BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028C20

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004235375.1|  PREDICTED: uncharacterized protein LOC101251266  90.1    4e-19   Solanum lycopersicum
ref|XP_009622594.1|  PREDICTED: uncharacterized protein LOC104113973  89.0    9e-19   Nicotiana tomentosiformis
ref|XP_011087555.1|  PREDICTED: uncharacterized protein LOC105169004  89.0    9e-19   Sesamum indicum [beniseed]
ref|XP_006364375.1|  PREDICTED: uncharacterized protein LOC102604825  88.6    1e-18   Solanum tuberosum [potatoes]
ref|XP_007145042.1|  hypothetical protein PHAVU_007G205000g           88.6    1e-18   Phaseolus vulgaris [French bean]
ref|XP_009777595.1|  PREDICTED: uncharacterized protein LOC104227135  87.4    4e-18   Nicotiana sylvestris
emb|CDP15177.1|  unnamed protein product                              87.4    4e-18   Coffea canephora [robusta coffee]
ref|NP_001236699.1|  uncharacterized protein LOC100305789             87.4    4e-18   Glycine max [soybeans]
ref|XP_006382263.1|  hypothetical protein POPTR_0005s00470g           86.7    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009388124.1|  PREDICTED: uncharacterized protein LOC103974943  86.7    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010276591.1|  PREDICTED: uncharacterized protein LOC104611304  86.3    8e-18   
ref|XP_010094902.1|  hypothetical protein L484_022651                 85.9    1e-17   Morus notabilis
ref|XP_007206740.1|  hypothetical protein PRUPE_ppa025034mg           85.9    1e-17   
ref|XP_010675933.1|  PREDICTED: uncharacterized protein LOC104891857  85.5    2e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004495807.1|  PREDICTED: uncharacterized protein LOC101500...  85.5    2e-17   Cicer arietinum [garbanzo]
gb|EYU33787.1|  hypothetical protein MIMGU_mgv1a017026mg              85.1    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_008388424.1|  PREDICTED: uncharacterized protein LOC103450811  85.1    2e-17   Malus domestica [apple tree]
ref|XP_009335542.1|  PREDICTED: uncharacterized protein LOC103928255  84.7    3e-17   
ref|XP_008246319.1|  PREDICTED: uncharacterized protein LOC103344508  84.7    3e-17   Prunus mume [ume]
ref|XP_010042389.1|  PREDICTED: uncharacterized protein LOC104431458  84.7    3e-17   
ref|XP_004495806.1|  PREDICTED: uncharacterized protein LOC101500...  85.9    3e-17   
ref|NP_001042596.2|  Os01g0250600                                     84.7    3e-17   
gb|EAY73312.1|  hypothetical protein OsI_01186                        84.7    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_002512579.1|  conserved hypothetical protein                   84.3    4e-17   
gb|KDO45244.1|  hypothetical protein CISIN_1g034386mg                 84.3    4e-17   Citrus sinensis [apfelsine]
ref|XP_007040723.1|  40S ribosomal protein S23-1                      84.0    6e-17   
ref|XP_010674483.1|  PREDICTED: uncharacterized protein LOC104890629  83.6    9e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH43129.1|  hypothetical protein MTR_1g484930                     83.6    9e-17   Medicago truncatula
ref|XP_003566365.1|  PREDICTED: uncharacterized protein LOC100824486  83.6    9e-17   Brachypodium distachyon [annual false brome]
ref|XP_008788173.1|  PREDICTED: uncharacterized protein LOC103706018  83.2    1e-16   Phoenix dactylifera
gb|KHG09109.1|  hypothetical protein F383_14708                       83.2    1e-16   Gossypium arboreum [tree cotton]
ref|XP_008453135.1|  PREDICTED: uncharacterized protein LOC103493937  82.8    1e-16   Cucumis melo [Oriental melon]
ref|NP_001144560.1|  uncharacterized protein LOC100277564             82.8    1e-16   Zea mays [maize]
gb|AFW71242.1|  hypothetical protein ZEAMMB73_291095                  82.8    2e-16   
gb|AFW71243.1|  hypothetical protein ZEAMMB73_291095                  83.6    2e-16   
ref|XP_004972980.1|  PREDICTED: uncharacterized protein LOC101772...  81.6    4e-16   
ref|XP_004968065.1|  PREDICTED: uncharacterized protein LOC101758...  81.6    5e-16   
ref|XP_002894674.1|  hypothetical protein ARALYDRAFT_474839           81.3    6e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_006840362.1|  hypothetical protein AMTR_s00045p00119230        81.3    6e-16   Amborella trichopoda
ref|XP_010511320.1|  PREDICTED: uncharacterized protein LOC104787436  81.3    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006303041.1|  hypothetical protein CARUB_v10021196mg           81.3    7e-16   Capsella rubella
ref|XP_004302332.1|  PREDICTED: uncharacterized protein LOC101291443  80.9    8e-16   Fragaria vesca subsp. vesca
ref|XP_006428326.1|  hypothetical protein CICLE_v10013195mg           80.5    1e-15   Citrus clementina [clementine]
gb|AFK43948.1|  unknown                                               80.1    1e-15   Medicago truncatula
ref|NP_564723.1|  uncharacterized protein                             80.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144737.1|  PREDICTED: uncharacterized protein LOC101221073  79.7    2e-15   Cucumis sativus [cucumbers]
dbj|BAJ91957.1|  predicted protein                                    80.1    2e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE77284.1|  unknown                                               79.3    3e-15   Picea sitchensis
ref|XP_010549224.1|  PREDICTED: uncharacterized protein LOC104820476  79.0    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_007199335.1|  hypothetical protein PRUPE_ppa023934mg           78.6    5e-15   
ref|XP_006404044.1|  hypothetical protein EUTSA_v10010969mg           78.2    8e-15   Eutrema salsugineum [saltwater cress]
emb|CDY65927.1|  BnaC09g51670D                                        77.4    1e-14   Brassica napus [oilseed rape]
ref|XP_009113363.1|  PREDICTED: uncharacterized protein LOC103838667  77.4    2e-14   Brassica rapa
emb|CDY67020.1|  BnaCnng53180D                                        77.0    2e-14   Brassica napus [oilseed rape]
ref|XP_011023865.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  77.0    2e-14   Populus euphratica
ref|XP_002455372.1|  hypothetical protein SORBIDRAFT_03g009500        74.3    2e-13   
ref|XP_002455154.1|  hypothetical protein SORBIDRAFT_03g005200        74.3    2e-13   
gb|EPS70280.1|  hypothetical protein M569_04483                       70.9    2e-12   Genlisea aurea
emb|CAN65746.1|  hypothetical protein VITISV_037764                   64.3    6e-10   Vitis vinifera
ref|XP_002279694.1|  PREDICTED: uncharacterized protein LOC100249447  64.3    6e-10   Vitis vinifera
ref|XP_006375711.1|  hypothetical protein POPTR_0013s00390g           60.8    8e-09   
gb|EMT16685.1|  hypothetical protein F775_00317                       55.8    7e-07   



