BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028B22

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    300   2e-92   Solanum tuberosum [potatoes]
ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    300   2e-92   Solanum tuberosum [potatoes]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    295   1e-90   Solanum lycopersicum
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    295   1e-90   Solanum lycopersicum
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    294   2e-90   Nicotiana tomentosiformis
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    294   3e-90   Nicotiana tomentosiformis
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    294   4e-90   
ref|XP_002510674.1|  protein binding protein, putative                  288   5e-88   Ricinus communis
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  288   8e-88   
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    285   4e-87   Fragaria vesca subsp. vesca
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    285   9e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    285   9e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    285   1e-86   
dbj|BAD95193.1|  hypothetical protein                                   271   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    284   1e-86   Camelina sativa [gold-of-pleasure]
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               284   2e-86   Arabis alpina [alpine rockcress]
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    284   2e-86   Cucumis melo [Oriental melon]
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    283   4e-86   Eucalyptus grandis [rose gum]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    282   7e-86   Camelina sativa [gold-of-pleasure]
emb|CDP07293.1|  unnamed protein product                                282   9e-86   Coffea canephora [robusta coffee]
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    282   9e-86   Prunus mume [ume]
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             282   1e-85   Prunus persica
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    281   1e-85   Sesamum indicum [beniseed]
gb|KJB57964.1|  hypothetical protein B456_009G187700                    281   1e-85   Gossypium raimondii
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    282   2e-85   Eucalyptus grandis [rose gum]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    281   2e-85   Tarenaya hassleriana [spider flower]
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                280   5e-85   Erythranthe guttata [common monkey flower]
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    279   1e-84   Malus domestica [apple tree]
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    279   1e-84   
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    279   1e-84   Cucumis sativus [cucumbers]
gb|KHG01113.1|  hypothetical protein F383_22949                         278   2e-84   Gossypium arboreum [tree cotton]
emb|CBI40712.3|  unnamed protein product                                278   3e-84   Vitis vinifera
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    278   4e-84   Vitis vinifera
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             276   2e-83   Capsella rubella
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             276   2e-83   Eutrema salsugineum [saltwater cress]
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    275   4e-83   Populus euphratica
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           275   4e-83   Populus trichocarpa [western balsam poplar]
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    275   5e-83   Oryza brachyantha
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    275   5e-83   Populus euphratica
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           275   6e-83   
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        274   7e-83   
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        274   8e-83   
emb|CDX97805.1|  BnaC04g41340D                                          273   1e-82   
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    273   1e-82   
emb|CDY29657.1|  BnaA04g17700D                                          274   1e-82   Brassica napus [oilseed rape]
ref|NP_180618.2|  BTB/POZ domain-containing protein                     272   4e-82   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93995.1|  hypothetical protein                                   272   6e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  272   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|AES98295.2|  BTB/POZ domain plant protein                            269   5e-81   Medicago truncatula
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  270   5e-81   Morus notabilis
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    269   7e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    269   9e-81   Populus euphratica
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    268   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    268   1e-80   
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    268   1e-80   
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    268   1e-80   Populus euphratica
ref|XP_003615337.1|  Kelch-like protein                                 269   2e-80   
gb|EEE63337.1|  hypothetical protein OsJ_18148                          266   4e-80   Oryza sativa Japonica Group [Japonica rice]
gb|AAV43802.1|  unknown protein                                         266   1e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    265   2e-79   Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    265   2e-79   
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    265   3e-79   Brachypodium distachyon [annual false brome]
gb|EEC79014.1|  hypothetical protein OsI_19541                          264   4e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    263   2e-78   Citrus sinensis [apfelsine]
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    263   2e-78   Citrus sinensis [apfelsine]
emb|CDM85346.1|  unnamed protein product                                262   2e-78   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             262   3e-78   
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             261   8e-78   Phaseolus vulgaris [French bean]
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    261   8e-78   Nelumbo nucifera [Indian lotus]
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    260   1e-77   Brassica rapa
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    260   1e-77   Brassica rapa
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    256   5e-76   Cicer arietinum [garbanzo]
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    256   6e-76   Cicer arietinum [garbanzo]
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    255   8e-76   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    255   1e-75   Nicotiana sylvestris
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    255   2e-75   
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          251   2e-74   Sorghum bicolor [broomcorn]
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750          251   3e-74   
ref|NP_001174372.1|  Os05g0345500                                       229   2e-72   
gb|EPS65824.1|  hypothetical protein M569_08953                         237   3e-69   Genlisea aurea
ref|XP_001751401.1|  predicted protein                                  229   3e-66   
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             226   5e-65   
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              224   1e-64   
gb|AAB63076.1|  unknown protein                                         192   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KIY99757.1|  hypothetical protein MNEG_8204                          197   1e-54   Monoraphidium neglectum
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586              187   2e-51   Chlorella variabilis
ref|XP_005650913.1|  hypothetical protein COCSUDRAFT_46062              164   4e-44   Coccomyxa subellipsoidea C-169
ref|XP_011399599.1|  BTB/POZ domain-containing protein                  143   3e-36   Auxenochlorella protothecoides
ref|XP_001697437.1|  predicted protein                                  118   7e-30   Chlamydomonas reinhardtii
ref|XP_002950189.1|  hypothetical protein VOLCADRAFT_48365              117   3e-29   Volvox carteri f. nagariensis
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...    111   3e-24   
ref|XP_004339299.1|  BTB/POZ domain containing protein                  109   1e-23   Acanthamoeba castellanii str. Neff
gb|KDD72973.1|  hypothetical protein H632_c2675p1                     87.0    4e-18   Helicosporidium sp. ATCC 50920
ref|XP_005708947.1|  ubiquitin-protein ligase                         87.8    4e-16   Galdieria sulphuraria
ref|XP_004333299.1|  BTB/POZ domain containing protein                84.3    5e-15   Acanthamoeba castellanii str. Neff
ref|XP_011189869.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    1e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189870.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    1e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    1e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189868.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    1e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004521546.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.8    2e-14   Ceratitis capitata [medfly]
ref|XP_004521545.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.8    2e-14   Ceratitis capitata [medfly]
ref|XP_004521542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.8    2e-14   Ceratitis capitata [medfly]
ref|XP_004521547.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.8    3e-14   
ref|XP_011199876.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.4    3e-14   
ref|XP_011199881.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.4    3e-14   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199880.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.4    3e-14   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199879.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  82.4    3e-14   Bactrocera dorsalis [papaya fruit fly]
ref|XP_005708289.1|  ubiquitin-protein ligase isoform 2               80.5    1e-13   Galdieria sulphuraria
ref|XP_005708288.1|  ubiquitin-protein ligase isoform 1               80.1    1e-13   Galdieria sulphuraria
ref|XP_011414031.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.5    1e-13   Crassostrea gigas
ref|XP_011414030.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.5    1e-13   Crassostrea gigas
gb|EKC30956.1|  E3 ubiquitin-protein ligase HECTD1                    80.5    1e-13   Crassostrea gigas
ref|XP_639138.1|  BTB/POZ domain-containing protein                   79.3    2e-13   Dictyostelium discoideum AX4
gb|AAB47544.1|  MigA                                                  79.3    2e-13   Dictyostelium discoideum
ref|XP_011290265.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.0    4e-13   Musca domestica
ref|XP_005178040.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.0    4e-13   
ref|XP_011290263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.6    5e-13   Musca domestica
ref|XP_011290264.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.6    5e-13   Musca domestica
ref|XP_005178039.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.6    5e-13   Musca domestica
ref|XP_011406508.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  76.6    2e-12   
ref|XP_005842130.1|  hypothetical protein GUITHDRAFT_41514            71.2    2e-12   Guillardia theta CCMP2712
ref|XP_002424807.1|  hect E3 ubiquitin ligase, putative               76.3    3e-12   Pediculus humanus corporis [human body lice]
ref|XP_003288046.1|  hypothetical protein DICPUDRAFT_16127            75.1    4e-12   Dictyostelium purpureum
ref|XP_004909451.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.7    8e-12   
ref|XP_004864091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.7    8e-12   Heterocephalus glaber [naked mole rat]
ref|XP_007063755.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  74.3    1e-11   
ref|XP_007429074.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   
ref|XP_004864090.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   Heterocephalus glaber [naked mole rat]
ref|XP_004909448.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   
ref|XP_004864088.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   Heterocephalus glaber [naked mole rat]
ref|XP_007429075.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   
ref|XP_004909450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   
ref|XP_010631867.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   Fukomys damarensis [Damara mole rat]
ref|XP_010631866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   Fukomys damarensis [Damara mole rat]
gb|EMP32200.1|  E3 ubiquitin-protein ligase HECTD1                    73.9    1e-11   Chelonia mydas [green seaturtle]
ref|XP_007429073.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   
ref|XP_005196337.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   
ref|XP_010333269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    2e-11   Saimiri boliviensis boliviensis
ref|XP_010333268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    2e-11   Saimiri boliviensis boliviensis
ref|XP_008162333.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    2e-11   Chrysemys picta bellii
ref|XP_009909049.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.9    2e-11   Picoides pubescens
ref|XP_005196336.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_006116431.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    2e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006116433.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    2e-11   
ref|XP_008267702.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_011222356.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Ailuropoda melanoleuca
ref|XP_010845303.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Bison bison bison
ref|XP_010372961.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Rhinopithecus roxellana
ref|XP_009004155.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Callithrix jacchus [common marmoset]
ref|XP_007984591.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Chlorocebus sabaeus
ref|XP_006056670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_007098141.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Panthera tigris altaica
ref|XP_005377022.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005222132.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Bos taurus [bovine]
ref|XP_005695269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_011374706.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Pteropus vampyrus
ref|XP_011222354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Ailuropoda melanoleuca
ref|XP_010845301.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Bison bison bison
ref|XP_010372959.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Rhinopithecus roxellana
ref|XP_009004153.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Callithrix jacchus [common marmoset]
ref|XP_006056667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005695268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005377019.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_004467983.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Dasypus novemcinctus
ref|XP_005881051.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Myotis brandtii
ref|XP_006056669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005695270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_010961314.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Camelus bactrianus [camel]
ref|XP_006085913.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005881050.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_010586873.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Loxodonta africana [African bush elephant]
ref|XP_006085912.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005881054.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Myotis brandtii
ref|XP_004755201.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Mustela putorius furo [black ferret]
ref|XP_004801249.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.6    2e-11   
ref|XP_010961316.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Camelus bactrianus [camel]
ref|XP_004755203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Mustela putorius furo [black ferret]
ref|XP_004055105.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.6    2e-11   
ref|XP_001969437.1|  GG23957                                          73.6    2e-11   
ref|XP_006056668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005377020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_008972942.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Pan paniscus [bonobo]
ref|XP_007098140.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Panthera tigris altaica
ref|XP_005267560.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005222130.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Bos taurus [bovine]
ref|XP_005285367.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005285366.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Chrysemys picta bellii
gb|ELK17058.1|  E3 ubiquitin-protein ligase HECTD1                    73.6    2e-11   Pteropus alecto
ref|XP_008267700.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008565372.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_635359.1|  hypothetical protein DDB_G0291147                   73.2    2e-11   Dictyostelium discoideum AX4
ref|XP_010631865.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_010631864.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_007113428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_007472588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Monodelphis domestica
ref|XP_003924275.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Saimiri boliviensis boliviensis
ref|XP_007660828.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_007660814.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007472586.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Monodelphis domestica
ref|XP_010333267.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Saimiri boliviensis boliviensis
ref|XP_002089068.1|  GE26196                                          73.6    2e-11   Drosophila yakuba
ref|XP_004755202.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Mustela putorius furo [black ferret]
ref|XP_006766087.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.6    2e-11   
ref|XP_008565371.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005196334.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_004467984.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Dasypus novemcinctus
ref|XP_004755200.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Mustela putorius furo [black ferret]
ref|XP_004755199.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Mustela putorius furo [black ferret]
ref|XP_005881052.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Myotis brandtii
ref|XP_004376588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.6    2e-11   
gb|ELW63202.1|  E3 ubiquitin-protein ligase HECTD1                    73.6    2e-11   Tupaia chinensis
ref|XP_010586874.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Loxodonta africana [African bush elephant]
ref|XP_010961313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Camelus bactrianus [camel]
ref|XP_007516893.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.6    2e-11   Erinaceus europaeus [common hedgehog]
ref|XP_004755198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Mustela putorius furo [black ferret]
ref|XP_850301.2|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-pr...  73.6    2e-11   Canis lupus familiaris [dogs]
ref|XP_005196335.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_006116430.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006116432.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_010214811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Tinamus guttatus
ref|XP_008101614.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Anolis carolinensis [Carolina anole]
ref|XP_006116428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_011281667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   
