Gaps = 1/177 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A  TAK  RVFF+++D +K    G Y+PYTPS+ LLYGLR  + ++FEEG +NV  RH  
Sbjct  224  ARHTAKCARVFFNFEDMIKSNATG-YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHHY  282

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L +  R AV AWGLKNC  + +WFSDTVTA+VVP   + ++++  A++RYNL+LG GL K
Sbjct  283  LASGVRAAVSAWGLKNCATEPKWFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLAK  342

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
            VAGKVFRIGHLG+LNEL +LG LAG EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  343  VAGKVFRIGHLGDLNELMVLGALAGAEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
            R FF W+D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R A
Sbjct  228  RCFFSWEDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAA  286

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRI
Sbjct  287  VDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRI  346

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  82
            GHLG L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  347  GHLGALDEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
            R FF W+D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R A
Sbjct  225  RCFFSWEDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAA  283

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRI
Sbjct  284  VDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRI  343

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  82
            GHLG L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  344  GHLGALDEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH  
Sbjct  221  AGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHH  279

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV AWGLK C ++ +W SDTVTA++VP   D++++++ A+KRYNL+LG GL+K
Sbjct  280  LAEGVRAAVAAWGLKPCAKESKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLSK  339

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  115
            VAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  340  VAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTPGSGVAAAQA  387



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            + +  +  RV+FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  
Sbjct  226  SGRNDRLARVYFDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAV  284

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++
Sbjct  285  LGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQ  344

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  345  VAGKVFRIGHVGDLNELSLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            + +  +  RV+FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  
Sbjct  226  SGRNDRLARVYFDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAV  284

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++
Sbjct  285  LGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQ  344

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  345  VAGKVFRIGHVGDLNELSLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 131/173 (76%), Gaps = 1/173 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA+  RVFFD+ D  K    G Y+PYTP++ +LYGLR  L  + +EGL+NV ARH R
Sbjct  221  ASKTAECRRVFFDFGDQAKANATG-YFPYTPALPMLYGLREALRCVEDEGLENVFARHRR  279

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L  +TR AV+AWGL  C ++E+W+SDTV+AV+VP  ++ +E++  A+KRYNL+LG GL++
Sbjct  280  LADSTRAAVEAWGLTLCAKEEKWYSDTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLSQ  339

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGK+FRIGH+G+LNEL LLG LAGVEM + D G  ++ GSGVAAA   L+ +
Sbjct  340  VAGKLFRIGHIGDLNELMLLGALAGVEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 127/176 (72%), Gaps = 1/176 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA S R +FD+ D +K    G Y+PYTP + LLYGLR  L ++ +EGL+N+  RH+ 
Sbjct  216  ASKTATSKRCYFDFDDMIKANATG-YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSH  274

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV+AWGL  C ++ +W+SDTVTA+VVP   ++ +++  A+ RYNLSLG GL++
Sbjct  275  LAGGVRAAVKAWGLTPCAKEPKWYSDTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQ  334

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  91
            VAGKVFRIGHLG+LNEL +LG LAG EM + D+G PV LGSGV AA ++ +   P+
Sbjct  335  VAGKVFRIGHLGDLNELMVLGALAGAEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
            RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR A
Sbjct  211  RVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQA  269

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  270  VAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRI  329

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  330  GHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  374



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 1/173 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            + +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  
Sbjct  226  SGRNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAV  284

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++
Sbjct  285  LGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQ  344

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  345  VAGKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
            RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR A
Sbjct  234  RVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  353  GHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
            RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH  LG ATR A
Sbjct  234  RVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHAVLGEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  353  GHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = -3

Query  609  TAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGT  430
            TA   R +F+  D+ K    G Y+PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L +
Sbjct  193  TATCTRAYFNLADHFK-ANAGGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLAS  251

Query  429  ATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAG  250
             TR AV AWGL  C ++ +W SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAG
Sbjct  252  GTRAAVDAWGLSLCAKEPKWQSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAG  311

Query  249  KVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            K+FRIGHLG+LNEL LLG ++G EM ++D+G  V+ GSGVAAA  Y +N 
Sbjct  312  KLFRIGHLGDLNELMLLGAISGAEMSMRDVGIQVEPGSGVAAAQEYFRNA  361



