BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028B07

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346696.1|  PREDICTED: methylthioribose-1-phosphate isom...    248   2e-76   Solanum tuberosum [potatoes]
ref|XP_009627128.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   7e-74   Nicotiana tomentosiformis
ref|XP_004244859.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   9e-74   Solanum lycopersicum
ref|XP_009781605.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   1e-73   Nicotiana sylvestris
ref|XP_010467106.1|  PREDICTED: methylthioribose-1-phosphate isom...    241   2e-73   Camelina sativa [gold-of-pleasure]
ref|NP_001077883.1|  methylthioribose-1-phosphate isomerase             237   8e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973428.1|  methylthioribose-1-phosphate isomerase                237   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65143.1|  putative translation initiation factor eIF-2B alp...    238   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_027726.1|  methylthioribose-1-phosphate isomerase                237   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488779.1|  PREDICTED: methylthioribose-1-phosphate isom...    236   8e-72   Camelina sativa [gold-of-pleasure]
gb|EYU28322.1|  hypothetical protein MIMGU_mgv1a008441mg                235   2e-71   Erythranthe guttata [common monkey flower]
gb|KFK39882.1|  hypothetical protein AALP_AA3G300900                    234   3e-71   Arabis alpina [alpine rockcress]
ref|XP_002883712.1|  eukaryotic translation initiation factor 2B ...    234   3e-71   
ref|XP_010412762.1|  PREDICTED: methylthioribose-1-phosphate isom...    233   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006396133.1|  hypothetical protein EUTSA_v10002579mg             233   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009102357.1|  PREDICTED: methylthioribose-1-phosphate isom...    232   3e-70   Brassica rapa
emb|CDY33397.1|  BnaA07g04420D                                          232   3e-70   Brassica napus [oilseed rape]
emb|CDY70356.1|  BnaCnng67980D                                          232   4e-70   Brassica napus [oilseed rape]
ref|XP_008242258.1|  PREDICTED: methylthioribose-1-phosphate isom...    231   6e-70   Prunus mume [ume]
ref|XP_007202151.1|  hypothetical protein PRUPE_ppa007089mg             231   7e-70   Prunus persica
ref|XP_009337200.1|  PREDICTED: methylthioribose-1-phosphate isom...    229   3e-69   Pyrus x bretschneideri [bai li]
ref|XP_004166700.1|  PREDICTED: methylthioribose-1-phosphate isom...    227   5e-69   
ref|XP_008388900.1|  PREDICTED: methylthioribose-1-phosphate isom...    229   6e-69   
gb|KJB82985.1|  hypothetical protein B456_013G223100                    226   8e-69   Gossypium raimondii
gb|KHG04432.1|  Methylthioribose-1-phosphate isomerase                  228   2e-68   Gossypium arboreum [tree cotton]
ref|XP_008450940.1|  PREDICTED: methylthioribose-1-phosphate isom...    227   3e-68   Cucumis melo [Oriental melon]
emb|CDP03069.1|  unnamed protein product                                226   4e-68   Coffea canephora [robusta coffee]
gb|KGN66312.1|  hypothetical protein Csa_1G597100                       226   5e-68   Cucumis sativus [cucumbers]
ref|XP_004144039.1|  PREDICTED: methylthioribose-1-phosphate isom...    227   5e-68   
ref|XP_007012613.1|  NagB/RpiA/CoA transferase-like superfamily p...    228   5e-68   
gb|KJB82983.1|  hypothetical protein B456_013G223100                    225   6e-68   Gossypium raimondii
gb|KDP33930.1|  hypothetical protein JCGZ_07501                         226   9e-68   Jatropha curcas
ref|XP_006280656.1|  hypothetical protein CARUB_v10026616mg             225   1e-67   Capsella rubella
gb|KJB82981.1|  hypothetical protein B456_013G223100                    226   1e-67   Gossypium raimondii
ref|XP_011078119.1|  PREDICTED: methylthioribose-1-phosphate isom...    225   1e-67   Sesamum indicum [beniseed]
ref|XP_010090181.1|  Methylthioribose-1-phosphate isomerase             224   2e-67   Morus notabilis
ref|XP_004287647.1|  PREDICTED: methylthioribose-1-phosphate isom...    224   4e-67   Fragaria vesca subsp. vesca
ref|XP_010930603.1|  PREDICTED: methylthioribose-1-phosphate isom...    224   4e-67   
ref|XP_008337840.1|  PREDICTED: methylthioribose-1-phosphate isom...    224   4e-67   
ref|XP_010047466.1|  PREDICTED: methylthioribose-1-phosphate isom...    224   6e-67   Eucalyptus grandis [rose gum]
ref|XP_009359722.1|  PREDICTED: methylthioribose-1-phosphate isom...    223   8e-67   Pyrus x bretschneideri [bai li]
ref|XP_008786516.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    222   2e-66   Phoenix dactylifera
ref|XP_002516257.1|  Methylthioribose-1-phosphate isomerase, puta...    222   3e-66   Ricinus communis
ref|XP_010666847.1|  PREDICTED: methylthioribose-1-phosphate isom...    221   6e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW79381.1|  hypothetical protein EUGRSUZ_C00793                     223   9e-66   Eucalyptus grandis [rose gum]
ref|XP_002308521.2|  eukaryotic translation initiation factor 2B ...    220   1e-65   
ref|XP_011019339.1|  PREDICTED: methylthioribose-1-phosphate isom...    220   2e-65   Populus euphratica
ref|XP_010261799.1|  PREDICTED: methylthioribose-1-phosphate isom...    219   2e-65   Nelumbo nucifera [Indian lotus]
gb|AFK33839.1|  unknown                                                 213   2e-65   Lotus japonicus
ref|XP_004488081.1|  PREDICTED: methylthioribose-1-phosphate isom...    219   5e-65   Cicer arietinum [garbanzo]
gb|AES65569.2|  methylthioribose-1-phosphate isomerase                  218   6e-65   Medicago truncatula
gb|KHN12290.1|  Methylthioribose-1-phosphate isomerase                  218   7e-65   Glycine soja [wild soybean]
ref|XP_002277806.1|  PREDICTED: methylthioribose-1-phosphate isom...    216   6e-64   Vitis vinifera
emb|CBI27788.3|  unnamed protein product                                216   2e-63   Vitis vinifera
ref|XP_006474713.1|  PREDICTED: methylthioribose-1-phosphate isom...    213   5e-63   Citrus sinensis [apfelsine]
ref|XP_006452822.1|  hypothetical protein CICLE_v10008682mg             213   8e-63   Citrus clementina [clementine]
ref|XP_007138649.1|  hypothetical protein PHAVU_009G226400g             213   9e-63   Phaseolus vulgaris [French bean]