ref|XP_003792055.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   
ref|XP_011222355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Ailuropoda melanoleuca
ref|XP_010845302.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Bison bison bison
ref|XP_010372960.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Rhinopithecus roxellana
ref|XP_009004154.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Callithrix jacchus [common marmoset]
ref|XP_007984590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Chlorocebus sabaeus
ref|XP_005377021.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_004637178.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   
ref|XP_010984469.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.2    2e-11   Camelus dromedarius [camel]
ref|XP_011374703.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Pteropus vampyrus
ref|XP_006890036.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006085911.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_004584798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   Ochotona princeps [southern American pika]
ref|XP_003408766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Loxodonta africana [African bush elephant]
sp|Q9ULT8.3|HECD1_HUMAN  RecName: Full=E3 ubiquitin-protein ligas...  73.2    2e-11   Homo sapiens [man]
ref|XP_009288642.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Aptenodytes forsteri
ref|XP_008101615.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Anolis carolinensis [Carolina anole]
ref|XP_008101612.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Anolis carolinensis [Carolina anole]
ref|XP_009288638.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Aptenodytes forsteri
ref|XP_008972943.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Pan paniscus [bonobo]
ref|XP_011374705.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Pteropus vampyrus
ref|XP_009004152.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Callithrix jacchus [common marmoset]
ref|XP_004467982.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Dasypus novemcinctus
ref|XP_010372956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Rhinopithecus roxellana
ref|XP_002918561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Ailuropoda melanoleuca
ref|XP_006056666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Bubalus bubalis [domestic water buffalo]
ref|XP_006906925.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.2    3e-11   
ref|XP_006191324.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_005890166.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   Bos mutus
ref|XP_005377018.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Chinchilla lanigera
ref|XP_004421198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004017927.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_001924707.4|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.2    3e-11   
ref|XP_002753836.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Callithrix jacchus [common marmoset]
gb|AAP13073.1|  E3 ligase for inhibin receptor                        73.2    3e-11   Homo sapiens [man]
ref|XP_010572563.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Haliaeetus leucocephalus
ref|XP_008267701.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005222131.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Bos taurus [bovine]
ref|XP_004941800.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010586872.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_011222353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Ailuropoda melanoleuca
ref|XP_010845300.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Bison bison bison
ref|XP_010372958.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Rhinopithecus roxellana
ref|XP_008972941.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Pan paniscus [bonobo]
ref|XP_008267699.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007984588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Chlorocebus sabaeus
ref|XP_007098139.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Panthera tigris altaica
ref|XP_005222129.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Bos taurus [bovine]
gb|ELR60436.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    3e-11   Bos mutus
ref|XP_006152455.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_008708622.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.2    3e-11   Ursus maritimus [white bear]
ref|XP_008071204.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   Carlito syrichta
ref|XP_002718172.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_002696742.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Bos taurus [bovine]
ref|XP_007098138.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Panthera tigris altaica
ref|XP_006835428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   Chrysochloris asiatica
ref|XP_004467981.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_003821255.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_003260766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|NP_001248188.1|  E3 ubiquitin-protein ligase HECTD1               73.2    3e-11   
gb|EPQ16917.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    3e-11   
ref|XP_010709956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010572566.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010390313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_005020674.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010709953.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010390298.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009317630.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_005020671.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010709952.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010572562.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010390290.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007936773.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_005020668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009317632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009288640.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007180745.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.2    3e-11   
ref|XP_009317628.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_004612165.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009288639.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007660818.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007113426.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_006263085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007472587.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_003464797.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.2    3e-11   
ref|XP_007472585.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007451326.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_004282185.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_006022320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
gb|ETO36723.1|  hypothetical protein RFI_00341                        72.8    3e-11   
gb|KFV93612.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    3e-11   
ref|XP_009288633.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
gb|EMC83831.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    3e-11   
ref|XP_009209622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_001364091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007660823.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007660811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_001512305.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009209621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009288641.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_007113427.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_008101613.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_004400006.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_006729616.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_008565370.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
gb|KFP02468.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    3e-11   
ref|XP_003756170.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009317629.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009288631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010214809.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_008101608.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_008101609.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
gb|KGL94873.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    3e-11   
ref|XP_005561082.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_004324112.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_008101607.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_006263086.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_006022319.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_008101611.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_006022318.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_005561083.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
gb|KFP99363.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    3e-11   
ref|XP_010151091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009877228.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009668205.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009462362.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009288636.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_002200542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009288634.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009317623.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009288632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010709951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010307144.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009942450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_009317626.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_009100181.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_006263084.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_005520368.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_005149352.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    3e-11   
ref|XP_005020673.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010709950.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
gb|KFV19064.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   
ref|XP_009317622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_005020666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_005020665.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   
ref|XP_010709954.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
gb|EOB00564.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   
ref|XP_009317631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005020669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009574994.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009288635.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010709955.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005020670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010572561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009951548.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009644998.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_008923247.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_008637792.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_005479915.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_421227.3|  PREDICTED: E3 ubiquitin-protein ligase HECTD1 i...  72.8    3e-11   
ref|XP_010390277.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317624.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010390306.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010286320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_010169085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009806354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_010572559.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010125887.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009992149.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009698490.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009561891.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_005417553.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
gb|KFP65021.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   
ref|XP_010572558.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010709949.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010390270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317625.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_004941799.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010709948.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010390263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005020667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_004941798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005020664.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005020672.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
gb|KFO93631.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   
ref|XP_010140687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_005322716.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009209620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010572564.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_004941801.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010015718.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
gb|KFP49559.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   
ref|XP_010572556.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010572565.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009986276.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009507570.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_005502361.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    4e-11   
ref|XP_010572557.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_004941797.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
gb|EHH27804.1|  hypothetical protein EGK_18090                        72.8    4e-11   
dbj|GAM18790.1|  hypothetical protein SAMD00019534_019650             71.6    4e-11   
dbj|BAA86445.2|  KIAA1131 protein                                     72.8    4e-11   
ref|XP_009885241.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    4e-11   
ref|XP_008494127.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    4e-11   
ref|XP_005951436.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_009075355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    4e-11   
ref|XP_008942534.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    4e-11   
ref|XP_004698576.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    4e-11   
ref|XP_008312937.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_005456015.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_005047457.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    4e-11   
ref|XP_008521118.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_008521116.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_005603479.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_005603478.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_005603477.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_005603476.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    4e-11   
ref|XP_001749884.1|  hypothetical protein                             72.4    4e-11   
gb|KFV06434.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
ref|XP_002078905.1|  GD22285                                          72.4    4e-11   
ref|XP_008159020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|NP_001131085.1|  HECT domain containing E3 ubiquitin protein ...  72.4    4e-11   
ref|XP_002036468.1|  GM11846                                          72.4    4e-11   
gb|KFB39857.1|  AGAP009511-PA-like protein                            72.4    5e-11   
ref|XP_010071203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    5e-11   
ref|XP_005456013.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    5e-11   
ref|XP_008312929.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    5e-11   
ref|XP_008312922.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    5e-11   
ref|XP_005456014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    5e-11   
ref|XP_005240951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    5e-11   
emb|CDK13341.1|  HECD-1, isoform c                                    72.4    5e-11   
emb|CDK13342.1|  HECD-1, isoform d                                    72.4    5e-11   
emb|CDK13343.1|  HECD-1, isoform e                                    72.4    5e-11   
emb|CDK13339.1|  HECD-1, isoform a                                    72.4    5e-11   
emb|CDK13344.1|  HECD-1, isoform f                                    72.4    5e-11   
emb|CDK13346.1|  HECD-1, isoform h                                    72.4    5e-11   
emb|CDK13340.1|  HECD-1, isoform b                                    72.4    5e-11   
emb|CDK13345.1|  HECD-1, isoform g                                    72.4    5e-11   
ref|XP_009968713.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    5e-11   
ref|XP_008521117.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    5e-11   
ref|XP_003451257.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    5e-11   
ref|XP_001489913.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    5e-11   
ref|NP_501120.1|  Protein HECD-1                                      72.4    5e-11   
ref|XP_008521114.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    6e-11   
ref|XP_008521115.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    6e-11   
ref|XP_005728612.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.0    6e-11   
ref|XP_004554704.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.0    6e-11   
ref|XP_010198466.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.0    6e-11   
ref|XP_002004091.1|  GI19489                                          72.0    6e-11   
ref|XP_008837027.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    7e-11   
ref|XP_008837026.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    7e-11   
gb|ETO19266.1|  E3 ubiquitin-protein ligase HECTD1                    71.2    7e-11   
gb|ETO35939.1|  hypothetical protein RFI_01125                        71.2    8e-11   
ref|XP_001844071.1|  E3 ubiquitin-protein ligase HECTD1               71.6    8e-11   
ref|XP_004341500.1|  BTB/POZ domain containing protein                70.1    9e-11   
ref|XP_008837024.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    9e-11   
ref|XP_008837025.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    9e-11   
ref|XP_007257970.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    9e-11   
gb|KDR14371.1|  E3 ubiquitin-protein ligase HECTD1                    71.6    9e-11   
ref|XP_008275346.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    9e-11   
ref|XP_008275345.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    9e-11   
gb|ETN62256.1|  hect E3 ubiquitin ligase                              71.6    9e-11   
ref|XP_006975329.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    1e-10   
ref|XP_011242353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    1e-10   
ref|XP_007637045.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    1e-10   
ref|XP_001963078.1|  GF14121                                          71.2    1e-10   
ref|XP_006240150.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   
ref|XP_010177459.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    71.2    1e-10   
ref|XP_004682014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    71.2    1e-10   
ref|XP_004989701.1|  hypothetical protein PTSG_12883                  71.2    1e-10   
gb|ERL91993.1|  hypothetical protein D910_09315                       71.2    1e-10   
gb|ENN80588.1|  hypothetical protein YQE_02993                        71.2    1e-10   
ref|XP_007257971.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   
ref|XP_007891590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   
ref|XP_006975330.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWW
Sbjct  641  AGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNASWW  700