>ref|XP_004235375.1| PREDICTED: uncharacterized protein LOC101251266 [Solanum lycopersicum]
Length=96

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKKG  540
            GPRIT PRS RW ACGAV+ SS+TALLVRLFSPECEPQNIAAYDKKG
Sbjct  50   GPRITVPRSLRWAACGAVTVSSSTALLVRLFSPECEPQNIAAYDKKG  96



>ref|XP_009622594.1| PREDICTED: uncharacterized protein LOC104113973 [Nicotiana tomentosiformis]
 ref|XP_009622595.1| PREDICTED: uncharacterized protein LOC104113973 [Nicotiana tomentosiformis]
 ref|XP_009622596.1| PREDICTED: uncharacterized protein LOC104113973 [Nicotiana tomentosiformis]
 ref|XP_009622597.1| PREDICTED: uncharacterized protein LOC104113973 [Nicotiana tomentosiformis]
 ref|XP_009622598.1| PREDICTED: uncharacterized protein LOC104113973 [Nicotiana tomentosiformis]
 ref|XP_009622599.1| PREDICTED: uncharacterized protein LOC104113973 [Nicotiana tomentosiformis]
 ref|XP_009622600.1| PREDICTED: uncharacterized protein LOC104113973 [Nicotiana tomentosiformis]
Length=96

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKKG  540
            GPRIT PRS RW  CGA+S SS+TALLVRLFSPECEPQNIAAYDKKG
Sbjct  50   GPRITVPRSLRWATCGAISMSSSTALLVRLFSPECEPQNIAAYDKKG  96



>ref|XP_011087555.1| PREDICTED: uncharacterized protein LOC105169004 [Sesamum indicum]
 ref|XP_011087556.1| PREDICTED: uncharacterized protein LOC105169004 [Sesamum indicum]
 ref|XP_011087557.1| PREDICTED: uncharacterized protein LOC105169004 [Sesamum indicum]
 ref|XP_011087558.1| PREDICTED: uncharacterized protein LOC105169004 [Sesamum indicum]
Length=96

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW ACGA+STS+TTALLVRLFSPECEPQNIAAYD+K
Sbjct  50   GPRITVPRSLRWAACGAISTSTTTALLVRLFSPECEPQNIAAYDRK  95



>ref|XP_006364375.1| PREDICTED: uncharacterized protein LOC102604825 [Solanum tuberosum]
Length=96