ref|XP_004979099.1|  PREDICTED: methylthioribose-1-phosphate isom...    212   2e-62   Setaria italica
ref|XP_003595318.1|  Methylthioribose-1-phosphate isomerase             210   9e-62   
gb|KDO73876.1|  hypothetical protein CISIN_1g017293mg                   209   3e-61   Citrus sinensis [apfelsine]
gb|EMS50123.1|  Methylthioribose-1-phosphate isomerase                  207   2e-60   Triticum urartu
ref|XP_003577698.1|  PREDICTED: methylthioribose-1-phosphate isom...    206   3e-60   Brachypodium distachyon [annual false brome]
gb|ADE77025.1|  unknown                                                 206   5e-60   Picea sitchensis
gb|KJB82984.1|  hypothetical protein B456_013G223100                    204   2e-59   Gossypium raimondii
ref|XP_006662829.1|  PREDICTED: methylthioribose-1-phosphate isom...    203   3e-59   Oryza brachyantha
ref|XP_009406483.1|  PREDICTED: methylthioribose-1-phosphate isom...    203   4e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007012614.1|  NagB/RpiA/CoA transferase-like superfamily p...    205   5e-59   
ref|XP_001754539.1|  predicted protein                                  202   6e-59   
sp|B6TZD1.1|MTNA_MAIZE  RecName: Full=Methylthioribose-1-phosphat...    201   2e-58   Zea mays [maize]
ref|XP_010541997.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    201   2e-58   Tarenaya hassleriana [spider flower]
gb|EMT32201.1|  Methylthioribose-1-phosphate isomerase                  203   2e-58   
dbj|BAJ86257.1|  predicted protein                                      201   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q9AYT7.1|MTNA_HORVU  RecName: Full=Methylthioribose-1-phosphat...    201   3e-58   Hordeum vulgare [barley]
ref|NP_001105275.1|  methylthioribose-1-phosphate isomerase             199   8e-58   
gb|ACG37871.1|  methylthioribose-1-phosphate isomerase                  199   1e-57   Zea mays [maize]
ref|NP_001067511.1|  Os11g0216900                                       199   2e-57   
sp|A2ZCP0.1|MTNA_ORYSI  RecName: Full=Methylthioribose-1-phosphat...    198   3e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_006842716.1|  hypothetical protein AMTR_s00147p00099160          196   3e-56   Amborella trichopoda
gb|ABA92066.2|  Initiation factor 2 subunit family protein, expre...    197   9e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992382.1|  hypothetical protein SELMODRAFT_135203             194   2e-55   
ref|XP_002967758.1|  hypothetical protein SELMODRAFT_87975              194   2e-55   
gb|KDO73879.1|  hypothetical protein CISIN_1g017293mg                   192   3e-55   Citrus sinensis [apfelsine]
ref|XP_006452823.1|  hypothetical protein CICLE_v10008682mg             192   3e-55   
gb|KJB07314.1|  hypothetical protein B456_001G015800                    190   1e-54   Gossypium raimondii
gb|EPS64192.1|  methylthioribose-1-phosphate isomerase                  187   3e-53   Genlisea aurea
emb|CBV37018.1|  5-methylthioribose-1-phosphate isomerase               170   1e-48   Plantago major [cart-track plant]
gb|KHG23802.1|  Methylthioribose-1-phosphate isomerase                  167   3e-47   Gossypium arboreum [tree cotton]
ref|XP_004993054.1|  methylthioribose-1-phosphate isomerase             171   8e-47   Salpingoeca rosetta
ref|XP_001742754.1|  hypothetical protein                               169   2e-46   Monosiga brevicollis MX1
gb|KJB07315.1|  hypothetical protein B456_001G015800                    158   1e-42   Gossypium raimondii
gb|EHJ70136.1|  eIF2B-alpha-like protein                                159   2e-42   
ref|XP_011184740.1|  PREDICTED: methylthioribose-1-phosphate isom...    158   4e-42   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_002072272.1|  GK22419                                            158   5e-42   Drosophila willistoni
ref|XP_004530069.1|  PREDICTED: methylthioribose-1-phosphate isom...    157   9e-42   Ceratitis capitata [medfly]
ref|XP_011210381.1|  PREDICTED: methylthioribose-1-phosphate isom...    157   1e-41   Bactrocera dorsalis [papaya fruit fly]
ref|NP_001037650.1|  methylthioribose-1-phosphate isomerase             157   1e-41   Bombyx mori [silk moth]
ref|XP_001357949.1|  GA10928                                            156   2e-41   Drosophila pseudoobscura pseudoobscura
ref|XP_002023756.1|  GL27236                                            156   2e-41   Drosophila persimilis
ref|XP_005185612.1|  PREDICTED: methylthioribose-1-phosphate isom...    156   2e-41   Musca domestica
emb|CDS04006.1|  hypothetical protein LRAMOSA06961                      156   3e-41   Lichtheimia ramosa
ref|XP_001418690.1|  predicted protein                                  155   4e-41   Ostreococcus lucimarinus CCE9901
emb|CEF98703.1|  Putative translation initiation factor,aIF-2BI/5...    160   5e-41   Ostreococcus tauri
ref|XP_001641945.1|  predicted protein                                  155   6e-41   Nematostella vectensis
ref|XP_001953494.1|  GF17194                                            155   7e-41   Drosophila ananassae
ref|WP_027718288.1|  methylthioribose-1-phosphate isomerase             154   7e-41   Desulfovirgula thermocuniculi
ref|XP_006396132.1|  hypothetical protein EUTSA_v10002579mg             154   9e-41   
ref|XP_001993776.1|  GH21593                                            154   1e-40   Drosophila grimshawi
emb|CAD27760.1|  putative translation initiation factor                 154   1e-40   Anopheles gambiae
ref|XP_011143671.1|  PREDICTED: methylthioribose-1-phosphate isom...    154   1e-40   Harpegnathos saltator
ref|XP_321518.1|  AGAP001589-PA                                         154   1e-40   Anopheles gambiae str. PEST
ref|XP_011052943.1|  PREDICTED: methylthioribose-1-phosphate isom...    154   2e-40   Acromyrmex echinatior
emb|CBY10943.1|  unnamed protein product                                153   2e-40   Oikopleura dioica
ref|XP_002001025.1|  GI10562                                            154   2e-40   Drosophila mojavensis
ref|XP_002054225.1|  GJ22917                                            154   2e-40   Drosophila virilis
emb|CDH49387.1|  methylthioribose-1-phosphate isomerase                 154   3e-40   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006560809.1|  PREDICTED: methylthioribose-1-phosphate isom...    153   3e-40   