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 126/171 (74%), Gaps = 1/171 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            ASKTA   RVFFD+ D +K    G Y+PYTP++ +LYGLR  L +LFEE L++V  RH  
Sbjct  216  ASKTAGLKRVFFDFNDMIKANATG-YFPYTPALPMLYGLRESLKILFEEKLEHVFERHHV  274

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV+AWGLK C  + +W+SDTVTA+VVP  I+ ++++  A++RYNLSLG GL++
Sbjct  275  LAGGVRAAVKAWGLKPCATEPKWYSDTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLSQ  334

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            VAGKVFRIGHLG+LN+L +LG + G EM + D+G  VKLGSGV AA A+ +
Sbjct  335  VAGKVFRIGHLGDLNDLMVLGAIGGAEMAMADVGIDVKLGSGVGAAQAHFR  385



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 129/187 (69%), Gaps = 4/187 (2%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A  +AK  RV+F + D LK  K G   PYTP + LL+GL+A L LL  EGLDNV ARH R
Sbjct  194  ARSSAKLKRVYFSFDDMLKTNKNGGV-PYTPILPLLHGLKASLGLLNAEGLDNVFARHHR  252

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L   TR AV AWGLK   ++  W SDT+T V VP  +DS +IV  A+ +YNLSLGLGL +
Sbjct  253  LAEGTRAAVAAWGLKLLCREPRWQSDTLTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLAE  312

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            V GKVFRIGHLGN++EL L G L GVEM L+D+G P++LGSGV AA    Q  TP+IP+R
Sbjct  313  VQGKVFRIGHLGNMDELMLAGALGGVEMTLRDVGLPIELGSGVGAALKVWQEGTPVIPTR  372

Query  78   I*FKCVI  58
               +C++
Sbjct  373  ---ECLM  376



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
             V+FDW D+ K    G Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  LG ATR A
Sbjct  234  HVYFDWADHQKQNGAG-YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLGEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFVRYNLALGAGLSQVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            GH+G+LNEL LLG +AG EM + D G  V+ GSGVAAAS+YL+
Sbjct  353  GHVGDLNELSLLGAIAGAEMAMLDNGVKVQPGSGVAAASSYLR  395



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 1/180 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A  TAKS R F D +D++     G Y+PYTPSI LLYGLR  +DLL EEGL NV ARH R
Sbjct  216  ARHTAKSRRCFLDIQDHITNNASG-YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQR  274

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV+AWGL+ C +  +W+S+TV+A+VVP   D+ +++  A+ RYNLSLG GL++
Sbjct  275  LAEGVRRAVKAWGLELCARDPKWYSNTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLSE  334

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  79
            VAGKVFRIGHLG+LNEL L   +AG EM ++D+G  V  GSGVAAA  Y + T P +  R
Sbjct  335  VAGKVFRIGHLGDLNELMLCSAIAGAEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKPR  394



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 122/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
             V+FDW D+ K    G Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  L  ATR A
Sbjct  234  HVYFDWADHQKQNGAG-YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA++VP  ID++ I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKEAKWNSDTVTAILVPEGIDAAAIIKHAFVRYNLALGAGLSQVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            GH+G+LNEL LLG +AG EM + D G  V+ GSGVAAAS+YL+
Sbjct  353  GHVGDLNELSLLGAIAGAEMAMLDNGVKVQPGSGVAAASSYLR  395



>sp|O08374.2|SGAA_HYPME RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Hyphomicrobium methylovorum]
 dbj|BAA19919.1| serine-glyoxylate aminotransferase [Hyphomicrobium methylovorum]
Length=405

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 120/170 (71%), Gaps = 1/170 (1%)
 Frame = -3

Query  615  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRL  436
            SK  +  R FF ++D +K    G ++PYTP+ QLL GLR  LDLLF EGLDNV ARHTRL
Sbjct  219  SKNGRMNRCFFSFEDMIKTNDQG-FFPYTPATQLLRGLRTSLDLLFAEGLDNVFARHTRL  277

Query  435  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  256
             +  R AV AWGLK C ++ +W+SDTV+A++VP  IDS+ I K A+ RYN S GLGLNKV
Sbjct  278  ASGVRAAVDAWGLKLCAKEPKWYSDTVSAILVPEGIDSNAITKTAYYRYNTSFGLGLNKV  337