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKKG  540
            GPRIT PRS RW  CGAV+ SS+TALLVRLFSPECEPQNIAAYDKKG
Sbjct  50   GPRITVPRSLRWATCGAVTVSSSTALLVRLFSPECEPQNIAAYDKKG  96



>ref|XP_007145042.1| hypothetical protein PHAVU_007G205000g [Phaseolus vulgaris]
 gb|ESW17036.1| hypothetical protein PHAVU_007G205000g [Phaseolus vulgaris]
Length=96

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRITNPRS RW ACGAV+ SS+TALLVRLFSPECEPQNIAAYD K
Sbjct  50   GPRITNPRSLRWAACGAVTVSSSTALLVRLFSPECEPQNIAAYDNK  95



>ref|XP_009777595.1| PREDICTED: uncharacterized protein LOC104227135 [Nicotiana sylvestris]
 ref|XP_009777596.1| PREDICTED: uncharacterized protein LOC104227135 [Nicotiana sylvestris]
 ref|XP_009777597.1| PREDICTED: uncharacterized protein LOC104227135 [Nicotiana sylvestris]
 ref|XP_009777598.1| PREDICTED: uncharacterized protein LOC104227135 [Nicotiana sylvestris]
 ref|XP_009777599.1| PREDICTED: uncharacterized protein LOC104227135 [Nicotiana sylvestris]
Length=96

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKKG  540
            GPRIT PRS RW  CG +S SS+TALLVRLFSPECEPQNIAAYDKKG
Sbjct  50   GPRITVPRSLRWATCGTISMSSSTALLVRLFSPECEPQNIAAYDKKG  96



>emb|CDP15177.1| unnamed protein product [Coffea canephora]
Length=96

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW ACGA++TSS+TALLVRLFSPECEPQNIAA+DKK
Sbjct  50   GPRITIPRSLRWAACGAITTSSSTALLVRLFSPECEPQNIAAFDKK  95



>ref|NP_001236699.1| uncharacterized protein LOC100305789 [Glycine max]
 ref|XP_003555772.1| PREDICTED: uncharacterized protein LOC100793929 isoform X1 [Glycine 
max]
 ref|XP_006605290.1| PREDICTED: uncharacterized protein LOC100305789 isoform X1 [Glycine 
max]
 ref|XP_006605291.1| PREDICTED: uncharacterized protein LOC100305789 isoform X2 [Glycine 
max]
 ref|XP_006605292.1| PREDICTED: uncharacterized protein LOC100305789 isoform X3 [Glycine 
max]
 ref|XP_006605774.1| PREDICTED: uncharacterized protein LOC100793929 isoform X2 [Glycine 
max]
 ref|XP_006605775.1| PREDICTED: uncharacterized protein LOC100793929 isoform X3 [Glycine 
max]
 gb|ACU13648.1| unknown [Glycine max]
 gb|KHN26194.1| hypothetical protein glysoja_035487 [Glycine soja]
 gb|KHN26208.1| hypothetical protein glysoja_035501 [Glycine soja]
Length=96

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRITNPRS RW ACGAV+ SS TALLVRLFSPECEPQNIAAYD K
Sbjct  50   GPRITNPRSLRWAACGAVTASSGTALLVRLFSPECEPQNIAAYDNK  95



>ref|XP_006382263.1| hypothetical protein POPTR_0005s00470g [Populus trichocarpa]
 ref|XP_011039040.1| PREDICTED: uncharacterized protein LOC105135715 [Populus euphratica]
 ref|XP_011039041.1| PREDICTED: uncharacterized protein LOC105135715 [Populus euphratica]
 ref|XP_011039042.1| PREDICTED: uncharacterized protein LOC105135715 [Populus euphratica]
 gb|ERP60060.1| hypothetical protein POPTR_0005s00470g [Populus trichocarpa]
Length=96

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRITNPRS RW ACGA++ SST+ALLVRLFSPECEPQNIAAYDK
Sbjct  50   GPRITNPRSLRWAACGAIAWSSTSALLVRLFSPECEPQNIAAYDK  94



>ref|XP_009388124.1| PREDICTED: uncharacterized protein LOC103974943 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388131.1| PREDICTED: uncharacterized protein LOC103974943 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388138.1| PREDICTED: uncharacterized protein LOC103974943 [Musa acuminata 
subsp. malaccensis]
Length=96

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRITNPRS RW +CGA+S SST+ALLVRLFSPECEPQNIAA+DK
Sbjct  50   GPRITNPRSLRWASCGAISVSSTSALLVRLFSPECEPQNIAAFDK  94



>ref|XP_010276591.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276592.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276593.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276594.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276595.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276596.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276597.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276598.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276599.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276600.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
 ref|XP_010276601.1| PREDICTED: uncharacterized protein LOC104611304 [Nelumbo nucifera]
Length=96