ref|XP_002037477.1|  GM12085                                            153   3e-40   Drosophila sechellia
ref|WP_015263041.1|  methylthioribose-1-phosphate isomerase             152   4e-40   Desulfitobacterium dichloroeliminans
ref|XP_002105622.1|  GD16414                                            153   4e-40   
ref|XP_001943893.1|  PREDICTED: methylthioribose-1-phosphate isom...    153   4e-40   Acyrthosiphon pisum
ref|XP_002424016.1|  conserved hypothetical protein                     153   4e-40   Pediculus humanus corporis [human body lice]
ref|XP_969152.1|  PREDICTED: methylthioribose-1-phosphate isomerase     153   4e-40   Tribolium castaneum [rust-red flour beetle]
ref|XP_006621214.1|  PREDICTED: methylthioribose-1-phosphate isom...    152   4e-40   Apis dorsata [rock honeybee]
ref|XP_392553.1|  PREDICTED: methylthioribose-1-phosphate isomera...    153   4e-40   Apis mellifera [bee]
ref|XP_002099512.1|  GE23315                                            153   4e-40   Drosophila yakuba
ref|NP_651868.1|  CG11334, isoform B                                    153   4e-40   Drosophila melanogaster
ref|XP_001981082.1|  GG11866                                            153   5e-40   Drosophila erecta
gb|AEE61699.1|  unknown                                                 152   5e-40   Dendroctonus ponderosae
gb|KDR24083.1|  Methylthioribose-1-phosphate isomerase                  152   5e-40   Zootermopsis nevadensis
gb|ETN63911.1|  translation initiation factor eif-2b                    152   5e-40   Anopheles darlingi [American malaria mosquito]
gb|EHL06398.1|  S-methyl-5-thioribose-1-phosphate isomerase             152   5e-40   Desulfitobacterium hafniense DP7
gb|KHN06061.1|  Methylthioribose-1-phosphate isomerase                  149   6e-40   Glycine soja [wild soybean]
ref|WP_005998427.1|  methylthioribose-1-phosphate isomerase             152   6e-40   Desulfuromonas acetoxidans
ref|XP_006621213.1|  PREDICTED: methylthioribose-1-phosphate isom...    152   7e-40   Apis dorsata [rock honeybee]
ref|WP_018210953.1|  methylthioribose-1-phosphate isomerase             152   7e-40   Desulfitobacterium hafniense
ref|WP_035214189.1|  methylthioribose-1-phosphate isomerase             152   7e-40   Desulfitobacterium hafniense
ref|WP_015944768.1|  methylthioribose-1-phosphate isomerase             152   7e-40   Desulfitobacterium hafniense
ref|WP_011460451.1|  methylthioribose-1-phosphate isomerase             152   8e-40   Desulfitobacterium hafniense
ref|XP_001604505.1|  PREDICTED: methylthioribose-1-phosphate isom...    152   9e-40   Nasonia vitripennis
gb|KJE93735.1|  translation initiation factor eif-2b                    152   1e-39   Capsaspora owczarzaki ATCC 30864
ref|XP_003080319.1|  methylthioribose kinase (ISS)                      158   1e-39   
ref|WP_042225012.1|  methylthioribose-1-phosphate isomerase             151   1e-39   Leptospirillum sp. Group II 'CF-1'
gb|AFS53499.1|  translation initiation factor, aIF-2BI/5-methylth...    151   1e-39   Leptospirillum ferriphilum ML-04
ref|WP_011878387.1|  methylthioribose-1-phosphate isomerase             151   1e-39   Desulfotomaculum reducens
ref|XP_002500043.1|  translation initiation factor fusion with me...    156   1e-39   Micromonas commoda
gb|EAY56266.1|  translation initiation factor, aIF-2BI/5-methylth...    151   1e-39   Leptospirillum rubarum
gb|EDZ38932.1|  Translation initiation factor, aIF-2BI/5- methylt...    151   1e-39   Leptospirillum sp. Group II '5-way CG'
gb|KGA93509.1|  Methylthioribose-1-phosphate isomerase                  151   1e-39   Leptospirillum ferriphilum
gb|ERL94382.1|  hypothetical protein D910_11661                         153   1e-39   Dendroctonus ponderosae
ref|XP_003726311.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    152   1e-39   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003697763.1|  PREDICTED: methylthioribose-1-phosphate isom...    151   1e-39   
ref|WP_027356529.1|  methylthioribose-1-phosphate isomerase             151   2e-39   Desulfofundulus thermocisternus
ref|WP_002650338.1|  methylthioribose-1-phosphate isomerase             151   2e-39   Blastopirellula marina
ref|XP_003700639.1|  PREDICTED: methylthioribose-1-phosphate isom...    151   2e-39   Megachile rotundata
ref|XP_004348313.2|  translation initiation factor eif-2b               152   2e-39   Capsaspora owczarzaki ATCC 30864
ref|XP_003760740.1|  PREDICTED: methylthioribose-1-phosphate isom...    151   2e-39   Sarcophilus harrisii
gb|EFN81802.1|  Translation initiation factor eIF-2B subunit alph...    151   2e-39   Harpegnathos saltator
emb|CBY31516.1|  unnamed protein product                                150   3e-39   Oikopleura dioica
ref|XP_008546891.1|  PREDICTED: methylthioribose-1-phosphate isom...    150   3e-39   Microplitis demolitor
ref|XP_001366752.1|  PREDICTED: methylthioribose-1-phosphate isom...    150   4e-39   Monodelphis domestica
ref|XP_661894.1|  hypothetical protein AN4290.2                         150   4e-39   Aspergillus nidulans FGSC A4
ref|XP_005648557.1|  hypothetical protein COCSUDRAFT_65695              157   5e-39   Coccomyxa subellipsoidea C-169
ref|XP_003389526.1|  PREDICTED: methylthioribose-1-phosphate isom...    150   5e-39   Amphimedon queenslandica
gb|EDL92228.1|  similar to hypothetical protein MGC3207, isoform ...    145   5e-39   Rattus norvegicus [brown rat]
ref|WP_041772593.1|  methylthioribose-1-phosphate isomerase             149   5e-39   
ref|WP_036082877.1|  methylthioribose-1-phosphate isomerase             149   5e-39   
ref|XP_006003718.1|  PREDICTED: methylthioribose-1-phosphate isom...    150   5e-39   Latimeria chalumnae
ref|WP_014795021.1|  MULTISPECIES: methylthioribose-1-phosphate i...    149   5e-39   Desulfitobacterium
ref|WP_038506986.1|  methylthioribose-1-phosphate isomerase             149   6e-39   
ref|NP_001090076.1|  methylthioribose-1-phosphate isomerase             150   6e-39   Xenopus laevis [clawed frog]
gb|AII98097.1|  BLTX771                                                 147   7e-39   Nephila pilipes
ref|XP_001664017.1|  AAEL013828-PA                                      149   8e-39   
sp|Q0VFN1.1|MTNA_XENTR  RecName: Full=Methylthioribose-1-phosphat...    149   1e-38   Xenopus tropicalis [western clawed frog]