Query  255  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            AGKVFRIGHLG L+E+ + G L   EM LKD G  +KLGSG  AA+ Y  
Sbjct  338  AGKVFRIGHLGMLDEVMIGGALFAAEMALKDNGVNLKLGSGTGAAAEYFS  387



>ref|WP_013217108.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|ADJ24949.1| aminotransferase class V [Hyphomicrobium denitrificans ATCC 51888]
Length=402

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = -3

Query  615  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRL  436
            SK  +  R FF ++D +K   +G ++PYTP+  L+ GLRA +DLL  EG+DNV+ARH RL
Sbjct  219  SKNGRMNRCFFSFEDMIKTNDLG-FFPYTPATTLIRGLRASIDLLLAEGIDNVVARHHRL  277

Query  435  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  256
             +  R  V AWGLK C ++ +W+SDTV+A++VP  +DS+ + K A+ RYN SLGLGLNKV
Sbjct  278  ASGVRAGVAAWGLKLCAKEPKWYSDTVSAILVPEGVDSNAVTKTAYYRYNTSLGLGLNKV  337

Query  255  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            AGKVFRIGHLG+L+E  + G L  VEM LKD G PVKLGSG AAA+ Y  + 
Sbjct  338  AGKVFRIGHLGSLDEYMVGGVLFAVEMALKDNGIPVKLGSGTAAAAEYFTSN  389



>ref|WP_020085137.1| serine--glyoxylate aminotransferase [Hyphomicrobium zavarzinii]
Length=400

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
            R FF W+D +K   +G ++PYTP+ QL+ GLRA L+L+F EG+DN++ARHTRL +  R A
Sbjct  227  RCFFSWEDMIKTNDLG-FFPYTPATQLIRGLRASLNLIFAEGIDNIVARHTRLASGVRAA  285

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTV+A+VVP  ID++ ++K A+ RYN SLG GLNK+ G+VFRI
Sbjct  286  VDAWGLKLCAKEPKWHSDTVSAIVVPEGIDANNVLKTAYYRYNTSLGTGLNKLNGRVFRI  345

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG L+E  +   L  VEM LKD G P+K GSG  AA+ Y   T
Sbjct  346  GHLGALDEGMIGSALFNVEMTLKDCGVPIKFGSGTGAAAEYFSKT  390



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A+KTA   RV+FD+ D +K    G Y+PYTP++ +LYGLR  + +LFEE L++V  RH  
Sbjct  216  ATKTAGLKRVYFDFADMIKANATG-YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHV  274

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV+AWGL  C ++ +W SDTVTA+VVP+ I+ ++++  A++RYNLSLG GL++
Sbjct  275  LAGGVRAAVKAWGLHPCAKEAKWDSDTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQ  334

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            VAGKVFRIGHLG+LN+L +LG +AG EM ++D+G  ++LGSGV AA  + ++T
Sbjct  335  VAGKVFRIGHLGDLNDLMVLGAIAGAEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>ref|WP_015599474.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|AGK59459.1| class V aminotransferase [Hyphomicrobium denitrificans 1NES1]
Length=406

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -3

Query  615  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRL  436
            SK  +  R FF ++D +K    G ++PYTP+  L+ GLR  +DLL  EG+DNV+ARH RL
Sbjct  220  SKNGRMNRCFFSFEDMIKTNDQG-FFPYTPATTLIRGLRTSIDLLLGEGIDNVVARHHRL  278

Query  435  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  256
             +  R  V AWGLK C ++ +W SDTV+AV+VP   DS+ + K A+ RYN SLGLGLNKV
Sbjct  279  ASGVRAGVHAWGLKLCAKEPKWHSDTVSAVLVPEGFDSNVVTKTAYYRYNTSLGLGLNKV  338

Query  255  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  103
            AGKVFRIGHLG+L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N
Sbjct  339  AGKVFRIGHLGSLDEFMVGGVLFAVEMALKDCGIPVKLGSGTGAAAEYFTN  389