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW ACGAVS SST+ALLVRLFSPECEPQNIAAYDK
Sbjct  50   GPRITVPRSLRWAACGAVSMSSTSALLVRLFSPECEPQNIAAYDK  94



>ref|XP_010094902.1| hypothetical protein L484_022651 [Morus notabilis]
 gb|EXB57545.1| hypothetical protein L484_022651 [Morus notabilis]
Length=98

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRSFRW ACGA+S  ST+ALLVRLFSPECEPQNIAAYDK
Sbjct  50   GPRITVPRSFRWAACGAISVGSTSALLVRLFSPECEPQNIAAYDK  94



>ref|XP_007206740.1| hypothetical protein PRUPE_ppa025034mg [Prunus persica]
 gb|EMJ07939.1| hypothetical protein PRUPE_ppa025034mg [Prunus persica]
Length=96

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW ACGAVS SSTTALLVRLFSPECEPQNIA YDK
Sbjct  50   GPRITVPRSLRWAACGAVSMSSTTALLVRLFSPECEPQNIATYDK  94



>ref|XP_010675933.1| PREDICTED: uncharacterized protein LOC104891857 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010675934.1| PREDICTED: uncharacterized protein LOC104891857 [Beta vulgaris 
subsp. vulgaris]
Length=96

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPR+T PRS RW ACG VS SSTTALLVRLFSPECEPQNIAAYD K
Sbjct  50   GPRVTIPRSLRWAACGGVSVSSTTALLVRLFSPECEPQNIAAYDNK  95



>ref|XP_004495807.1| PREDICTED: uncharacterized protein LOC101500096 isoform X2 [Cicer 
arietinum]
Length=96

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW ACGAV+ SS+TALLVRLFSPECEPQNIAAYD K
Sbjct  50   GPRITIPRSLRWAACGAVTVSSSTALLVRLFSPECEPQNIAAYDNK  95



>gb|EYU33787.1| hypothetical protein MIMGU_mgv1a017026mg [Erythranthe guttata]
Length=96

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            G RIT PRS RW ACGAVSTS+TTALLVRLFSPECEPQNIAAYD K
Sbjct  50   GTRITVPRSLRWAACGAVSTSATTALLVRLFSPECEPQNIAAYDHK  95



>ref|XP_008388424.1| PREDICTED: uncharacterized protein LOC103450811 [Malus domestica]
 ref|XP_008388425.1| PREDICTED: uncharacterized protein LOC103450811 [Malus domestica]
 ref|XP_009365459.1| PREDICTED: uncharacterized protein LOC103955311 [Pyrus x bretschneideri]
 ref|XP_009365460.1| PREDICTED: uncharacterized protein LOC103955311 [Pyrus x bretschneideri]
Length=96

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW ACGAVS SS+TALLVRLFSPECEPQNIA YDK
Sbjct  50   GPRITVPRSLRWAACGAVSVSSSTALLVRLFSPECEPQNIATYDK  94



>ref|XP_009335542.1| PREDICTED: uncharacterized protein LOC103928255 [Pyrus x bretschneideri]
Length=96

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW ACGAVS SS+TALLVRLFSPECEPQNIA YDK
Sbjct  50   GPRITVPRSLRWAACGAVSVSSSTALLVRLFSPECEPQNIATYDK  94



>ref|XP_008246319.1| PREDICTED: uncharacterized protein LOC103344508 [Prunus mume]
Length=96

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PR+ RW ACGAVS SSTTALLVRLFSPECEPQNIA YDK
Sbjct  50   GPRITVPRTLRWAACGAVSMSSTTALLVRLFSPECEPQNIATYDK  94



>ref|XP_010042389.1| PREDICTED: uncharacterized protein LOC104431458 [Eucalyptus grandis]
 ref|XP_010042396.1| PREDICTED: uncharacterized protein LOC104431458 [Eucalyptus grandis]
 ref|XP_010042401.1| PREDICTED: uncharacterized protein LOC104431458 [Eucalyptus grandis]
 ref|XP_010042408.1| PREDICTED: uncharacterized protein LOC104431458 [Eucalyptus grandis]
 ref|XP_010042413.1| PREDICTED: uncharacterized protein LOC104431458 [Eucalyptus grandis]
Length=96

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW ACGAVS SST+ LLVRLFSPECEPQNIAAYDK
Sbjct  50   GPRITVPRSLRWAACGAVSVSSTSTLLVRLFSPECEPQNIAAYDK  94



>ref|XP_004495806.1| PREDICTED: uncharacterized protein LOC101500096 isoform X1 [Cicer 
arietinum]
Length=131

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW ACGAV+ SS+TALLVRLFSPECEPQNIAAYD K
Sbjct  85   GPRITIPRSLRWAACGAVTVSSSTALLVRLFSPECEPQNIAAYDNK  130