ref|XP_003397603.1|  PREDICTED: methylthioribose-1-phosphate isom...    149   1e-38   Bombus terrestris [large earth bumblebee]
ref|XP_003486247.1|  PREDICTED: methylthioribose-1-phosphate isom...    149   1e-38   Bombus impatiens
ref|NP_001016877.1|  methylthioribose-1-phosphate isomerase             149   1e-38   Xenopus tropicalis [western clawed frog]
ref|WP_024545108.1|  methylthioribose-1-phosphate isomerase             149   1e-38   Synechococcus sp. NKBG15041c
ref|WP_012910912.1|  methylthioribose-1-phosphate isomerase             149   1e-38   Pirellula staleyi
gb|KFB37657.1|  AGAP001589-PA-like protein                              149   1e-38   Anopheles sinensis
gb|EWM30107.1|  Methylthioribose kinase                                 154   2e-38   Nannochloropsis gaditana
ref|WP_014067125.1|  methylthioribose-1-phosphate isomerase             149   2e-38   Rhodothermus marinus
ref|XP_005855554.1|  methylthioribose-1-phosphate isomerase             154   2e-38   Nannochloropsis gaditana CCMP526
ref|XP_001865446.1|  translation initiation factor eif-2b               148   2e-38   Culex quinquefasciatus
ref|WP_003542966.1|  methylthioribose-1-phosphate isomerase             148   2e-38   Desulfotomaculum nigrificans
ref|XP_001510432.2|  PREDICTED: methylthioribose-1-phosphate isom...    147   2e-38   
ref|WP_013810013.1|  methylthioribose-1-phosphate isomerase             148   2e-38   Desulfotomaculum nigrificans
ref|WP_012843989.1|  methylthioribose-1-phosphate isomerase             148   2e-38   Rhodothermus marinus
ref|WP_014186905.1|  methylthioribose-1-phosphate isomerase             148   2e-38   Desulfosporosinus orientis
ref|WP_018086583.1|  hypothetical protein                               148   2e-38   Desulfurispora thermophila
gb|ADU64905.1|  translation initiation factor, aIF-2BI family           148   2e-38   Desulfurispirillum indicum S5
ref|XP_008049359.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   2e-38   
gb|EQD24052.1|  hypothetical protein D084_Lepto4C00613G0001             147   3e-38   Leptospirillum sp. Group IV 'UBA BS'
ref|WP_041726234.1|  methylthioribose-1-phosphate isomerase             147   3e-38   
ref|XP_003057882.1|  translation initiation factor fusion with me...    152   3e-38   Micromonas pusilla CCMP1545
gb|KIZ04682.1|  isopentenyl-diphosphate Delta-isomerase                 150   3e-38   Monoraphidium neglectum
ref|XP_004688304.1|  PREDICTED: methylthioribose-1-phosphate isom...    147   4e-38   Condylura cristata
ref|WP_040198990.1|  methylthioribose-1-phosphate isomerase             147   4e-38   Geoalkalibacter subterraneus
ref|WP_034610423.1|  methylthioribose-1-phosphate isomerase             147   5e-38   
ref|WP_008411947.1|  Methylthioribose-1-phosphate isomerase             147   6e-38   
ref|WP_015195030.1|  methylthioribose-1-phosphate isomerase             147   6e-38   Stanieria cyanosphaera
ref|WP_030007368.1|  methylthioribose-1-phosphate isomerase             147   6e-38   Synechococcus sp. NKBG042902
ref|WP_029717928.1|  methylthioribose-1-phosphate isomerase             147   7e-38   
ref|WP_022245755.1|  methylthioribose-1-phosphate isomerase             147   7e-38   
ref|XP_006139228.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   7e-38   
ref|WP_041443958.1|  methylthioribose-1-phosphate isomerase             146   7e-38   
dbj|BAC33016.1|  unnamed protein product                                147   8e-38   Mus musculus [mouse]
ref|XP_006918814.1|  PREDICTED: methylthioribose-1-phosphate isom...    147   8e-38   Pteropus alecto
ref|XP_011380861.1|  PREDICTED: methylthioribose-1-phosphate isom...    147   9e-38   Pteropus vampyrus
ref|WP_014828515.1|  methylthioribose-1-phosphate isomerase             146   9e-38   Desulfosporosinus acidiphilus
ref|WP_006716525.1|  methylthioribose-1-phosphate isomerase             146   9e-38   Desulfitobacterium metallireducens
ref|XP_008104502.1|  PREDICTED: methylthioribose-1-phosphate isom...    146   1e-37   Anolis carolinensis [Carolina anole]
gb|EHA19257.1|  hypothetical protein ASPNIDRAFT_54270                   147   1e-37   Aspergillus niger ATCC 1015
ref|XP_006779623.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    144   1e-37   
ref|XP_011342004.1|  PREDICTED: methylthioribose-1-phosphate isom...    147   1e-37   Ooceraea biroi
ref|XP_006560811.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   1e-37   
ref|WP_025322587.1|  methylthioribose-1-phosphate isomerase             146   1e-37   
ref|XP_005881674.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    145   1e-37   
ref|XP_003501976.1|  PREDICTED: methylthioribose-1-phosphate isom...    146   1e-37   Cricetulus griseus [Chinese hamsters]
ref|WP_041533752.1|  methylthioribose-1-phosphate isomerase             145   1e-37   
ref|XP_003218379.1|  PREDICTED: methylthioribose-1-phosphate isom...    146   2e-37   Anolis carolinensis [Carolina anole]
ref|XP_006560810.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   2e-37   Apis mellifera [bee]
ref|XP_006993155.1|  PREDICTED: methylthioribose-1-phosphate isom...    146   2e-37   Peromyscus maniculatus bairdii
ref|XP_005310723.1|  PREDICTED: methylthioribose-1-phosphate isom...    146   2e-37   Chrysemys picta bellii
ref|WP_009620316.1|  methylthioribose-1-phosphate isomerase             145   2e-37   Desulfosporosinus sp. OT
sp|A5D1G8.1|MTNA_PELTS  RecName: Full=Methylthioribose-1-phosphat...    146   2e-37   Pelotomaculum thermopropionicum SI
ref|NP_001010947.1|  methylthioribose-1-phosphate isomerase             146   2e-37   Rattus norvegicus [brown rat]
ref|XP_006621216.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   2e-37   Apis dorsata [rock honeybee]
gb|ACB00286.1|  translation initiation factor, putative, aIF-2BI ...    146   2e-37   Synechococcus sp. PCC 7002
ref|XP_011262788.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   2e-37   Camponotus floridanus
ref|NP_080699.3|  methylthioribose-1-phosphate isomerase                146   2e-37   Mus musculus [mouse]
ref|XP_002679019.1|  predicted protein                                  146   2e-37   Naegleria gruberi strain NEG-M
ref|XP_004009303.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    144   2e-37   