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
             V+FDW D+ K    G Y+PYTP + LLYGLR  L  L EEGL+NV  RH  L  ATR A
Sbjct  234  HVYFDWADHQKQNGAG-YFPYTPPLPLLYGLREALACLREEGLENVYNRHKVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFMRYNLALGAGLSQVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GH+G+LNEL LLG +AG EM + D G  V+ GSGVAAAS+YL+  
Sbjct  353  GHVGDLNELSLLGAIAGAEMSMLDNGVKVQPGSGVAAASSYLREN  397



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A KT K  R +F+++D +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  
Sbjct  221  AGKTNKGRRAYFEFQDMIAQNANG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHHH  279

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L   TR AV AWGLK C ++ +W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL++
Sbjct  280  LAEGTRAAVAAWGLKTCAKEPKWNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLSE  339

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            VAGKVFRIGHLG+LNEL LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  340  VAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 125/176 (71%), Gaps = 1/176 (1%)
 Frame = -3

Query  615  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRL  436
            SK     RVFF ++D +    +G Y+PYTPSI LLYGL+  L +L EEGL++V  RH RL
Sbjct  219  SKKNNLHRVFFSFEDMIVNNDVG-YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHRRL  277

Query  435  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  256
                R AV+AWGLK C +  + +SDTVTAVVVP   D+ ++++ A+++YNLSLG GL KV
Sbjct  278  AHGVRRAVEAWGLKTCCKNPKEYSDTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLMKV  337

Query  255  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  88
             G+VFRIGHLG+LNEL +L  LAG EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  338  RGRVFRIGHLGDLNELMVLATLAGTEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|WP_042673896.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B34]
Length=402

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+N+  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENIYHRHHVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_043385155.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
Length=402

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -3

Query  612  KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLG  433
            KT K  R +F+++D +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH  L 
Sbjct  223  KTNKGRRAYFEFQDMIAQNANG-YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHHHLA  281

Query  432  TATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVA  253
               R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GL++VA
Sbjct  282  EGCRAAVAAWGLKTCAKEPKWNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLSEVA  341

Query  252  GKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  106
            GKVFRIGHLG+LNEL LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  342  GKVFRIGHLGDLNELMLLGAIAGAEMAMLDNGIKIQPGSGVAAAQAVFR  390



>ref|WP_043355705.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B1]
Length=402

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_010687105.1| Aminotransferase class V [Methylobacterium mesophilicum]
 gb|EMS39671.1| Aminotransferase class V [Methylobacterium mesophilicum SR1.6/6]
Length=402

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L+++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALEIVKEEGLENVYHRHHVLAEATRQA  292

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAFERYNLSLGAGLSKVAGKVFRI  352

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>gb|AIQ91949.1| Aminotransferase class V [Methylobacterium oryzae CBMB20]
Length=443

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  275  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  333

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  334  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRI  393

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  394  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  438



>ref|WP_013949995.1| MULTISPECIES: serine--glyoxylate aminotransferase [Hyphomicrobium]
 emb|CCB67605.1| serine-glyoxylate aminotransferase [Hyphomicrobium sp. MC1]
Length=406

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  415
            R FF W+D +K   +G Y+PYTP+ QL+ GLRA LDL+  EG+DNV+ARH R+ +  R A
Sbjct  227  RCFFSWEDMIKTNDLG-YFPYTPATQLIRGLRASLDLILAEGIDNVVARHHRMASGVRAA  285

Query  414  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  235
            V AWGLK C ++ +W SDTV+A++VP   D++ ++K A+ RYN SLG GLNKVAGKVFRI
Sbjct  286  VDAWGLKLCAKEPKWHSDTVSAILVPEGADANAVLKTAYYRYNTSLGTGLNKVAGKVFRI  345

Query  234  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            GHLG ++E  + G L  VEM LKD G  +KLGSG  AA+ Y   T
Sbjct  346  GHLGAVDEFMVGGVLFAVEMALKDSGINIKLGSGTGAAAEYFSKT  390



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 126/177 (71%), Gaps = 2/177 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A +TAKS R +FD  D +K    G Y+PYTP++ LLYGLR  LDL+F+EGLDNV ARH  
Sbjct  224  AIETAKSKRCYFDLGDMIKANATG-YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHHH  282