>ref|NP_001042596.2| Os01g0250600 [Oryza sativa Japonica Group]
 dbj|BAD81218.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11260.1| hypothetical protein OsJ_01111 [Oryza sativa Japonica Group]
 dbj|BAG95270.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87749.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04510.2| Os01g0250600 [Oryza sativa Japonica Group]
Length=100

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKKG  540
            GPRIT PRS RW +CGA+S SS +ALLVRLFSPECEPQNIAAYDK G
Sbjct  50   GPRITVPRSLRWASCGAISVSSASALLVRLFSPECEPQNIAAYDKLG  96



>gb|EAY73312.1| hypothetical protein OsI_01186 [Oryza sativa Indica Group]
Length=100

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKKG  540
            GPRIT PRS RW +CGA+S SS +ALLVRLFSPECEPQNIAAYDK G
Sbjct  50   GPRITVPRSLRWASCGAISVSSASALLVRLFSPECEPQNIAAYDKLG  96



>ref|XP_002512579.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50031.1| conserved hypothetical protein [Ricinus communis]
Length=96

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW  CGA+STSSTTALLVRLFSPECEPQNIAA+D+
Sbjct  50   GPRITVPRSLRWATCGAISTSSTTALLVRLFSPECEPQNIAAFDR  94



>gb|KDO45244.1| hypothetical protein CISIN_1g034386mg [Citrus sinensis]
Length=96

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPR+T PRS RW  CGAVS SSTTALLVRLFSPECEPQNIAAYD+
Sbjct  50   GPRVTVPRSLRWAGCGAVSVSSTTALLVRLFSPECEPQNIAAYDR  94



>ref|XP_007040723.1| 40S ribosomal protein S23-1 [Theobroma cacao]
 gb|EOY25224.1| 40S ribosomal protein S23-1 [Theobroma cacao]
Length=96

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW ACGAVS SST+ALLVRLFSPECEPQN+AAYD
Sbjct  50   GPRITVPRSLRWAACGAVSVSSTSALLVRLFSPECEPQNVAAYD  93



>ref|XP_010674483.1| PREDICTED: uncharacterized protein LOC104890629 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674484.1| PREDICTED: uncharacterized protein LOC104890629 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674485.1| PREDICTED: uncharacterized protein LOC104890629 [Beta vulgaris 
subsp. vulgaris]
Length=96

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  695  VHGNAGPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            +H + GPR+T PRS RW ACGAVS SSTTALLVRLFSPECEPQNI AY+
Sbjct  47   LHYHYGPRVTIPRSLRWAACGAVSVSSTTALLVRLFSPECEPQNIIAYE  95



>gb|KEH43129.1| hypothetical protein MTR_1g484930 [Medicago truncatula]
Length=96

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRI  PRS RW ACGAV+ SS+TALLVRLFSPECEPQNIAAYD K
Sbjct  50   GPRIQIPRSLRWAACGAVTVSSSTALLVRLFSPECEPQNIAAYDNK  95



>ref|XP_003566365.1| PREDICTED: uncharacterized protein LOC100824486 [Brachypodium 
distachyon]
 ref|XP_010230695.1| PREDICTED: uncharacterized protein LOC100824486 [Brachypodium 
distachyon]
 ref|XP_010230696.1| PREDICTED: uncharacterized protein LOC100824486 [Brachypodium 
distachyon]
Length=100

 Score = 83.6 bits (205),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW +CG +STSST+ALLVRLFSPECEPQNIAAYD+
Sbjct  50   GPRITVPRSLRWASCGVISTSSTSALLVRLFSPECEPQNIAAYDR  94



>ref|XP_008788173.1| PREDICTED: uncharacterized protein LOC103706018 [Phoenix dactylifera]
Length=96

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW +CGA+S SST+ LLVRLFSPECEPQNIAAYDK
Sbjct  50   GPRITIPRSLRWASCGAISVSSTSVLLVRLFSPECEPQNIAAYDK  94



>gb|KHG09109.1| hypothetical protein F383_14708 [Gossypium arboreum]
 gb|KJB25223.1| hypothetical protein B456_004G182000 [Gossypium raimondii]
Length=97

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW ACGAVS SS +ALLVRLFSPECE QNIAAYDK+
Sbjct  50   GPRITVPRSLRWAACGAVSVSSASALLVRLFSPECESQNIAAYDKR  95



>ref|XP_008453135.1| PREDICTED: uncharacterized protein LOC103493937 [Cucumis melo]
 ref|XP_008453144.1| PREDICTED: uncharacterized protein LOC103493937 [Cucumis melo]
 ref|XP_008453150.1| PREDICTED: uncharacterized protein LOC103493937 [Cucumis melo]
Length=97

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW ACGA S S+T+ALLVRLFSPECEPQNIAAYD+
Sbjct  50   GPRITVPRSLRWAACGAASMSATSALLVRLFSPECEPQNIAAYDR  94