ref|XP_006621215.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   2e-37   Apis dorsata [rock honeybee]
gb|EPY88013.1|  hypothetical protein CB1_000201003                      143   3e-37   Camelus ferus
gb|KIL43486.1|  methylthioribose-1-phosphate isomerase                  145   3e-37   Jeotgalibacillus alimentarius
ref|WP_041123830.1|  methylthioribose-1-phosphate isomerase             145   3e-37   
ref|XP_006003719.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   3e-37   Latimeria chalumnae
ref|XP_003798062.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   3e-37   Otolemur garnettii
dbj|GAA90121.1|  translation initiation factor                          145   3e-37   Aspergillus kawachii IFO 4308
ref|WP_021916583.1|  methylthioribose-1-phosphate isomerase             145   3e-37   
gb|EIE81164.1|  S-methyl-5-thioribose-1-phosphate isomerase             145   3e-37   Rhizopus delemar RA 99-880
ref|XP_005370998.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   3e-37   Microtus ochrogaster [prairie voles]
emb|CDM34949.1|  Methylthioribose-1-phosphate isomerase                 145   3e-37   Penicillium roqueforti FM164
ref|XP_006023465.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   3e-37   Alligator sinensis
ref|WP_029420357.1|  methylthioribose-1-phosphate isomerase             145   3e-37   Alicyclobacillus macrosporangiidus
ref|XP_003123394.2|  PREDICTED: methylthioribose-1-phosphate isom...    145   3e-37   
ref|WP_025681854.1|  methylthioribose-1-phosphate isomerase             145   4e-37   Paenibacillus sp. 1-49
dbj|GAN33575.1|  methylthioribose-1-phosphate isomerase                 145   4e-37   Candidatus Brocadia sinica JPN1
ref|XP_006100374.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    145   4e-37   Myotis lucifugus
ref|WP_015185955.1|  methylthioribose-1-phosphate isomerase             145   4e-37   Microcoleus sp. PCC 7113
ref|WP_010936295.1|  methylthioribose-1-phosphate isomerase             144   4e-37   Dehalococcoides mccartyi
ref|XP_005682375.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    144   4e-37   
ref|XP_008156200.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   5e-37   
ref|XP_006262838.1|  PREDICTED: methylthioribose-1-phosphate isom...    145   5e-37   Alligator mississippiensis
ref|XP_005850664.1|  hypothetical protein CHLNCDRAFT_140697             149   5e-37   Chlorella variabilis
ref|XP_009433121.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   5e-37   
ref|XP_007737063.1|  S-methyl-5-thioribose-1-phosphate isomerase        145   6e-37   Capronia epimyces CBS 606.96
gb|KGO76677.1|  Initiation factor 2B alpha/beta/delta                   145   6e-37   Penicillium italicum
emb|CEI86534.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    145   6e-37   Rhizopus microsporus
ref|XP_006206282.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   6e-37   Vicugna pacos
gb|KGO39130.1|  Initiation factor 2B alpha/beta/delta                   145   6e-37   Penicillium expansum
ref|WP_025778541.1|  methylthioribose-1-phosphate isomerase             144   6e-37   
ref|XP_008965945.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    144   6e-37   
ref|XP_002151818.1|  translation initiation factor, putative            145   6e-37   Talaromyces marneffei ATCC 18224
gb|EMF09885.1|  methylthioribose-1-phosphate isomerase                  145   7e-37   Sphaerulina musiva SO2202
ref|WP_041082154.1|  methylthioribose-1-phosphate isomerase             144   7e-37   Thermotoga profunda
ref|WP_031515328.1|  methylthioribose-1-phosphate isomerase             144   7e-37   
ref|WP_012881779.1|  methylthioribose-1-phosphate isomerase             144   7e-37   Dehalococcoides mccartyi
dbj|BAQ34404.1|  putative methylthioribose-1-phosphate isomerase        144   7e-37   Dehalococcoides sp. UCH007
ref|WP_041341462.1|  methylthioribose-1-phosphate isomerase             144   7e-37   Dehalococcoides mccartyi
ref|WP_041330698.1|  methylthioribose-1-phosphate isomerase             144   8e-37   Dehalococcoides mccartyi
ref|WP_031502477.1|  methylthioribose-1-phosphate isomerase             144   8e-37   Pseudothermotoga hypogea
ref|XP_007993676.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   8e-37   Chlorocebus sabaeus
ref|WP_003516545.1|  methylthioribose-1-phosphate isomerase             144   8e-37   Hungateiclostridium thermocellum
gb|EKG14703.1|  Initiation factor 2B-related protein                    144   9e-37   Macrophomina phaseolina MS6
ref|XP_003275654.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   1e-36   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_003915068.2|  PREDICTED: methylthioribose-1-phosphate isom...    144   1e-36   Papio anubis [baboon]
ref|WP_022457447.1|  methylthioribose-1-phosphate isomerase             144   1e-36   
ref|WP_013841815.1|  methylthioribose-1-phosphate isomerase             144   1e-36   Desulfotomaculum ruminis
ref|NP_115661.1|  methylthioribose-1-phosphate isomerase isoform 2      143   1e-36   
ref|XP_010992133.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   1e-36   
ref|XP_010359906.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   1e-36   
ref|XP_009433120.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   1e-36   
ref|XP_006175447.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   1e-36   
ref|XP_001794215.1|  hypothetical protein SNOG_03661                    144   1e-36   
gb|EHH59270.1|  Methylthioribose-1-phosphate isomerase                  144   1e-36   
ref|XP_010759673.1|  methylthioribose-1-phosphate isomerase             144   1e-36   
ref|XP_006900885.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    144   1e-36   
gb|EHH29705.1|  Methylthioribose-1-phosphate isomerase                  144   1e-36   
ref|WP_011683253.1|  methylthioribose-1-phosphate isomerase             143   1e-36   
ref|XP_010952462.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   1e-36   
ref|XP_001540232.1|  hypothetical protein HCAG_04072                    144   1e-36   
ref|XP_011303133.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   1e-36   
ref|XP_005615138.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    142   1e-36   
ref|WP_007220775.1|  methylthioribose-1-phosphate isomerase             143   1e-36   