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH++DQTICKPGQFAS
Sbjct  701  MVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHENDQTICKPGQFAS  760

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  761  WPITGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWW
Sbjct  661  AGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNASWW  720

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH++DQTICKPGQFAS
Sbjct  721  MVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHENDQTICKPGQFAS  780

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  781  WPITGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWW
Sbjct  641  AGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNTSWW  700

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNLRVH++DQTICKPGQFAS
Sbjct  701  MVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHENDQTICKPGQFAS  760

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  761  WPVTGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWW
Sbjct  661  AGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNTSWW  720

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNLRVH++DQTICKPGQFAS
Sbjct  721  MVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHENDQTICKPGQFAS  780

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  781  WPVTGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV++TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWW
Sbjct  641  AGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWW  700

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFAS
Sbjct  701  MVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFAS  760

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  761  WPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   294 bits (753),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV++TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWW
Sbjct  663  AGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWW  722

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFAS
Sbjct  723  MVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFAS  782

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  783  WPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  826



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   294 bits (752),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV++TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWW
Sbjct  661  AGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWW  720

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFAS
Sbjct  721  MVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFAS  780

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  781  WPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   288 bits (737),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+KR+ +TASSP  R TDPK LVSR +QGTSFAGP++EDGN  +WW
Sbjct  643  AGTSYGEHQWVNPVLAKRITITASSPTLRHTDPKALVSRTYQGTSFAGPRMEDGNKCAWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG +WTNLRVHKDDQT+CKPGQFAS
Sbjct  703  MVDIGKDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKSWTNLRVHKDDQTVCKPGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGPN LLPFRFFR+++TGP TD  +PWN CIC LELYGYFR
Sbjct  763  WPITGPNSLLPFRFFRVILTGPTTDVSDPWNLCICFLELYGYFR  806



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   288 bits (736),  Expect = 8e-88, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWWM
Sbjct  647  GTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGHISSWWM  706

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASW
Sbjct  707  VDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASW  766

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            PIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGY+R
Sbjct  767  PITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYYR  809



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   285 bits (730),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQW NPVL+KR+ +TASSP SRFTDPKVLVSR +QGTSFAGP +EDG  ++WW
Sbjct  640  AGTSYGEHQWFNPVLAKRITITASSPPSRFTDPKVLVSRTYQGTSFAGPHIEDGRNNTWW  699

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQL+CNYYT+R DGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFAS
Sbjct  700  MVDIGADHQLICNYYTLRHDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFAS  759

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGPN LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  760  WPVTGPNALLPFRFFRVVLTGPTMDASNPWNFCICFLELYGYFH  803



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   285 bits (728),  Expect = 9e-87, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM
Sbjct  647  GTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWM  706

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASW
Sbjct  707  VDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASW  766

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            PIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  767  PITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  809



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   285 bits (729),  Expect = 9e-87, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM
Sbjct  661  GTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWM  720

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASW
Sbjct  721  VDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASW  780

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            PIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  781  PITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  823



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   285 bits (728),  Expect = 1e-86, Method: Composition-based stats.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM
Sbjct  662  GTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWM  721

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASW
Sbjct  722  VDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGRTWTDLRVHEDDQTMCKAGQFASW  781

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            PIT  N LLPFRFFR+++TGP TD   PWN CIC LELYGY+R
Sbjct  782  PITAANALLPFRFFRLLLTGPTTDTSTPWNFCICYLELYGYYR  824



>dbj|BAD95193.1| hypothetical protein [Arabidopsis thaliana]
Length=331

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW
Sbjct  168  VGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWW  227

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            ++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFAS
Sbjct  228  VVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFAS  287

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  288  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  331



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   284 bits (727),  Expect = 1e-86, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM
Sbjct  656  GTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWM  715

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASW
Sbjct  716  VDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASW  775

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            PIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  776  PITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  818



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   284 bits (727),  Expect = 2e-86, Method: Composition-based stats.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWWM
Sbjct  645  GTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGHISSWWM  704

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH++DQT+CK GQFASW
Sbjct  705  VDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHENDQTMCKAGQFASW  764

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            PIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGY R
Sbjct  765  PITAANALLPFRFFRLVLTGPTVDTSTPWNFCICYLELYGYLR  807



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNP+LSK++ +T SSP SR+TDPKVLVSR +QGTSFAG +VEDG   SWW
Sbjct  643  AGTSYGEHQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFAGLRVEDGKTCSWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFAS
Sbjct  703  MVDIGEDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTVCKPGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            WP+TGPN LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  763  WPVTGPNALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   283 bits (724),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPV++KR+ +TASSP SR+TDPKVLVSR FQGTSFAGP++EDG+  SWW
Sbjct  639  AGTSYGEHQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQGTSFAGPRIEDGHNCSWW  698

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+LR H +DQTICKPGQFAS
Sbjct  699  MVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAHDNDQTICKPGQFAS  758

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGPN LLPFR+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  759  WPITGPNALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYFR  802



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   282 bits (722),  Expect = 7e-86, Method: Composition-based stats.
 Identities = 121/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM
Sbjct  647  GTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWM  706

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASW
Sbjct  707  VDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASW  766

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            PIT  N LLPFRFFR+V+TGP TD   PWN  IC LELYGYFR
Sbjct  767  PITAANALLPFRFFRLVLTGPTTDTSTPWNFYICYLELYGYFR  809



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSK+V VTASSP SRFTDPKVL SR +QGTSFAG ++ DG  +SWW
Sbjct  639  AGTSYGKHQWVNPVLSKKVTVTASSPTSRFTDPKVLASRTYQGTSFAGSRMGDGRNTSWW  698

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G  HQLMCNYYT+RQDGS+AFMR WNFQGS+DG NWTNLR+H+ D+T+CKPGQFAS
Sbjct  699  MVDIGPGHQLMCNYYTLRQDGSKAFMRCWNFQGSSDGRNWTNLRIHEKDETLCKPGQFAS  758

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI  PN LLPFRFFR+ MT P TD+ NPWNCCIC LELYGYF 
Sbjct  759  WPINDPNALLPFRFFRVTMTAPTTDDTNPWNCCICFLELYGYFH  802



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WW
Sbjct  642  AGTSYGKHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+  DHQL+CNYYT+RQDGSRA+MR W FQGS DG  WTNLRVH++DQTICKPGQFAS
Sbjct  702  MVDISADHQLICNYYTLRQDGSRAYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGPN LLP+RFFR+V+TGP TD  NPWN CIC+LELYGY  
Sbjct  762  WPVTGPNALLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYLH  805



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WW
Sbjct  642  AGTSYGKHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+  DHQL+CNYYT+RQDGSR +MR W FQGS DG  WTNLRVH++DQTICKPGQFAS
Sbjct  702  MVDISADHQLICNYYTLRQDGSRTYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGPN LLP+RFFR+V+TGP TD  NPWN CIC+LELYGYF 
Sbjct  762  WPVTGPNALLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYFH  805



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSK+V +T SSP SRFTDPKVLVSR++QGTSFAGP+ EDG  +SWW
Sbjct  641  AGTSYGEHQWVNPVLSKKVTITPSSPLSRFTDPKVLVSRSYQGTSFAGPRKEDGRTTSWW  700

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G+ HQLMCNYYT+RQDGSRAF+R+W+FQGS DG NWTNLRVH++D T+CKPGQ+AS
Sbjct  701  MVDIGHGHQLMCNYYTLRQDGSRAFIRNWSFQGSMDGNNWTNLRVHENDVTMCKPGQYAS  760

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+ GPN LLPFRFFR V+T P TD  NPW+ CIC LELYGYFR
Sbjct  761  WPVVGPNALLPFRFFRAVLTAPTTDITNPWSFCICFLELYGYFR  804



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            +GTSYG H WVNPVLSKR+ +TASSP SR TDPKVLVSR +QGT FAGP++E+GNI +WW
Sbjct  639  SGTSYGEHPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQGTCFAGPRMENGNICAWW  698

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRA++R+W FQG  DG  W +LRVH++DQT+CKPGQFAS
Sbjct  699  MVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVHENDQTMCKPGQFAS  758

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGPN LLPFRFFR+++TGP TD  NPWN CIC LELYGYFR
Sbjct  759  WPVTGPNALLPFRFFRVLLTGPTTDASNPWNLCICFLELYGYFR  802



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPV++KR+ +TASSP SR+TDPKVLVSR FQGTSFAGP++EDG+  SWW
Sbjct  690  AGTSYGEHQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQGTSFAGPRIEDGHNCSWW  749

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+LR H +DQTICKPGQFAS
Sbjct  750  MVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAHDNDQTICKPGQFAS  809

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGPN LLPFR+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  810  WPITGPNALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYFR  853



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   281 bits (718),  Expect = 2e-85, Method: Composition-based stats.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+K++ +  SSP SRFTDPK L SR + GTSFAGP++EDG ISSWW
Sbjct  641  AGTSYGDHQWVNPVLAKKITIIVSSPTSRFTDPKTLASRTYMGTSFAGPRMEDGQISSWW  700

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCNYYT+RQDGSR + RSW  QGS DG +W ++RVH+DDQT+CK GQFAS
Sbjct  701  MVDLGKDHQLMCNYYTLRQDGSRTYPRSWKLQGSMDGNSWADVRVHEDDQTMCKLGQFAS  760

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI G N LLPFR+FR+VMTGP  D  NPW+ CIC LELYGYFR
Sbjct  761  WPIVGANSLLPFRYFRVVMTGPTADASNPWSFCICFLELYGYFR  804



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   280 bits (716),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSK+V +TASSPFSRFTDPKVLVSR++ GTSFAGP++E+G  ++WW
Sbjct  639  AGTSYGEHQWVNPVLSKKVIITASSPFSRFTDPKVLVSRSYLGTSFAGPRMENGRNTAWW  698

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G+ HQLMCN+YT+RQDGSRAFMR+WNFQGS DG NWTNLRVH++D+T+ KPGQFAS
Sbjct  699  MVDIGHSHQLMCNHYTLRQDGSRAFMRNWNFQGSMDGNNWTNLRVHENDETMSKPGQFAS  758