Query  438  LGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  262
            L    R AV + WGL+ C +  +W+SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+
Sbjct  283  LAQGVRAAVTEGWGLELCAKGPKWYSDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGLS  342

Query  261  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  91
            KVAGKVFRIGHLG+LNEL L   +AG EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  343  KVAGKVFRIGHLGDLNELMLTSAIAGAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>gb|AID30749.1| serine--glyoxylate aminotransferase [Mesorhizobium huakuii 7653R]
Length=249

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 120/173 (69%), Gaps = 1/173 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            AS+TA   R FF ++D ++    G Y+PYTP+ QLL GLRA LDL+ EEGLDN+ ARH R
Sbjct  69   ASRTATHRRCFFSFEDMIRANDAG-YFPYTPATQLLRGLRASLDLIAEEGLDNIFARHHR  127

Query  438  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  259
            L    R AV AWGLK C +  +W SDTV+A++VP  IDS++IVKRA++ Y  SLG GLNK
Sbjct  128  LAEGVRKAVDAWGLKLCAKAPKWHSDTVSAILVPEGIDSADIVKRAYRTYQTSLGGGLNK  187

Query  258  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  100
            V GKVFRIGHLG LNE+ +L  L+  EM L D G  +  GSGV AA  + + +
Sbjct  188  VMGKVFRIGHLGWLNEVMVLSSLSAAEMALLDCGVRLAPGSGVGAAIQHFRAS  240



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            AS+TA S R +FD  D +K    G Y+PYTP++ LLYGLR  LDLLFEEGLDNV ARH  
Sbjct  224  ASETATSRRCYFDLADMIKANATG-YFPYTPALPLLYGLRTALDLLFEEGLDNVFARHHY  282

Query  438  LGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  262
            L    R A+ + W L  C +  +W SDTV+A+VVP   +++ ++ RA++RYNL+LG GL+
Sbjct  283  LAQGVRAAITEGWDLGVCAKAPKWHSDTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGLS  342

Query  261  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  112
            KVAGKVFRIGHLG+LNEL L+G +AG EM + DIG  V+ GSG  AA+ Y
Sbjct  343  KVAGKVFRIGHLGDLNELMLMGAIAGAEMAMLDIGIDVRPGSGTGAAAQY  392



>ref|WP_011630756.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
 gb|ABI60946.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis 
CGDNIH1]
Length=394

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRL  418
            RV+FD++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R 
Sbjct  228  RVYFDFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVRE  286

Query  417  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  238
            AV+AWGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FR
Sbjct  287  AVKAWGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFR  346

Query  237  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  112
            IGHLG+LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  347  IGHLGDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  388



>ref|WP_038511699.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 121/162 (75%), Gaps = 2/162 (1%)
 Frame = -3

Query  594  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHTRLGTATRL  418
            RV+FD++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNVIARH  L    R 
Sbjct  228  RVYFDFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNVIARHHYLAQGVRE  286

Query  417  AVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFR  238
            AV+AWGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+LG GL++VAGK+FR
Sbjct  287  AVKAWGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFR  346

Query  237  IGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  112
            IGHLG+LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  347  IGHLGDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  388



>ref|WP_031597721.1| serine--glyoxylate aminotransferase [Ferrovum myxofaciens]
Length=398

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -3

Query  618  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  439
            A++ ++  R +FD+ D +K    G Y+PYTPSI +LYGLR  L +L EEGL+NV ARH  
Sbjct  216  AAQNSRHPRCYFDYLDMVKSNGTG-YFPYTPSIPMLYGLREALVMLEEEGLENVFARHHY  274

Query  438  LGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  262
            L    R AV Q W L  C +  +W+SD+V+A+VVP+  +++E+++RA++RYNL+LG GL+
Sbjct  275  LAEGVRAAVTQGWKLSLCAKAPQWYSDSVSAIVVPAGFNAAEVIERAYRRYNLALGAGLS  334

Query  261  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  112
            KVAGKVFRIGHLG+LNE+ L+G +AG EM + D G PV  GSGVAAA+ +
Sbjct  335  KVAGKVFRIGHLGDLNEVMLMGAIAGAEMAMLDCGIPVTPGSGVAAATQF  384



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520