gb|KIW51203.1|  S-methyl-5-thioribose-1-phosphate isomerase             144   2e-36   
ref|WP_010192347.1|  methylthioribose-1-phosphate isomerase             143   2e-36   
ref|WP_022442585.1|  methylthioribose-1-phosphate isomerase             143   2e-36   
sp|C0S1C8.1|MTNA_PARBP  RecName: Full=Methylthioribose-1-phosphat...    144   2e-36   
gb|EES51572.1|  translation initiation factor, aIF-2BI/5-methylth...    143   2e-36   
ref|XP_007129465.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   2e-36   
ref|WP_008735502.1|  methylthioribose-1-phosphate isomerase             143   2e-36   
gb|AIC57312.1|  MRI1                                                    143   2e-36   
sp|C0P108.1|MTNA_AJECG  RecName: Full=Methylthioribose-1-phosphat...    144   2e-36   
ref|XP_007780227.1|  methylthioribose-1-phosphate isomerase             144   2e-36   
ref|NP_001026897.1|  methylthioribose-1-phosphate isomerase isofo...    143   2e-36   
ref|WP_007786347.1|  methylthioribose-1-phosphate isomerase             143   2e-36   
dbj|GAM36840.1|  hypothetical protein TCE0_022f06253                    144   2e-36   
ref|XP_007532519.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-36   
ref|XP_005336293.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   2e-36   
ref|WP_022022701.1|  methylthioribose-1-phosphate isomerase             143   2e-36   
ref|XP_004277483.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   2e-36   
ref|XP_004060186.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   2e-36   
ref|XP_003915067.2|  PREDICTED: methylthioribose-1-phosphate isom...    144   2e-36   
dbj|GAM84914.1|  hypothetical protein ANO11243_029160                   143   2e-36   
ref|XP_005888077.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   2e-36   
ref|XP_003275653.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   2e-36   
ref|XP_007993674.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   2e-36   
ref|XP_010327857.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   2e-36   
ref|NP_001039852.1|  methylthioribose-1-phosphate isomerase             143   2e-36   
ref|XP_001933231.1|  methylthioribose-1-phosphate isomerase             144   2e-36   
ref|WP_038286736.1|  methylthioribose-1-phosphate isomerase, part...    142   2e-36   
emb|CAG06038.1|  unnamed protein product                                142   2e-36   
ref|WP_034123807.1|  methylthioribose-1-phosphate isomerase             142   2e-36   
ref|XP_004327551.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   2e-36   
ref|WP_015868793.1|  methylthioribose-1-phosphate isomerase             142   2e-36   
ref|XP_003972078.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   2e-36   
ref|WP_013150441.1|  methylthioribose-1-phosphate isomerase             142   3e-36   
gb|ELR62033.1|  Methylthioribose-1-phosphate isomerase                  143   3e-36   
ref|XP_011496297.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|XP_003468199.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   3e-36   
ref|WP_015756786.1|  methylthioribose-1-phosphate isomerase             142   3e-36   
ref|WP_012995426.1|  methylthioribose-1-phosphate isomerase             142   3e-36   
ref|XP_008853656.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|XP_001216022.1|  hypothetical protein ATEG_07401                    143   3e-36   
ref|XP_002480786.1|  translation initiation factor, putative            143   3e-36   
ref|XP_003982003.3|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
gb|KIW17463.1|  S-methyl-5-thioribose-1-phosphate isomerase             143   3e-36   
ref|XP_008564259.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|WP_028992312.1|  methylthioribose-1-phosphate isomerase             142   3e-36   
ref|XP_004389786.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|XP_004672487.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|XP_005336292.1|  PREDICTED: methylthioribose-1-phosphate isom...    144   3e-36   
ref|XP_007720298.1|  S-methyl-5-thioribose-1-phosphate isomerase        143   3e-36   
ref|WP_041977489.1|  methylthioribose-1-phosphate isomerase             142   3e-36   
ref|XP_003639811.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    142   3e-36   
ref|XP_001820594.2|  methylthioribose-1-phosphate isomerase             142   3e-36   
ref|XP_005962906.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|WP_011928888.1|  methylthioribose-1-phosphate isomerase             142   3e-36   
ref|WP_015407610.1|  methylthioribose-1-phosphate isomerase             142   3e-36   
ref|XP_002761866.2|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|XP_007098210.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
ref|XP_006874338.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   3e-36   
dbj|GAE86917.1|  methylthioribose-1-phosphate isomerase [ [             142   4e-36   
pdb|4LDR|A  Chain A, Structure Of The S283y Mutant Of Mrdi              142   4e-36   
ref|WP_011309035.1|  methylthioribose-1-phosphate isomerase             142   4e-36   
ref|WP_041238857.1|  methylthioribose-1-phosphate isomerase             138   4e-36   
ref|WP_022483180.1|  methylthioribose-1-phosphate isomerase             142   4e-36   
ref|WP_015248370.1|  methylthioribose-1-phosphate isomerase             142   4e-36   
gb|EFN63924.1|  Translation initiation factor eIF-2B subunit alph...    142   4e-36   
gb|KEQ98081.1|  hypothetical protein AUEXF2481DRAFT_63242               143   4e-36   
ref|XP_008505941.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   4e-36   
ref|XP_006790934.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   4e-36   
ref|XP_004399024.1|  PREDICTED: methylthioribose-1-phosphate isom...    143   4e-36   
gb|EIT82996.1|  putative translation initiation factor                  142   4e-36   
ref|WP_041606628.1|  methylthioribose-1-phosphate isomerase             142   4e-36   
ref|XP_007681661.1|  hypothetical protein BAUCODRAFT_319460             142   4e-36   
sp|Q2UIM3.1|MTNA_ASPOR  RecName: Full=Methylthioribose-1-phosphat...    142   5e-36   
ref|WP_021863415.1|  methylthioribose-1-phosphate isomerase             142   5e-36   
emb|CEG65982.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    142   5e-36   