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+ GP  LLPFRFFR+V+  P TD  NPW+ CIC LELYGYFR
Sbjct  759  WPVVGPTALLPFRFFRVVLVAPTTDATNPWSLCICFLELYGYFR  802



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR ++GTSFAGPQ+EDG+ S+WW
Sbjct  642  AGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRGTSFAGPQIEDGHKSTWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFAS
Sbjct  702  TVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  762  WPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  805



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR ++GTSFAGPQ+EDG+ S+WW
Sbjct  640  AGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRGTSFAGPQIEDGHKSTWW  699

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFAS
Sbjct  700  TVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFAS  759

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  760  WPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  803



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNP+LSK++ +T SSP SR+TDPKVLVSR +QGTSF G +VEDG   SWW
Sbjct  643  AGTSYGEHQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFTGLRVEDGKTCSWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFAS
Sbjct  703  MVDIGEDHQLMCNYYTLRQDGSRAFIRYWNLQGSFDGKTWTNLRVHENDQTVCKPGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            W +TGPN LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  763  WAVTGPNALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            +GTSYG H WVNPVLSKR+ +TASSP SR TDPKVLVSR +QGT FAGP++E+GNI +WW
Sbjct  639  SGTSYGEHPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQGTCFAGPRMENGNICAWW  698

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRA++R+W FQG  DG  W +LRVH++DQT+CKPGQFAS
Sbjct  699  MVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVHENDQTMCKPGQFAS  758

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGPN LLPFRFFR+++TG  TD  NPWN CIC LELYGYFR
Sbjct  759  WPVTGPNALLPFRFFRVLLTGLTTDASNPWNLCICFLELYGYFR  802



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNP+L+KR+ +TASSP SR TDPKVLVSR +QGTSF GP+VEDG   SWW
Sbjct  626  AGTSYGEHQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQGTSFTGPRVEDGKNCSWW  685

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG  WTNLRVH++DQT+CKPGQ+AS
Sbjct  686  MVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVHENDQTMCKPGQYAS  745

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI  PN LLPFRFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  746  WPIMAPNALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYFH  789



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNP+L+KR+ +TASSP SR TDPKVLVSR +QGTSF GP+VEDG   SWW
Sbjct  643  AGTSYGEHQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQGTSFTGPRVEDGKNCSWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG  WTNLRVH++DQT+CKPGQ+AS
Sbjct  703  MVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVHENDQTMCKPGQYAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI  PN LLPFRFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  763  WPIMAPNALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYFH  806



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWW
Sbjct  646  VGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEGGHISSWW  705

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LR+H+DDQT+CK GQFAS
Sbjct  706  MVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRIHEDDQTMCKVGQFAS  765

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGYFR
Sbjct  766  WPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYFR  809



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP+ EDG+ISSWW
Sbjct  643  VGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKTYVGTSFAGPRKEDGHISSWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFAS
Sbjct  703  MVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+ +TGP TD   PWN CIC LELYGYFR
Sbjct  763  WPITAANALLPFRFFRLFLTGPTTDTSTPWNFCICYLELYGYFR  806



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   275 bits (703),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WW
Sbjct  645  AGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWW  704

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            MID+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFAS
Sbjct  705  MIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTMCKAGQFAS  764

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGP  LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  765  WPITGPQALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  808



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WW
Sbjct  638  AGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWW  697

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            MID+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFAS
Sbjct  698  MIDIGQDHQLMCNHYTLRQDGSRAFIRCWNLQGSLDGKTWTNLRVHENDQTMCKAGQFAS  757

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGP  LLPFRFFR+V+TGP TD  NP N CIC LELYGYF 
Sbjct  758  WPITGPQALLPFRFFRVVLTGPTTDGSNPHNLCICFLELYGYFH  801



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + V ASSP SR+TDPK LVS+N+QGT FAGP++EDG + SWW
Sbjct  642  AGTSFGKHQWINPVLAKNIKVIASSPNSRYTDPKALVSKNYQGTCFAGPRLEDGKMCSWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G+DHQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LR+HKDDQTIC+PGQFAS
Sbjct  702  MVDIGHDHQLMCNYYTVRQDGSTTFMRSWVLQGSMDGQNWTSLRIHKDDQTICQPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGP+ LLPFRFFR+++TG  T   N WN CIC LELYGYFR
Sbjct  762  WPITGPSALLPFRFFRVMLTGHATGVSNTWNLCICFLELYGYFR  805



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WW
Sbjct  638  AGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWW  697

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            MID+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFAS
Sbjct  698  MIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTMCKAGQFAS  757

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGP  LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  758  WPITGPQALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  801



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   275 bits (702),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQW+NPVL+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +EDG+I +WW
Sbjct  643  AGTSYGEHQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMEDGHIRAWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFAS
Sbjct  703  MVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGP+ LLPFRFFR+V+TGP TD  NP N CIC LELYGYF 
Sbjct  763  WPITGPHALLPFRFFRVVLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG H WVNPVLSKR+A+TASSP SR+TDPKVLVSR +QGT FAGP++E G I +WW
Sbjct  626  AGTSYGEHPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCFAGPRMEGGRICAWW  685

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            MID+G DHQL+CNYYT+RQDGSRA++R W  QGS DG +W +LRVH++DQT+CKPGQFAS
Sbjct  686  MIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVHENDQTMCKPGQFAS  745

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TG N LLPFRFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  746  WPVTGTNALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  789



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   274 bits (701),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG H WVNPVLSKR+A+TASSP SR+TDPKVLVSR +QGT FAGP++E G I +WW
Sbjct  642  AGTSYGEHPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCFAGPRMEGGRICAWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            MID+G DHQL+CNYYT+RQDGSRA++R W  QGS DG +W +LRVH++DQT+CKPGQFAS
Sbjct  702  MIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVHENDQTMCKPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TG N LLPFRFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  762  WPVTGTNALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  805



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWW
Sbjct  633  VGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWW  692

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFAS
Sbjct  693  MVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFAS  752

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  753  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  796



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            +GTSYG HQWVNPVLSK++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WW
Sbjct  642  SGTSYGEHQWVNPVLSKKITVTASSPASRYTDPKTLVSRAYQGTSFAGPRIEDGMNCAWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  +MRSW FQGS DG NWTNLRVH++DQTIC+PGQFAS
Sbjct  702  MVDIGQDHQLMCNYYTLRQDGSTTYMRSWAFQGSMDGENWTNLRVHENDQTICRPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI G   LLPFRFFR+++TGP T   N WN CIC +ELYGYFR
Sbjct  762  WPIIGSTSLLPFRFFRVILTGPATGYSNVWNLCICFIELYGYFR  805



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWW
Sbjct  681  VGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWW  740

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFAS
Sbjct  741  MVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFAS  800

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  801  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  844



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW
Sbjct  646  VGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWW  705

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            ++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFAS
Sbjct  706  VVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFAS  765

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  766  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  809



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW
Sbjct  649  VGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWW  708

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            ++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFAS
Sbjct  709  VVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFAS  768

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  769  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  812



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 138/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW
Sbjct  692  VGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWW  751

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            ++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFAS
Sbjct  752  VVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFAS  811

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  812  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  855



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  S
Sbjct  634  AGTSYGEHQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCS  693

Query  508  WWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
            WWMIDLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQF
Sbjct  694  WWMIDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQF  753

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            ASWP+ GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  754  ASWPVVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  798



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   270 bits (689),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+K + +TASSP SRFTDPKVL SR +QGTSFAGP++EDG+ S+WW
Sbjct  647  AGTSYGEHQWVNPVLAKTITITASSPPSRFTDPKVLASRTYQGTSFAGPRIEDGHSSTWW  706

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G +HQLMCNYYT+RQDGSRA++RSW+ QGS DG  WTNL VH++DQT+CK GQFAS
Sbjct  707  MVDIGSNHQLMCNYYTLRQDGSRAYIRSWSLQGSLDGKTWTNLSVHENDQTVCKLGQFAS  766

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI GPN L PFRFFR ++TGP TD  NP N CIC LELYGYF 
Sbjct  767  WPIVGPNALRPFRFFRALLTGPTTDISNPCNLCICFLELYGYFH  810



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   269 bits (688),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG H+WVNP+LS R+ +T SSP SRFTDPKVL SR +QGTSF+GP+ EDG   SWW
Sbjct  642  AGTSYGEHRWVNPMLSNRITITTSSPISRFTDPKVLASRTYQGTSFSGPRFEDGRTCSWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            MID+G DHQLMCNYYT+RQDGSR F+R WN QGS DG +WTNLR HK+DQ ICKPGQFAS
Sbjct  702  MIDVGEDHQLMCNYYTLRQDGSRTFIRHWNLQGSLDGKHWTNLREHKNDQKICKPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGP  LL FRFFR+++TGP TD    W  CIC LELYGYFR
Sbjct  762  WPVTGPQALLSFRFFRVILTGPTTDPTETWKFCICFLELYGYFR  805



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   269 bits (687),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQW+NPVL+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +E+G+I +WW
Sbjct  643  AGTSYGEHQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMENGHIRAWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             +D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFAS
Sbjct  703  TVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGP+ LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  763  WPVTGPHALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG H WVNPVLSK++ +TASSP SR+TD K LVSR +Q TSFAGP++EDG+ S+WW
Sbjct  640  AGTSYGEHAWVNPVLSKKITLTASSPASRYTDSKALVSRTYQATSFAGPRIEDGHSSAWW  699

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G+DHQLMCNYYT+RQDGS  ++RSW FQGS DG NWTNLRVH DDQTIC+ GQFAS
Sbjct  700  MVDIGHDHQLMCNYYTLRQDGSSTYIRSWAFQGSVDGKNWTNLRVHNDDQTICRSGQFAS  759

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            WP+ GP  LLPFR FR+++TGP + + N WN CIC +ELYGYF
Sbjct  760  WPVIGPMALLPFRIFRVILTGPASGDANVWNLCICFIELYGYF  802



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            +GTSYG HQWVNPVL+K++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WW
Sbjct  640  SGTSYGEHQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQGTSFAGPRIEDGKNCAWW  699

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNLRVH++DQTIC+PGQFAS
Sbjct  700  MVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVHENDQTICRPGQFAS  759

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            W +TG   LLPFRFFR+++TGP + + + WN CIC +ELYGYFR
Sbjct  760  WTVTGSTALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYFR  803



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            +GTSYG HQWVNPVL+K++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WW
Sbjct  642  SGTSYGEHQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQGTSFAGPRIEDGKNCAWW  701

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNLRVH++DQTIC+PGQFAS
Sbjct  702  MVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVHENDQTICRPGQFAS  761

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            W +TG   LLPFRFFR+++TGP + + + WN CIC +ELYGYFR
Sbjct  762  WTVTGSTALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYFR  805



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +E+G+I +WW
Sbjct  643  AGTSYGEHQWINPILAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMENGHIRAWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             +D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFAS
Sbjct  703  TVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+TGP+ LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  763  WPVTGPHALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  S
Sbjct  719  AGTSYGEHQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCS  778