>ref|NP_001144560.1| uncharacterized protein LOC100277564 [Zea mays]
 gb|ACG41362.1| hypothetical protein [Zea mays]
Length=100

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW +CGAVS S+T+ALLVRLFSPECEPQNIAA+DK
Sbjct  50   GPRITVPRSLRWASCGAVSMSATSALLVRLFSPECEPQNIAAFDK  94



>gb|AFW71242.1| hypothetical protein ZEAMMB73_291095 [Zea mays]
Length=100

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW +CGAVS S+T+ALLVRLFSPECEPQNIAA+DK
Sbjct  50   GPRITVPRSLRWASCGAVSMSATSALLVRLFSPECEPQNIAAFDK  94



>gb|AFW71243.1| hypothetical protein ZEAMMB73_291095 [Zea mays]
Length=135

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW +CGAVS S+T+ALLVRLFSPECEPQNIAA+DK
Sbjct  85   GPRITVPRSLRWASCGAVSMSATSALLVRLFSPECEPQNIAAFDK  129



>ref|XP_004972980.1| PREDICTED: uncharacterized protein LOC101772337 isoform X1 [Setaria 
italica]
 ref|XP_004972981.1| PREDICTED: uncharacterized protein LOC101772337 isoform X2 [Setaria 
italica]
 ref|XP_004972982.1| PREDICTED: uncharacterized protein LOC101772337 isoform X3 [Setaria 
italica]
 ref|XP_004972983.1| PREDICTED: uncharacterized protein LOC101772337 isoform X4 [Setaria 
italica]
Length=100

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW +CGAVS S+TTALLVRLFSPECEPQNIAA+D
Sbjct  50   GPRITVPRSLRWASCGAVSVSATTALLVRLFSPECEPQNIAAFD  93



>ref|XP_004968065.1| PREDICTED: uncharacterized protein LOC101758392 isoform X2 [Setaria 
italica]
 ref|XP_004968066.1| PREDICTED: uncharacterized protein LOC101758392 isoform X3 [Setaria 
italica]
Length=100

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW +CGAVS S+TTALLVRLFSPECEPQNIAA+D
Sbjct  50   GPRITVPRSLRWASCGAVSVSATTALLVRLFSPECEPQNIAAFD  93



>ref|XP_002894674.1| hypothetical protein ARALYDRAFT_474839 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70933.1| hypothetical protein ARALYDRAFT_474839 [Arabidopsis lyrata subsp. 
lyrata]
Length=103

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW  CGAVS S++TA+LVRLFSPECEPQNIAAYD
Sbjct  50   GPRITVPRSLRWAGCGAVSVSTSTAMLVRLFSPECEPQNIAAYD  93



>ref|XP_006840362.1| hypothetical protein AMTR_s00045p00119230 [Amborella trichopoda]
 gb|ERN02037.1| hypothetical protein AMTR_s00045p00119230 [Amborella trichopoda]
Length=95

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW   GA+  SSTTALLVRLFSPECEPQNIAAY+KK
Sbjct  50   GPRITVPRSLRWAGSGAIGVSSTTALLVRLFSPECEPQNIAAYEKK  95



>ref|XP_010511320.1| PREDICTED: uncharacterized protein LOC104787436 [Camelina sativa]
 ref|XP_010511321.1| PREDICTED: uncharacterized protein LOC104787436 [Camelina sativa]
 ref|XP_010415024.1| PREDICTED: uncharacterized protein LOC104701091 [Camelina sativa]
 ref|XP_010415025.1| PREDICTED: uncharacterized protein LOC104701091 [Camelina sativa]
 ref|XP_010480285.1| PREDICTED: uncharacterized protein LOC104759010 [Camelina sativa]
 ref|XP_010480286.1| PREDICTED: uncharacterized protein LOC104759010 [Camelina sativa]
 ref|XP_010480287.1| PREDICTED: uncharacterized protein LOC104759010 [Camelina sativa]
Length=103

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW  CGAVS S++TA+LVRLFSPECEPQNIAAYD
Sbjct  50   GPRITVPRSLRWAGCGAVSVSTSTAMLVRLFSPECEPQNIAAYD  93



>ref|XP_006303041.1| hypothetical protein CARUB_v10021196mg [Capsella rubella]
 gb|EOA35939.1| hypothetical protein CARUB_v10021196mg [Capsella rubella]
Length=103

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW  CGA+S SS+TA+LVRLFSPECEPQNIAAYD
Sbjct  50   GPRITVPRSLRWAGCGALSVSSSTAMLVRLFSPECEPQNIAAYD  93