ref|XP_003850691.1|  hypothetical protein MYCGRDRAFT_73955              142   5e-36   
ref|XP_009235038.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    142   5e-36   
ref|WP_003867676.1|  MULTISPECIES: methylthioribose-1-phosphate i...    142   5e-36   
ref|WP_017651920.1|  methylthioribose-1-phosphate isomerase             142   5e-36   
gb|ACL70597.1|  putative translation initiation factor, aIF-2BI f...    142   5e-36   
ref|WP_044236377.1|  methylthioribose-1-phosphate isomerase             142   5e-36   
emb|CEJ01322.1|  Putative S-methyl-5-thioribose-1-phosphate isome...    142   6e-36   
ref|WP_041041382.1|  methylthioribose-1-phosphate isomerase             141   6e-36   
gb|EDL61542.1|  Putative translation initiation factor, aIF-2BI/5...    142   6e-36   
ref|WP_013625462.1|  methylthioribose-1-phosphate isomerase             141   6e-36   
ref|XP_007514904.1|  translation initiation factor, aIF-2BI family      146   7e-36   
gb|KEQ84160.1|  Methylthioribose-1-phosphate isomerase                  142   7e-36   
ref|XP_007469132.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    142   7e-36   
ref|XP_007422307.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   7e-36   
gb|EME39638.1|  hypothetical protein DOTSEDRAFT_75327                   142   7e-36   
gb|EKV08512.1|  Methylthioribose-1-phosphate isomerase                  142   7e-36   
ref|XP_004066207.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   7e-36   
ref|WP_013638913.1|  methylthioribose-1-phosphate isomerase             141   7e-36   
ref|WP_022492324.1|  methylthioribose-1-phosphate isomerase             141   7e-36   
ref|XP_003455807.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   7e-36   
ref|XP_007570269.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   7e-36   
ref|XP_010740335.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   8e-36   
ref|XP_005805132.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   8e-36   
ref|WP_022485644.1|  methylthioribose-1-phosphate isomerase             141   8e-36   
gb|KEQ71351.1|  Methylthioribose-1-phosphate isomerase                  142   8e-36   
gb|EMD90991.1|  hypothetical protein COCHEDRAFT_1176662                 142   8e-36   
ref|XP_004748335.1|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    142   8e-36   
ref|XP_007632876.1|  PREDICTED: methylthioribose-1-phosphate isom...    139   8e-36   
ref|WP_040947624.1|  methylthioribose-1-phosphate isomerase             135   8e-36   
ref|WP_006521892.1|  methylthioribose-1-phosphate isomerase             141   8e-36   
ref|XP_002627028.1|  S-methyl-5-thioribose-1-phosphate isomerase        142   8e-36   
ref|WP_010943990.1|  methylthioribose-1-phosphate isomerase             141   8e-36   
ref|WP_038043640.1|  methylthioribose-1-phosphate isomerase             140   8e-36   
gb|KGQ02006.1|  methylthioribose-1-phosphate isomerase                  142   9e-36   
ref|WP_013175456.1|  methylthioribose-1-phosphate isomerase             141   9e-36   
ref|WP_020611639.1|  methylthioribose-1-phosphate isomerase             141   9e-36   
ref|XP_007708817.1|  hypothetical protein COCCADRAFT_2167               142   9e-36   
sp|C5GGE5.1|MTNA_AJEDR  RecName: Full=Methylthioribose-1-phosphat...    142   9e-36   
ref|WP_034598620.1|  methylthioribose-1-phosphate isomerase             141   9e-36   
ref|WP_021721119.1|  methylthioribose-1-phosphate isomerase             141   9e-36   
gb|EUN32000.1|  hypothetical protein COCVIDRAFT_86317                   142   9e-36   
gb|KEQ63615.1|  Methylthioribose-1-phosphate isomerase                  142   9e-36   
ref|XP_002921063.2|  PREDICTED: LOW QUALITY PROTEIN: methylthiori...    142   9e-36   
ref|WP_014297071.1|  methylthioribose-1-phosphate isomerase             141   9e-36   
ref|XP_007182139.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   1e-35   
ref|XP_002560080.1|  Pc14g00860                                         141   1e-35   
gb|EJK50909.1|  hypothetical protein THAOC_29980                        142   1e-35   
ref|WP_006491745.1|  Methylthioribose-1-phosphate isomerase             141   1e-35   
gb|ELK32054.1|  Coiled-coil domain-containing protein 130               144   1e-35   
ref|WP_009145106.1|  methylthioribose-1-phosphate isomerase             141   1e-35   
ref|WP_027715327.1|  methylthioribose-1-phosphate isomerase             141   1e-35   
gb|KEF62771.1|  S-methyl-5-thioribose-1-phosphate isomerase             142   1e-35   
ref|XP_007702121.1|  hypothetical protein COCSADRAFT_38815              142   1e-35   
dbj|GAN06082.1|  translation initiation factor                          141   1e-35   
ref|XP_006079940.1|  PREDICTED: methylthioribose-1-phosphate isom...    142   1e-35   
ref|XP_008031489.1|  hypothetical protein SETTUDRAFT_166325             142   1e-35   
ref|WP_014266552.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
gb|EKE03029.1|  hypothetical protein ACD_20C00287G0012                  141   1e-35   
ref|XP_004616861.1|  PREDICTED: methylthioribose-1-phosphate isom...    141   1e-35   
ref|XP_007691907.1|  hypothetical protein COCMIDRAFT_105818             141   1e-35   
ref|WP_014785421.1|  methylthioribose-1-phosphate isomerase             141   1e-35   
ref|WP_015212367.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
ref|WP_034104637.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
ref|WP_027363563.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
ref|NP_001104708.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
ref|WP_014904482.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
ref|XP_011166414.1|  PREDICTED: methylthioribose-1-phosphate isom...    139   1e-35   
ref|XP_007952565.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   1e-35   
ref|WP_029247727.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
ref|WP_033703996.1|  methylthioribose-1-phosphate isomerase             135   1e-35   
ref|WP_014730166.1|  methylthioribose-1-phosphate isomerase             140   1e-35   
gb|EFX71518.1|  hypothetical protein DAPPUDRAFT_308831                  140   2e-35   
ref|WP_041555500.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
gb|EEM50105.1|  Methylthioribose-1-phosphate isomerase                  135   2e-35   
ref|XP_010870944.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-35   