Query  508  WWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
            WWMIDLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQF
Sbjct  779  WWMIDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQF  838

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            ASWP+ GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  839  ASWPVVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  883



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWW
Sbjct  571  AGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWW  630

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFAS
Sbjct  631  MVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFAS  690

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITG   LLPFRFFR+++T P T   N WN CIC LELYGYFR
Sbjct  691  WPITGQTALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYFR  734



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWW
Sbjct  643  AGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFAS
Sbjct  703  MVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITG   LLPFRFFR+++T P T   N WN CIC LELYGYFR
Sbjct  763  WPITGQTALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYFR  806



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   S
Sbjct  637  AGTSYGEHPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCS  696

Query  508  WWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
            WWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQF
Sbjct  697  WWMVDLGQDHQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQF  756

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            ASWPI GPN LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  757  ASWPIIGPNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  801



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   S
Sbjct  641  AGTSYGEHPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCS  700

Query  508  WWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
            WWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQF
Sbjct  701  WWMVDLGQDHQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQF  760

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            ASWPI GPN LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  761  ASWPIIGPNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  805



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + V ASSP SR+T+PK LVS+N+QGT FAGP+ E+G   SWW
Sbjct  649  AGTSFGKHQWINPVLAKNITVMASSPNSRYTNPKALVSKNYQGTCFAGPRDENGKKCSWW  708

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  FMRSW FQGS DG NWT+L VH+++QTIC+PGQFAS
Sbjct  709  MVDIGEDHQLMCNYYTVRQDGSTTFMRSWVFQGSMDGENWTSLGVHEEEQTICQPGQFAS  768

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGP+ LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  769  WPITGPSALLPFRFFRLALTGPATGMSNTWNLCICFLELYGYFR  812



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWW
Sbjct  643  AGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFAS
Sbjct  703  MVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITG   LLPFRFFR+++T P T   + WN CIC LELYGYFR
Sbjct  763  WPITGQTALLPFRFFRVMLTAPATGVSHTWNLCICFLELYGYFR  806



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG H WVNPVL+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WW
Sbjct  643  AGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFAS
Sbjct  703  MVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            W + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  763  WAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  806



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG H WVNPVL+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WW
Sbjct  654  AGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWW  713

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFAS
Sbjct  714  MVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFAS  773

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            W + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  774  WAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  817



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+QGT FAGP+ EDG   SWW
Sbjct  644  AGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQGTCFAGPRDEDGKKCSWW  703

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS AFMRSW  QGS DG NWT+L V++D++ IC+PGQFAS
Sbjct  704  MVDIGQDHQLMCNYYTVRQDGSTAFMRSWVLQGSMDGENWTSLVVNEDERAICQPGQFAS  763

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPITGP+ LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  764  WPITGPSALLPFRFFRLALTGPTTS--NTWNLCICFLELYGYFR  805



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG H WVNPVL+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WW
Sbjct  655  AGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWW  714

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFAS
Sbjct  715  MVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFAS  774

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            W + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  775  WAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  818



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   +
Sbjct  637  AGTSYGEHPWVNPLLAEQRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCT  696

Query  508  WWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
            WWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS +G +WTNL VH++D+++CKPGQF
Sbjct  697  WWMVDLGQDHQLMCNYYTLRQDGSKAFPRFWNIQGSQEGKSWTNLWVHENDRSVCKPGQF  756

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            ASWPI GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  757  ASWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  801



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   261 bits (666),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL++++ VTASSP SR+TDPKVLVSR +Q TSFAGP++EDG   +WW
Sbjct  643  AGTSYGEHQWVNPVLAQKITVTASSPASRYTDPKVLVSRTYQATSFAGPRMEDGKNCAWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCN YT+RQDGS  +MR W  QGS DG NWT+L+VH +DQTICKPGQFAS
Sbjct  703  MVDLGQDHQLMCNCYTLRQDGSNVYMRCWALQGSLDGRNWTDLKVHGNDQTICKPGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+ GP  +LPFRFFR+++TGP T   +PWN  IC LELYGYF 
Sbjct  763  WPVQGPAAVLPFRFFRVILTGPTTSNSSPWNLSICFLELYGYFH  806



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++++T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWW
Sbjct  638  VGTSYGSHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWW  697

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFAS
Sbjct  698  MVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFAS  757

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  758  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  801



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
             GTSYG+HQWVNPVL+K++++T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWW
Sbjct  643  VGTSYGSHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWW  702

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFAS
Sbjct  703  MVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFAS  762

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  763  WPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  806



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  S
Sbjct  630  AGTSYGEHQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCS  689

Query  508  WWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
            WWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQF
Sbjct  690  WWMVDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQF  749

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            ASWPI  PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  750  ASWPIVAPNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  794



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  S
Sbjct  650  AGTSYGEHQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCS  709

Query  508  WWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
            WWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQF
Sbjct  710  WWMVDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQF  769

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            ASWPI  PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  770  ASWPIVAPNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  814



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   255 bits (652),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 133/164 (81%), Gaps = 8/164 (5%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR ++        +EDG+ S+WW
Sbjct  642  AGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYR--------IEDGHKSTWW  693

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFAS
Sbjct  694  TVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFAS  753

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  754  WPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  797



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 131/164 (80%), Gaps = 14/164 (9%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+EDG  +SWW
Sbjct  661  AGTSYGKHQWVNPVLSKRVTITASSPISRCTDPKVLVSRNFQGTSLAGPQMEDGRNASWW  720

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS AFMR WNFQGS DG +WTNLR+       C P     
Sbjct  721  MVDVGQDHQLMCNYYTLRQDGSGAFMRRWNFQGSLDGKSWTNLRI------XCSP-----  769

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
               TGPN LLPFRFFR++MT P TD+ NPWNCCIC LELYGYFR
Sbjct  770  ---TGPNALLPFRFFRLLMTAPTTDDTNPWNCCICFLELYGYFR  810



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + V ASSP SR TDPK LVS+N+QGT FAGP +EDG   SWW
Sbjct  697  AGTSFGKHQWMNPVLAKNITVVASSPNSRHTDPKALVSKNYQGTCFAGPCIEDGKKISWW  756

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LRVH++D TIC PGQFAS
Sbjct  757  MVDIGQDHQLMCNYYTVRQDGSTTFMRSWVLQGSMDGRNWTSLRVHEEDATICHPGQFAS  816

Query  322  WPITGPNPLLPFRFFRIVMTGP--GTDEMNPWNCCICVLELYGYFR  191
            WP+ GP  LLPFRFFR+ +TGP  G    N WN CIC LELYGY R
Sbjct  817  WPVVGPPALLPFRFFRVALTGPAAGGSVSNAWNLCICFLELYGYLR  862



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 129/164 (79%), Gaps = 2/164 (1%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTS+G HQW+NPVL+K + V ASSP SR TDPK LVS+N+QGT FAGP +E+G   SWW
Sbjct  646  AGTSFGKHQWMNPVLTKNITVVASSPNSRHTDPKALVSKNYQGTCFAGPCIENGKKLSWW  705

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G D+QLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LRVH DD TIC PGQFAS
Sbjct  706  MVDIGQDYQLMCNYYTVRQDGSTTFMRSWALQGSMDGRNWTSLRVHDDDPTICHPGQFAS  765

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI GP  LLPFRFFR+ +TGP       WN CIC LELYGYFR
Sbjct  766  WPIVGPAALLPFRFFRVALTGPAAG--CAWNLCICFLELYGYFR  807



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            +GTSYG H WVNP L+KRV VTASSP SR+TDPK LVSR +Q TSFAGP++  G   +WW
Sbjct  664  SGTSYGEHDWVNPFLAKRVIVTASSPASRYTDPKSLVSRTYQATSFAGPRIVGGKNCAWW  723

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             ID+G DH+LMCNYYTIRQDGS  F R W+ QGS D  NWT+LRVH++D+TICKP QFAS
Sbjct  724  KIDIGQDHELMCNYYTIRQDGSTGFTRHWSLQGSRDAENWTDLRVHENDRTICKPAQFAS  783

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            WPI  PN LLPFRFFR+++TG  T + NPWN C+C LELYGYFR
Sbjct  784  WPIHPPNALLPFRFFRVLLTGLTTSDSNPWNLCMCFLELYGYFR  827



>ref|NP_001174372.1| Os05g0345500 [Oryza sativa Japonica Group]
 dbj|BAH93100.1| Os05g0345500 [Oryza sativa Japonica Group]
Length=152

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -1

Query  622  VTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQD  443
            VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQD
Sbjct  9    VTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQD  68

Query  442  GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMT  263
            GS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T
Sbjct  69   GSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLT  128

Query  262  GPGTDEMNPWNCCICVLELYGYFR  191
             P T   N WN CIC LELYGYFR
Sbjct  129  APATGVSNTWNLCICFLELYGYFR  152



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   237 bits (605),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYG HQWVNPVLSK+V +T SSP SRFTDPKVLVSR++QGTSFAGP++E+G  ++WW
Sbjct  640  AGTSYGQHQWVNPVLSKKVFITGSSPVSRFTDPKVLVSRSYQGTSFAGPRMENGKNTAWW  699

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            M+D+G DHQL+CNYYTIRQDGSRAF+R W+ QGSTDG NW +LRVH++D T+CK GQ+AS
Sbjct  700  MVDIGDDHQLICNYYTIRQDGSRAFLRHWSLQGSTDGANWASLRVHENDATMCKSGQYAS  759

Query  322  WPITGPNPLLPFRFFRIVMTG  260
            WP+ G N LLPFRFFRI +TG
Sbjct  760  WPVVGSNALLPFRFFRIALTG  780



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GTSYG+H W+NP L+K++ V+ASSP SRFTD K LVSRN+QGTSFAGP    G +S+WW 
Sbjct  622  GTSYGSHPWMNPALTKKLVVSASSPPSRFTDAKALVSRNYQGTSFAGPCNVGGQMSAWWK  681

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG D QL+CNYYT+RQD S +FMR+W+ QGS DG  WT LR H +DQTI   GQ+ASW
Sbjct  682  VDLGADQQLLCNYYTVRQDSSSSFMRNWSLQGSVDGQRWTQLRTHHNDQTIGHGGQYASW  741

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            P+ G N LLPFRFFR+++ GP T    PWN  +C LELYGY R
Sbjct  742  PVFGANALLPFRFFRVILLGPTTSVSTPWNLSLCYLELYGYLR  784



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYGAH+W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW
Sbjct  629  AGTSYGAHEWMNPMVTKQITLSASSPHSRYTDPKVLASRNYQATSFAGPCIERGETVSWW  688

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             +DLG DH+LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+AS
Sbjct  689  RVDLGPDHKLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYAS  748

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            WP+ G   L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  749  WPVHGSKSLIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  791