>ref|XP_004302332.1| PREDICTED: uncharacterized protein LOC101291443 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466215.1| PREDICTED: uncharacterized protein LOC101291443 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466216.1| PREDICTED: uncharacterized protein LOC101291443 [Fragaria vesca 
subsp. vesca]
Length=96

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PR+ RWGACGA+S SS+TALLVRL SPECEPQNI  YDK
Sbjct  50   GPRITVPRALRWGACGALSVSSSTALLVRLLSPECEPQNIETYDK  94



>ref|XP_006428326.1| hypothetical protein CICLE_v10013195mg [Citrus clementina]
 ref|XP_006428327.1| hypothetical protein CICLE_v10013195mg [Citrus clementina]
 ref|XP_006480356.1| PREDICTED: uncharacterized protein LOC102625920 isoform X1 [Citrus 
sinensis]
 ref|XP_006480357.1| PREDICTED: uncharacterized protein LOC102625920 isoform X2 [Citrus 
sinensis]
 gb|ESR41566.1| hypothetical protein CICLE_v10013195mg [Citrus clementina]
 gb|ESR41567.1| hypothetical protein CICLE_v10013195mg [Citrus clementina]
Length=96

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPR+T PRS RW  CGAVS SSTTALLV LFSPECEPQNIAAYD+
Sbjct  50   GPRVTVPRSLRWAGCGAVSVSSTTALLVCLFSPECEPQNIAAYDR  94



>gb|AFK43948.1| unknown [Medicago truncatula]
Length=96

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRI  PRS RW ACGAV+ SS+TAL VRLFSPECEPQNIAAYD K
Sbjct  50   GPRIQIPRSLRWAACGAVTVSSSTALPVRLFSPECEPQNIAAYDNK  95



>ref|NP_564723.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974042.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001077732.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG50734.1|AC079733_2 hypothetical protein [Arabidopsis thaliana]
 dbj|BAC41794.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42937.1| At1g57540 [Arabidopsis thaliana]
 gb|AEE33431.1| uncharacterized protein AT1G57540 [Arabidopsis thaliana]
 gb|AEE33432.1| uncharacterized protein AT1G57540 [Arabidopsis thaliana]
 gb|AEE33433.1| uncharacterized protein AT1G57540 [Arabidopsis thaliana]
Length=103

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW  CGA+S S++TA+LVRLFSPECEPQNIAAYD
Sbjct  50   GPRITVPRSLRWAGCGALSVSTSTAMLVRLFSPECEPQNIAAYD  93



>ref|XP_004144737.1| PREDICTED: uncharacterized protein LOC101221073 [Cucumis sativus]
 gb|KGN61028.1| hypothetical protein Csa_2G034810 [Cucumis sativus]
Length=97

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT  RS RW ACGA S S+T+ALLVRLFSPECEPQNIAAYD +
Sbjct  50   GPRITVRRSLRWAACGAASMSATSALLVRLFSPECEPQNIAAYDNR  95



>dbj|BAJ91957.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=111

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW +CGA+ TS+T A+LVRLFSPECEPQNIAA+D+
Sbjct  61   GPRITVPRSLRWASCGAIGTSATAAMLVRLFSPECEPQNIAAFDR  105



>gb|ADE77284.1| unknown [Picea sitchensis]
Length=98

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PR+ RWG CGAV+ SS+TALLVRLFS ECEPQN+AAYDK
Sbjct  50   GPRITFPRAVRWGLCGAVTGSSSTALLVRLFSTECEPQNVAAYDK  94



>ref|XP_010549224.1| PREDICTED: uncharacterized protein LOC104820476 [Tarenaya hassleriana]
 ref|XP_010549229.1| PREDICTED: uncharacterized protein LOC104820476 [Tarenaya hassleriana]
 ref|XP_010549232.1| PREDICTED: uncharacterized protein LOC104820476 [Tarenaya hassleriana]
Length=103

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRIT PRS RW  CGAV+ S++TALLVRLFSPECEPQN+AA+D
Sbjct  50   GPRITVPRSLRWAGCGAVTVSTSTALLVRLFSPECEPQNVAAFD  93



>ref|XP_007199335.1| hypothetical protein PRUPE_ppa023934mg [Prunus persica]
 gb|EMJ00534.1| hypothetical protein PRUPE_ppa023934mg [Prunus persica]
Length=96

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GP I  PRS  W ACGAVS SSTTALLVRLFSPECEPQNIA YDK
Sbjct  50   GPNIIVPRSLCWAACGAVSMSSTTALLVRLFSPECEPQNIAIYDK  94



>ref|XP_006404044.1| hypothetical protein EUTSA_v10010969mg [Eutrema salsugineum]
 gb|ESQ45497.1| hypothetical protein EUTSA_v10010969mg [Eutrema salsugineum]
Length=103