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWW  503
            AGTSYGAH+W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW
Sbjct  609  AGTSYGAHEWMNPMVTKQITLSASSPPSRYTDPKVLASRNYQATSFAGPCIERGETVSWW  668

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             +DLG DH+LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+AS
Sbjct  669  RVDLGPDHKLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYAS  728

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            WP+ G   L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  729  WPVHGSKSLIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  771



>gb|AAB63076.1| unknown protein [Arabidopsis thaliana]
Length=114

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  532  VEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQ  353
            +EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQ
Sbjct  1    MEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQ  60

Query  352  TICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
            T+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  61   TMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  114



>gb|KIY99757.1| hypothetical protein MNEG_8204 [Monoraphidium neglectum]
Length=725

 Score =   197 bits (500),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 89/162 (55%), Positives = 109/162 (67%), Gaps = 0/162 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
             T YG+ QWVNPVL+KR+ V ASSP SRFTDPK LVS  F  TSFA P+ E G  SSWW+
Sbjct  523  ATDYGSKQWVNPVLAKRIEVRASSPASRFTDPKALVSGAFLRTSFACPRYEGGQPSSWWL  582

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG  H+L+CNYYT+R D S  F R W  Q S D  +W +LR H  D  I  PGQ+ASW
Sbjct  583  VDLGPSHRLLCNYYTMRHDSSSDFPRHWVLQASNDLQHWVDLRRHIADAAIRLPGQYASW  642

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            P++GP   +PFR FR+++ GP      PWN C+  +E YGYF
Sbjct  643  PVSGPASHMPFRAFRLLLAGPTLSAATPWNFCLSHVEFYGYF  684



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 113/162 (70%), Gaps = 0/162 (0%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            G+  G+  WVNPVL+ R+ V ASSP  R TDPK L   NF   +FAGP++E+G +SSWW+
Sbjct  492  GSRGGSQPWVNPVLAGRLQVRASSPACRSTDPKALAGNNFARCNFAGPRMENGQLSSWWV  551

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG +H+L+CN+YT+R DGS  F+RSW  QGS DG +W +LR H  D+T+  PGQ+ASW
Sbjct  552  LDLGPEHRLICNHYTLRHDGSTDFLRSWVLQGSNDGASWADLRRHISDRTVRMPGQYASW  611

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            P++     +P+R FR+++ GP  +  NP + C+   ELYGY 
Sbjct  612  PVSSHAAAVPYRMFRLLLVGPNPEAANPHHVCLSFWELYGYL  653



>ref|XP_005650913.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26369.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
Length=448

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (65%), Gaps = 5/164 (3%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GT+YG  ++VNP LS R+ VTASSP  RFTDPK +VS +F   + AG Q  DG   +WW 
Sbjct  279  GTAYGQQKFVNPALSGRLQVTASSPSCRFTDPKAVVSGHFLRNNAAG-QRRDGG--TWWR  335

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG  H+LMCNYYT+R D S  + RSW  Q STDG  W +LR H DD TI   GQ+ASW
Sbjct  336  VDLGEQHRLMCNYYTMRHDASPDYARSWALQASTDGTVWVDLRQHADDCTINMAGQYASW  395

Query  319  PITGPNPLLPFRFFRIVMT--GPGTDEMNPWNCCICVLELYGYF  194
            P+TG     PFRFF++++T   P + + N     +  LE YGYF
Sbjct  396  PVTGHAARRPFRFFQLLLTPAAPASGKANGRVFSLSYLEFYGYF  439



>ref|XP_011399599.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
 gb|KFM26661.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
Length=465

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 94/164 (57%), Gaps = 2/164 (1%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
             T  G  QWVNP+LS RV V ASSP  R T+P   V+      +FA P+ E G + SWW 
Sbjct  279  ATQGGQQQWVNPMLSGRVKVQASSPACRSTNPASCVALGPPRLNFAAPRSEAGRLVSWWS  338

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDG--VNWTNLRVHKDDQTICKPGQFA  326
            +DLG  HQL C+ YT+R D S   +RSW  Q S DG    W +LR H++D T+  PGQ+ 
Sbjct  339  LDLGPRHQLACSAYTLRHDKSHDPLRSWTLQASRDGPQCGWEDLRRHENDLTLRLPGQYG  398

Query  325  SWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            SW +TG    +P+R FRI +        NPW+  +  +ELYG  
Sbjct  399  SWAVTGHAATVPYRCFRICVMQMQKGNENPWHASLAQIELYGNL  442



>ref|XP_001697437.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00099.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=113

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = -1

Query  526  DGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  347
            +G  SSWW +DLG  HQL   YYT+R DGS+ F RSW  QGS D  NW +L+ H +D T+
Sbjct  1    NGVASSWWQVDLGEQHQLAITYYTLRHDGSQDFARSWVLQGSHDLSNWVDLKRHANDTTV  60

Query  346  CKPGQFASWPITGPNPLLPFRFFRIVMTGPGT--DEMNPWNCCICVLELYGYF  194
              PGQ+ASWP+ GP    P+R FR+++T P    +  + +N C+  +E YG+ 
Sbjct  61   KVPGQYASWPVIGPAAATPYRAFRLLLTAPNASPNPASRYNFCLSNVEFYGFM  113



>ref|XP_002950189.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
 gb|EFJ48857.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
Length=108

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = -1

Query  511  SWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQ  332
            SWW +DLG  HQL   YYT+R DGS+ F+RSW  QGS D   W +L+ H +D TI  PGQ
Sbjct  1    SWWQVDLGEQHQLAITYYTLRHDGSQDFVRSWVLQGSHDLAVWVDLKRHSNDTTIKVPGQ  60

Query  331  FASWPITGPNPLLPFRFFRIVMTGPGT--DEMNPWNCCICVLELYGYF  194
            +ASWP+ GP   +P+R FR+++T P    +  +  N C+  LELYG+ 
Sbjct  61   YASWPVIGPAAAVPYRAFRLLLTAPNASPNPASRHNFCLSNLELYGFL  108



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score =   111 bits (277),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = -1

Query  682  AGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISS  509
            AGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   S
Sbjct  641  AGTSYGEHPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCS  700

Query  508  WWMIDLGYDHQ  476
            WWM+DLG DHQ
Sbjct  701  WWMVDLGQDHQ  711



>ref|XP_004339299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR17286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=775

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 85/154 (55%), Gaps = 8/154 (5%)
 Frame = -1

Query  655  WVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  476
            WVNP  +  V V  S+P SR+++P+ +V R F  T +       G    W ++ L  +  
Sbjct  629  WVNPCRAGLVKVVCSAPPSRYSNPEAVVDRAFHTTWYTS-----GRPHPWLIVQLLKEKA  683

Query  475  LMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  296
             +   Y IRQDGS  F+RSW+ QGS DG +W +L  H +D  +  P ++  WP++    +
Sbjct  684  FVMKGYAIRQDGSTVFLRSWSMQGSNDGQSWVDLSTHVNDCGLASPSRWVFWPVSS---V  740

Query  295  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            +P+  FR++MTGP    ++P    +  +E YG+F
Sbjct  741  VPYAQFRLIMTGPSASPVSPNTLALSNIEFYGFF  774



>gb|KDD72973.1| hypothetical protein H632_c2675p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=110

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -1

Query  499  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  320
            +DLG   +L   +Y +R D SR F+R W  Q S DG  W ++R H  D ++    Q+A+W
Sbjct  1    VDLGPRRRLALTHYALRHDASRDFLRDWVVQASADGEAWVDVRRHASDPSLKVAHQWAAW  60

Query  319  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            P+ G     P+R  R+++  P     NPW+  +   E YG+ 
Sbjct  61   PLVGHAAARPWRALRVLLDRPNAGADNPWHLALSAWEFYGHL  102



>ref|XP_005708947.1| ubiquitin-protein ligase [Galdieria sulphuraria]
 gb|EME32427.1| ubiquitin-protein ligase [Galdieria sulphuraria]
Length=970

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 46/133 (35%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = -1

Query  652  VNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  473
            VNP     V++T+SS  SRF   + L   +   + FA   + + +   W+ +DLG +  L
Sbjct  821  VNPHKYNIVSITSSSG-SRFAKLESLAESSVNRSCFA---LSNSSSLVWFALDLGAERVL  876

Query  472  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  296
             C++YT+  DGS + F+R+W  +GS DG +WT L+ H++D+T+  P Q A+W +  P   
Sbjct  877  ACSFYTLAHDGSESNFLRNWCLEGSKDGKSWTVLKEHQNDETLQSPLQRATWRLEEPTSQ  936

Query  295  LPFRFFRIVMTGP  257
            + +R+FR++   P
Sbjct  937  VFYRYFRVIARPP  949



>ref|XP_004333299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=764

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 79/150 (53%), Gaps = 14/150 (9%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNI-SSWW  503
             T+ G   W NP  + R+ VTASS      DP  LVS+          ++  G++ +SW+
Sbjct  610  ATNRGREPWTNPHSAGRLRVTASS--IEKGDPVKLVSKK-------PSELWSGDVPASWF  660

Query  502  MIDLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQF  329
             IDLG    L+ NYYT+R  G+     +R+W+ QGS+DG  W  L+ H +D ++  P   
Sbjct  661  AIDLGPSRTLVPNYYTLRHGGNYKADSLRTWDLQGSSDGKTWIVLKRHTNDTSLSGPFAT  720

Query  328  ASWPITGPNPLLPFRFFRIVMTGPGTDEMN  239
             SWPI  P+    +R FRI+ TG  +   N
Sbjct  721  HSWPI--PSVTEAYRHFRILQTGHNSSNHN  748



>ref|XP_011189869.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
cucurbitae]
Length=2893

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1164  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1216

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +P
Sbjct  1217  AWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEP  1274

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1275  GSTATWPIVCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189870.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
cucurbitae]
Length=2889

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1164  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1216

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +P
Sbjct  1217  AWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEP  1274

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1275  GSTATWPIVCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
 ref|XP_011189867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
Length=2905

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1176  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1228

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +P
Sbjct  1229  AWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEP  1286

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1287  GSTATWPIVCAPDEMHGFRHIRVQQNG  1313



>ref|XP_011189868.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
cucurbitae]
Length=2901

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1176  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1228

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +P
Sbjct  1229  AWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEP  1286

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1287  GSTATWPIVCAPDEMHGFRHIRVQQNG  1313



>ref|XP_004521546.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X5 
[Ceratitis capitata]
Length=2888

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1161  GSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1213

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +P
Sbjct  1214  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEP  1271

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  RI   G
Sbjct  1272  GSTATWPIVCSPDEMQGFRHIRIQQNG  1298



>ref|XP_004521545.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X4 
[Ceratitis capitata]
Length=2896

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1173  GSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1225

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +P
Sbjct  1226  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEP  1283

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  RI   G
Sbjct  1284  GSTATWPIVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521542.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Ceratitis capitata]
 ref|XP_004521543.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Ceratitis capitata]
 ref|XP_004521544.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X3 
[Ceratitis capitata]
Length=2900

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1173  GSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1225

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +P
Sbjct  1226  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEP  1283

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  RI   G
Sbjct  1284  GSTATWPIVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521547.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X6 
[Ceratitis capitata]
Length=2477

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1173  GSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1225

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +P
Sbjct  1226  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEP  1283

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  RI   G
Sbjct  1284  GSTATWPIVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_011199876.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199877.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199878.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
Length=2899

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1171  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1223

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +P
Sbjct  1224  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEP  1281

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1282  GSTATWPIVCAPDEMHGFRHIRVQQNG  1308



>ref|XP_011199881.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
dorsalis]
Length=2883

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1159  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1211

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +P
Sbjct  1212  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEP  1269

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1270  GSTATWPIVCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199880.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
dorsalis]
Length=2887

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1159  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1211

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +P
Sbjct  1212  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEP  1269

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1270  GSTATWPIVCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199879.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
dorsalis]
Length=2895

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  
Sbjct  1171  GSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKK  1223

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +P
Sbjct  1224  AWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEP  1281

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPI   P+ +  FR  R+   G
Sbjct  1282  GSTATWPIVCAPDEMHGFRHIRVQQNG  1308



>ref|XP_005708289.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
 gb|EME31769.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
Length=960

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 51/155 (33%), Positives = 83/155 (54%), Gaps = 11/155 (7%)
 Frame = -1

Query  652  VNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  473
            +NP     V +++SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L
Sbjct  809  INPHKHGVVKISSSSG-ARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYEL  864

Query  472  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  296
             C+ Y++  DGS + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I      
Sbjct  865  ACSAYSLVHDGSESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQ  924

Query  295  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
              FR+FRI+    G+  +N  N     LE YG  R
Sbjct  925  EFFRYFRILARSRGS-RLNLGN-----LEFYGRLR  953



>ref|XP_005708288.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
 gb|EME31768.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
Length=944

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 51/155 (33%), Positives = 83/155 (54%), Gaps = 11/155 (7%)
 Frame = -1

Query  652  VNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  473
            +NP     V +++SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L
Sbjct  793  INPHKHGVVKISSSSG-ARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYEL  848

Query  472  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  296
             C+ Y++  DGS + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I      
Sbjct  849  ACSAYSLVHDGSESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQ  908

Query  295  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
              FR+FRI+    G+  +N  N     LE YG  R
Sbjct  909  EFFRYFRILARSRGS-RLNLGN-----LEFYGRLR  937



>ref|XP_011414031.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Crassostrea gigas]
Length=2445

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A +WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ I
Sbjct  1097  AVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAI  1149

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+
Sbjct  1150  DLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTAT  1207

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1208  WPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_011414030.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Crassostrea gigas]
Length=2448

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A +WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ I
Sbjct  1100  AVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAI  1152

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+
Sbjct  1153  DLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTAT  1210

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1211  WPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1251



>gb|EKC30956.1| E3 ubiquitin-protein ligase HECTD1 [Crassostrea gigas]
Length=2380

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A +WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ I
Sbjct  1097  AVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAI  1149

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+
Sbjct  1150  DLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTAT  1207

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1208  WPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_639138.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
 gb|EAL65772.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
Length=863

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 55/162 (34%), Positives = 79/162 (49%), Gaps = 16/162 (10%)
 Frame = -1

Query  676  TSYGAHQWVNPVLSKRVAVTASS-PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            T  G  +W NP  + ++ +T+SS       D   L    F               +SW M
Sbjct  705  TDGGNEKWSNPHSTSKIKITSSSIDKGNLYDIVELTPNAFWTKDVP---------ASWVM  755

Query  499  IDLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  326
            IDLG +  ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       
Sbjct  756  IDLGPNRTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNYKYATH  815

Query  325  SWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
            SWP+TG      FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  816  SWPVTGCET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  853



>gb|AAB47544.1| MigA [Dictyostelium discoideum]
Length=813

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 56/161 (35%), Positives = 83/161 (52%), Gaps = 14/161 (9%)
 Frame = -1

Query  676  TSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
            T  G  +W NP  + ++ +T+SS         V ++ N    +F    V     +SW MI
Sbjct  655  TDGGNEKWSNPHSTSKIKITSSSIDKGNLYDIVELTPN----AFWTKDVP----ASWVMI  706

Query  496  DLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            DLG +  ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       S
Sbjct  707  DLGPNRTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNYKYATHS  766

Query  322  WPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
            WP+TG      FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  767  WPVTGCET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  803



>ref|XP_011290265.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Musca 
domestica]
Length=2804

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = -1

Query  658   QWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  491
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1158  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1210

Query  490   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  317
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1211  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1268

Query  316   IT-GPNPLLPFRFFRIVMTG  260
             I   P+    FR  RI   G
Sbjct  1269  IVCAPDENQGFRHIRIQQNG  1288



>ref|XP_005178040.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Musca 
domestica]
Length=2792

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = -1

Query  658   QWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  491
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1146  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1198

Query  490   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  317
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1199  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1256

Query  316   IT-GPNPLLPFRFFRIVMTG  260
             I   P+    FR  RI   G
Sbjct  1257  IVCAPDENQGFRHIRIQQNG  1276



>ref|XP_011290263.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Musca 
domestica]
Length=2848

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = -1

Query  658   QWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  491
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1202  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1254

Query  490   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  317
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1255  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1312

Query  316   IT-GPNPLLPFRFFRIVMTG  260
             I   P+    FR  RI   G
Sbjct  1313  IVCAPDENQGFRHIRIQQNG  1332



>ref|XP_011290264.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Musca 
domestica]
Length=2836

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = -1

Query  658   QWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  491
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1190  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1242

Query  490   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  317
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1243  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1300

Query  316   IT-GPNPLLPFRFFRIVMTG  260
             I   P+    FR  RI   G
Sbjct  1301  IVCAPDENQGFRHIRIQQNG  1320



>ref|XP_005178039.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Musca 
domestica]
Length=2847

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = -1

Query  658   QWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  491
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1201  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1253

Query  490   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  317
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1254  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1311

Query  316   IT-GPNPLLPFRFFRIVMTG  260
             I   P+    FR  RI   G
Sbjct  1312  IVCAPDENQGFRHIRIQQNG  1331



>ref|XP_011406508.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Amphimedon 
queenslandica]
Length=2146

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 17/170 (10%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++     WVNP     V V++S     P+    D   ++ R+    + A    +D + +
Sbjct  1018  GSNARTCDWVNPAAHHIVVVSSSDGRILPYGNLDD---ILCRD---DTPANCHTKD-DRN  1070

Query  511   SWWMIDLGYDHQLMCNYYTIRQD---GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  341
             SW+ +D G        +Y++R     G+R+ +RSW+FQ S DGV WT +  H +D ++ +
Sbjct  1071  SWFAVDTGV--WFFPTHYSLRHSRGYGNRSALRSWDFQVSKDGVTWTTVYSHVNDNSLNE  1128

Query  340   PGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  191
             PG  ASW ++ P     +R  R+++TGP       +   +  LE+YG  R
Sbjct  1129  PGSTASWSLSPPTDPEGWRHLRLILTGPNASGHTHY-LSLSGLEVYGEVR  1177



>ref|XP_005842130.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
 gb|EKX55150.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
Length=111

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = -1

Query  514  SSWWMIDLGYDHQLMCNYYTIRQDG--SRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  341
            S W  +DLG    L+   Y+I      S   MRSW F+GS +  +W  LR H +D  +  
Sbjct  1    SPWLAVDLGEGRGLIATAYSIMHGSGSSSNAMRSWRFEGSNNKNSWITLREHLNDPRMQT  60

Query  340  PGQFASWPITGPNP----LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  194
            PGQ  ++ +   +     L  FR+FRI++TGP +   N +  C C LELYG +
Sbjct  61   PGQVETFFLHNLDKEVTRLQAFRYFRILLTGPNSS--NFFRLCACRLELYGRY  111



>ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
 gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
Length=2686

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 76/142 (54%), Gaps = 16/142 (11%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             + +WVNP     V VT+S     P+ R  D   ++SR+   +S       D +  +W+ I
Sbjct  1101  SSEWVNPAQYGLVMVTSSDGRNLPYGRLED---ILSRD---SSALNCHTND-DRKAWFAI  1153

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    L+ + YTIR  +   R+ +R+W FQ S DGVNWT L  H DD ++ +PG  AS
Sbjct  1154  DLGL--WLIPSCYTIRHARGYGRSALRNWLFQVSKDGVNWTTLYTHTDDTSLNEPGSTAS  1211

Query  322   WPITGP-NPLLPFRFFRIVMTG  260
             WP+  P +    +R  R+  TG
Sbjct  1212  WPLDPPLDETQGWRHVRLQQTG  1233



>ref|XP_003288046.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
 gb|EGC35433.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
Length=602

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 14/162 (9%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
             T     +W NP L+ ++ +T+SS         V ++ N    +F    V     +SW M
Sbjct  443  STDGNKEKWSNPHLTSKIKITSSSVDKGNLHDIVEITPN----AFWTKDVP----ASWVM  494

Query  499  IDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  326
            ID+G +  ++ +YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       
Sbjct  495  IDVGPNRSVVPHYYTIRHGLSFKSDSLRTWDFQGSTNGEQWTVLKRHTNDLSLNFKYATH  554

Query  325  SWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
            SWPITG      +R+FRI+ TG  ++  N     I  +E+YG
Sbjct  555  SWPITGCET--AYRYFRILQTGKNSNNRN--FLVIGGIEIYG  592



>ref|XP_004909451.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2562

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864091.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2563

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007063755.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Chelonia mydas]
Length=2577

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WPI  P
Sbjct  1198  WPIDPP  1203



>ref|XP_007429074.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Python 
bivittatus]
Length=2523

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004864090.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2608

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004909448.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004909449.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
 gb|EHB18581.1| E3 ubiquitin-protein ligase HECTD1 [Heterocephalus glaber]
Length=2609

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864088.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004864089.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
Length=2610

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007429075.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Python 
bivittatus]
Length=2509

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004909450.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2607

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_010631867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fukomys 
damarensis]
Length=2331

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010631866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Fukomys 
damarensis]
Length=2563

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>gb|EMP32200.1| E3 ubiquitin-protein ligase HECTD1 [Chelonia mydas]
Length=2610

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1127  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1179

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1180  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1237

Query  322   WPITGP  305
             WPI  P
Sbjct  1238  WPIDPP  1243



>ref|XP_007429073.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Python 
bivittatus]
Length=2570

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005196337.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bos 
taurus]
Length=1507

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010333269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Saimiri 
boliviensis boliviensis]
Length=2331

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_010333268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Saimiri 
boliviensis boliviensis]
Length=2563

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_008162333.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chrysemys 
picta bellii]
Length=2523

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_009909049.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Picoides pubescens]
Length=2570

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WPI  P
Sbjct  1198  WPIDPP  1203



>ref|XP_005196336.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bos 
taurus]
Length=1739