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPRIT PRS RW  CGAVS S++TA LVRL SPECEPQNIAAYD+
Sbjct  50   GPRITVPRSLRWAGCGAVSMSASTATLVRLLSPECEPQNIAAYDQ  94



>emb|CDY65927.1| BnaC09g51670D [Brassica napus]
Length=103

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPR+T PRS RW  CGAVS S++TA LVRL SPECEPQNIAAYD+
Sbjct  50   GPRVTVPRSLRWAGCGAVSMSASTATLVRLLSPECEPQNIAAYDQ  94



>ref|XP_009113363.1| PREDICTED: uncharacterized protein LOC103838667 [Brassica rapa]
Length=103

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPR+T PRS RW  CGAVS S++TA LVRL SPECEPQNIAAYD+
Sbjct  50   GPRVTVPRSLRWAGCGAVSMSASTATLVRLLSPECEPQNIAAYDQ  94



>emb|CDY67020.1| BnaCnng53180D [Brassica napus]
Length=103

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GPR+T PRS RW  CGAVS S++TA LVRL SPECEPQNIAAYD+
Sbjct  50   GPRVTVPRSLRWAGCGAVSMSASTATLVRLLSPECEPQNIAAYDQ  94



>ref|XP_011023865.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105125213 
[Populus euphratica]
Length=98

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDK  546
            GP ITNPRS RW AC A   SST+ALLVRLFSPECEPQNIAA+DK
Sbjct  50   GPTITNPRSLRWAACRAFCWSSTSALLVRLFSPECEPQNIAAHDK  94



>ref|XP_002455372.1| hypothetical protein SORBIDRAFT_03g009500 [Sorghum bicolor]
 gb|EES00492.1| hypothetical protein SORBIDRAFT_03g009500 [Sorghum bicolor]
Length=101

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQN-IAAYDK  546
            GP+IT PRS RW +CGA+S S T+ALLVR FSPECEPQN IAAYDK
Sbjct  50   GPKITVPRSLRWASCGAISMSLTSALLVRSFSPECEPQNIIAAYDK  95



>ref|XP_002455154.1| hypothetical protein SORBIDRAFT_03g005200 [Sorghum bicolor]
 gb|EES00274.1| hypothetical protein SORBIDRAFT_03g005200 [Sorghum bicolor]
Length=101

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQN-IAAYDK  546
            GP+IT PRS RW +CGA+S S T+ALLVR FSPECEPQN IAAYDK
Sbjct  50   GPKITVPRSLRWASCGAISMSLTSALLVRSFSPECEPQNIIAAYDK  95



>gb|EPS70280.1| hypothetical protein M569_04483, partial [Genlisea aurea]
Length=93

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYD  549
            GPRI   RS RW  CGAV TS+TTALLV+LF+ +CEPQNIAAYD
Sbjct  50   GPRINVGRSLRWAGCGAVFTSTTTALLVQLFAAQCEPQNIAAYD  93



>emb|CAN65746.1| hypothetical protein VITISV_037764 [Vitis vinifera]
Length=96

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW ACGAVS SS++ALLVRLFSP CEPQNIAAYD K
Sbjct  50   GPRITVPRSLRWAACGAVSVSSSSALLVRLFSPACEPQNIAAYDNK  95



>ref|XP_002279694.1| PREDICTED: uncharacterized protein LOC100249447 [Vitis vinifera]
 ref|XP_010659760.1| PREDICTED: uncharacterized protein LOC100249447 [Vitis vinifera]
 emb|CBI39669.3| unnamed protein product [Vitis vinifera]
Length=96

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  680  GPRITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAAYDKK  543
            GPRIT PRS RW ACGAVS SS++ALLVRLFSP CEPQNIAAYD K
Sbjct  50   GPRITVPRSLRWAACGAVSVSSSSALLVRLFSPACEPQNIAAYDNK  95



>ref|XP_006375711.1| hypothetical protein POPTR_0013s00390g [Populus trichocarpa]
 gb|ERP53508.1| hypothetical protein POPTR_0013s00390g [Populus trichocarpa]
Length=71

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -3

Query  671  ITNPRSFRWGACGAVSTSSTTALLVRLFSPECEPQNIAA  555
            I +  S RW ACGAV  SST+ALLVRLFSPECEPQNIAA
Sbjct  32   IFSVESSRWAACGAVCWSSTSALLVRLFSPECEPQNIAA  70



>gb|EMT16685.1| hypothetical protein F775_00317 [Aegilops tauschii]
Length=85

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +1

Query  538  YPFLS*AAIF*GSHSGLNRRTSNAVVELVETAPQAPHLKLRGFVILGP  681
            Y  LS AA+F GSHSGL  RTS A V LV  APQ  HL+L G VILGP
Sbjct  37   YSGLSKAAMFCGSHSGLKSRTSMAAVALVPIAPQDAHLRLLGTVILGP  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680