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006116431.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pelodiscus 
sinensis]
Length=2529

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1145

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  322   WPITGP  305
             WP+  P
Sbjct  1204  WPVDPP  1209



>ref|XP_006116433.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Pelodiscus 
sinensis]
Length=2523

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_008267702.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Oryctolagus 
cuniculus]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011222356.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Ailuropoda 
melanoleuca]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010845303.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bison 
bison bison]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010372961.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Rhinopithecus 
roxellana]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_009004155.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Callithrix 
jacchus]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007984591.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chlorocebus 
sabaeus]
 ref|XP_009425898.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Pan 
troglodytes]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056670.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bubalus 
bubalis]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007098141.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Panthera 
tigris altaica]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377022.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chinchilla 
lanigera]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005222132.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X10 [Bos 
taurus]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005695269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Capra 
hircus]
Length=2561

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011374706.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pteropus 
vampyrus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011222354.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ailuropoda 
melanoleuca]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010845301.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bison 
bison bison]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010372959.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Rhinopithecus 
roxellana]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_009004153.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Callithrix 
jacchus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056667.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bubalus 
bubalis]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005695268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Capra 
hircus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377019.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chinchilla 
lanigera]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004467983.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 3 [Dasypus 
novemcinctus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005881051.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
brandtii]
 ref|XP_006085914.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Myotis 
lucifugus]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056669.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bubalus 
bubalis]
Length=2502

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005695270.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Capra 
hircus]
Length=2502

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010961314.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Camelus 
bactrianus]
Length=2553

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006085913.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Myotis 
lucifugus]
Length=2561

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005881050.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Myotis 
brandtii]
Length=2561

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010586873.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Loxodonta 
africana]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006085912.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
lucifugus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005881054.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Myotis 
brandtii]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755201.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Mustela 
putorius furo]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004801249.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Mustela putorius 
furo]
Length=2566

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010961316.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Camelus 
bactrianus]
Length=2321

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755203.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Mustela 
putorius furo]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004055105.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Gorilla gorilla 
gorilla]
Length=2520

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1029  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1081

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1082  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1139

Query  322   WPITGP  305
             WP+  P
Sbjct  1140  WPLDPP  1145



>ref|XP_001969437.1| GG23957 [Drosophila erecta]
 gb|EDV58496.1| GG23957 [Drosophila erecta]
Length=2724

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/147 (33%), Positives = 75/147 (51%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++     WVNP     V VT+S     P+ +  D   ++SR+    S +       N  
Sbjct  1139  GSNAKTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKK  1191

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +P
Sbjct  1192  AWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSLVEP  1249

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPIT   +  + +R  RI   G
Sbjct  1250  GSTATWPITCATDDSVRYRHIRIQQNG  1276



>ref|XP_006056668.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bubalus 
bubalis]
Length=2561

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377020.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chinchilla 
lanigera]
Length=2561

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008972942.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
paniscus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007098140.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Panthera 
tigris altaica]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005267560.2| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Homo 
sapiens]
 ref|XP_007984589.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chlorocebus 
sabaeus]
 ref|XP_009247279.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pongo 
abelii]
 ref|XP_009425896.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
troglodytes]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005222130.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Bos 
taurus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005285367.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chrysemys 
picta bellii]
Length=2509

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_005285366.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Chrysemys 
picta bellii]
Length=2570

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPVDPP  1203



>gb|ELK17058.1| E3 ubiquitin-protein ligase HECTD1 [Pteropus alecto]
Length=2489

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1050  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1102

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1103  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1160

Query  322   WPITGP  305
             WP+  P
Sbjct  1161  WPLDPP  1166



>ref|XP_008267700.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Oryctolagus 
cuniculus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008565372.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Galeopterus 
variegatus]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_635359.1| hypothetical protein DDB_G0291147 [Dictyostelium discoideum AX4]
 gb|EAL61857.1| hypothetical protein DDB_G0291147 [Dictyostelium discoideum AX4]
Length=938

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 55/162 (34%), Positives = 76/162 (47%), Gaps = 14/162 (9%)
 Frame = -1

Query  679  GTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWM  500
            GT+ G  +W NP L  RV V  SS         V+   N   + F    V     +SW  
Sbjct  779  GTNGGKEEWSNPALRGRVRVACSSQ----EKGSVIDCFNRTSSEFWSMDVP----ASWIS  830

Query  499  IDLGYDHQLMCNYYTIRQDG-SRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFA  326
            ++LG    ++   YT+R  G S+A  +R+W  QGS D  NWT L  H +D ++       
Sbjct  831  VNLGSSRTMVPTCYTLRHGGNSKADCLRNWTLQGSMDSKNWTVLVRHSNDASLNGNFSTC  890

Query  325  SWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
            SWPI  PN    +R FRI+ TG  +   N  +  I  +E YG
Sbjct  891  SWPI--PNCTQAYRHFRILQTGRNSSNHNFLS--ISGIEFYG  928



>ref|XP_010631865.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Fukomys 
damarensis]
Length=2608

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010631864.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fukomys 
damarensis]
 gb|KFO29273.1| E3 ubiquitin-protein ligase HECTD1 [Fukomys damarensis]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007113428.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Physeter 
catodon]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007472588.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Monodelphis 
domestica]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_003924275.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010333266.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_007660828.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Ornithorhynchus 
anatinus]
Length=2522

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007660814.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ornithorhynchus 
anatinus]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007472586.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Monodelphis 
domestica]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010333267.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Saimiri 
boliviensis boliviensis]
Length=2608

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_002089068.1| GE26196 [Drosophila yakuba]
 gb|EDW88780.1| GE26196 [Drosophila yakuba]
Length=2725

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/147 (33%), Positives = 75/147 (51%), Gaps = 16/147 (11%)
 Frame = -1

Query  679   GTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNIS  512
             G++     WVNP     V VT+S     P+ +  D   ++SR+    S +       N  
Sbjct  1140  GSNAKTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD----SISLNCHTKDNKK  1192

Query  511   SWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKP  338
             +W+ IDLG    ++   YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +P
Sbjct  1193  AWFAIDLGV--YIIPTAYTLRHARGYGRSALRNWLLQGSKDGLTWTTLSTHVDDKSLVEP  1250

Query  337   GQFASWPIT-GPNPLLPFRFFRIVMTG  260
             G  A+WPIT   +  + +R  RI   G
Sbjct  1251  GSTATWPITCATDDSVRYRHIRIQQNG  1277



>ref|XP_004755202.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Mustela 
putorius furo]
Length=2549

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006766087.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Myotis davidii]
Length=2598

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008565371.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Galeopterus 
variegatus]
Length=2172

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664  AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
            A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  696  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  748

Query  496  DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
            DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  749  DLGL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  806

Query  322  WPITGP  305
            WP+  P
Sbjct  807  WPLDPP  812



>ref|XP_005196334.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
 ref|XP_877459.4| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
Length=1786

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004467984.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 4 [Dasypus 
novemcinctus]
Length=2549

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755200.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Mustela 
putorius furo]
Length=2608

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755199.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Mustela 
putorius furo]
Length=2609

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005881052.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Myotis 
brandtii]
 ref|XP_005881053.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Myotis 
brandtii]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004376588.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Trichechus manatus 
latirostris]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>gb|ELW63202.1| E3 ubiquitin-protein ligase HECTD1 [Tupaia chinensis]
Length=2543

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010586874.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Loxodonta 
africana]
Length=2549

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010961313.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Camelus 
bactrianus]
Length=2600

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007516893.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Erinaceus europaeus]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755198.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Mustela 
putorius furo]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_850301.2| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
isoform 1 [Canis lupus familiaris]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005196335.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bos 
taurus]
Length=1784

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006116430.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pelodiscus 
sinensis]
Length=2570

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_006116432.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Pelodiscus 
sinensis]
Length=2502

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1145

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  322   WPITGP  305
             WP+  P
Sbjct  1204  WPVDPP  1209



>ref|XP_010214811.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Tinamus 
guttatus]
Length=2523

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008101614.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X7 [Anolis 
carolinensis]
Length=2529

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1145

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1204  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1244



>ref|XP_006116428.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pelodiscus 
sinensis]
 ref|XP_006116429.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Pelodiscus 
sinensis]
Length=2576

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1145

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  322   WPITGP  305
             WP+  P
Sbjct  1204  WPVDPP  1209



>ref|XP_011281667.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Felis catus]
Length=2509

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_003792055.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Otolemur garnettii]
Length=2538

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011222355.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Ailuropoda 
melanoleuca]
Length=2549

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010845302.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bison 
bison bison]
Length=2549

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010372960.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Rhinopithecus 
roxellana]
Length=2549

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_009004154.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Callithrix 
jacchus]
Length=2549

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007984590.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Chlorocebus 
sabaeus]
 ref|XP_009247280.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pongo 
abelii]
 ref|XP_009425897.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pan 
troglodytes]
Length=2549

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377021.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Chinchilla 
lanigera]
Length=2549

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004637178.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Octodon degus]
Length=2586

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010984469.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Camelus dromedarius]
Length=2597

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011374703.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pteropus 
vampyrus]
 ref|XP_011374704.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pteropus 
vampyrus]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006890036.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Elephantulus edwardii]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006085911.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Myotis 
lucifugus]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004584798.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ochotona princeps]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_003408766.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Loxodonta 
africana]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>sp|Q9ULT8.3|HECD1_HUMAN RecName: Full=E3 ubiquitin-protein ligase HECTD1; AltName: Full=E3 
ligase for inhibin receptor; AltName: Full=EULIR; AltName: 
Full=HECT domain-containing protein 1 [Homo sapiens]
 gb|AAI72391.1| HECT domain containing 1 [synthetic construct]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_009288642.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X11 [Aptenodytes 
forsteri]
Length=2523

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008101615.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Anolis 
carolinensis]
Length=2523

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008101612.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Anolis 
carolinensis]
Length=2544

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1108  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1160

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1161  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1218

Query  322   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  200
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1219  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1259



>ref|XP_009288638.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X7 [Aptenodytes 
forsteri]
Length=2548

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1112  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1164

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1165  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1222

Query  322   WPITGP  305
             WP+  P
Sbjct  1223  WPLDPP  1228



>ref|XP_008972943.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pan 
paniscus]
Length=2549

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011374705.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Pteropus 
vampyrus]
Length=2608

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_009004152.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Callithrix 
jacchus]
Length=2608

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004467982.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 2 [Dasypus 
novemcinctus]
Length=2608

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010372956.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010372957.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Rhinopithecus 
roxellana]
Length=2610

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_002918561.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Ailuropoda 
melanoleuca]
 gb|EFB13214.1| hypothetical protein PANDA_007038 [Ailuropoda melanoleuca]
Length=2610

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056666.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bubalus 
bubalis]
Length=2610

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006906925.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Pteropus alecto]
Length=2610

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -1

Query  664   AHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  497
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  496   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  323
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  322   WPITGP  305
             WP+  P
Sbjct  1198  WPLDPP  1203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060