ref|WP_033676063.1|  MULTISPECIES: methylthioribose-1-phosphate i...    135   2e-35   
ref|WP_035299486.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
ref|WP_006530882.1|  S-methyl-5-thioribose-1-phosphate isomerase        140   2e-35   
ref|XP_006678377.1|  hypothetical protein BATDEDRAFT_19408              141   2e-35   
ref|WP_015406964.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
ref|XP_008315470.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-35   
ref|XP_004872496.1|  PREDICTED: methylthioribose-1-phosphate isom...    139   2e-35   
ref|XP_008315471.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-35   
ref|XP_004595907.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-35   
ref|XP_010591802.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-35   
ref|WP_026362427.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
ref|XP_004635691.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-35   
ref|WP_029098309.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
ref|WP_013254014.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
ref|WP_040100051.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
ref|WP_019392905.1|  hypothetical protein                               140   2e-35   
ref|WP_040058298.1|  methylthioribose-1-phosphate isomerase             140   2e-35   
ref|XP_004715550.1|  PREDICTED: methylthioribose-1-phosphate isom...    140   2e-35   
ref|WP_019504828.1|  hypothetical protein                               140   2e-35   
ref|WP_022986533.1|  methylthioribose-1-phosphate isomerase             140   3e-35   
emb|CEP08072.1|  hypothetical protein                                   140   3e-35   
gb|AFY46305.1|  S-methyl-5-thioribose-1-phosphate isomerase             140   3e-35   
ref|WP_012984216.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
gb|KIV77933.1|  S-methyl-5-thioribose-1-phosphate isomerase             140   3e-35   
gb|EEB76234.1|  methylthioribose-1-phosphate isomerase                  139   3e-35   
ref|WP_043883894.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
dbj|GAE00299.1|  translation initiation factor, putative                140   3e-35   
ref|WP_002685587.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
ref|WP_013932080.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
ref|WP_004514196.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
ref|WP_015716694.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
ref|WP_023558366.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
ref|WP_021945330.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
gb|KEY83965.1|  translation initiation factor                           140   3e-35   
ref|XP_752241.1|  translation initiation factor                         140   3e-35   
ref|WP_011941095.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
ref|WP_019551415.1|  MULTISPECIES: methylthioribose-1-phosphate i...    139   3e-35   
ref|WP_005995136.1|  methylthioribose-1-phosphate isomerase             139   3e-35   
ref|WP_037387875.1|  methylthioribose-1-phosphate isomerase             139   4e-35   
ref|WP_003869624.1|  MULTISPECIES: methylthioribose-1-phosphate i...    139   4e-35   
ref|WP_028493113.1|  methylthioribose-1-phosphate isomerase             139   4e-35   
ref|WP_029912732.1|  methylthioribose-1-phosphate isomerase             139   4e-35   
ref|WP_014063004.1|  methylthioribose-1-phosphate isomerase             139   4e-35   
ref|WP_020492794.1|  methylthioribose-1-phosphate isomerase             139   4e-35   
ref|WP_013452044.1|  methylthioribose-1-phosphate isomerase             139   4e-35   
ref|WP_011025825.1|  methylthioribose-1-phosphate isomerase             139   4e-35   
ref|WP_026692257.1|  methylthioribose-1-phosphate isomerase             139   5e-35   
ref|XP_004872495.1|  PREDICTED: methylthioribose-1-phosphate isom...    139   5e-35   
ref|WP_022106828.1|  methylthioribose-1-phosphate isomerase             139   5e-35   
ref|WP_031931601.1|  methylthioribose-1-phosphate isomerase             139   5e-35   
ref|WP_011994667.1|  methylthioribose-1-phosphate isomerase             139   5e-35   
ref|XP_007929107.1|  hypothetical protein MYCFIDRAFT_204427             140   5e-35   
ref|XP_007583690.1|  putative methylthioribose-1-phosphate isomer...    145   5e-35   
gb|KIE10230.1|  methylthioribose-1-phosphate isomerase                  139   5e-35   
gb|EHB14460.1|  Methylthioribose-1-phosphate isomerase                  139   5e-35   



>ref|XP_006346696.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Solanum 
tuberosum]
Length=374

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV ENIPATLIADSAAAALM AGRV AVIVGADR+AANGDTANKIGTY+LAV AMHH
Sbjct  220  AFELVHENIPATLIADSAAAALMNAGRVKAVIVGADRVAANGDTANKIGTYNLAVSAMHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSGQ+IVIEERSPKELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  280  GIPFYVAAPLTSVDLSLSSGQEIVIEERSPKELLHTRGGLGEQVAASGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGNV  302
            A LISGIITEKGVI+K+G D FDI GFV K SGN+
Sbjct  340  AKLISGIITEKGVITKNGTDTFDIAGFVRKTSGNL  374



>ref|XP_009627128.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Nicotiana tomentosiformis]
 sp|Q948X8.1|MTNA_TOBAC RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Nicotiana 
tabacum]
 dbj|BAB63262.1| CIG2 [Nicotiana tabacum]
Length=374

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV ENIPATLIADSAAAALM AGRV AVIVGADR+AANGDTANKIGTY+LAV AMHH
Sbjct  220  AFELVHENIPATLIADSAAAALMNAGRVKAVIVGADRVAANGDTANKIGTYNLAVSAMHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTS+DLSLSSGQ+IVIEERSPKELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  280  GIPFYVAAPLTSIDLSLSSGQEIVIEERSPKELLHTRGGLGEQVAASGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGNV  302
            A+LISGIITEKGVI+K G + FDI  FV K SGN+
Sbjct  340  ANLISGIITEKGVITKKGAETFDIAEFVRKTSGNL  374



>ref|XP_004244859.1| PREDICTED: methylthioribose-1-phosphate isomerase [Solanum lycopersicum]
Length=374

 Score =   241 bits (615),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV ENIPATLIADSAAAALM AGRV AVIVGADRIAANGDTANKIGTY+LAV AMHH
Sbjct  220  AFELVHENIPATLIADSAAAALMNAGRVKAVIVGADRIAANGDTANKIGTYNLAVSAMHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSGQ+IVIEERSPKELLHT GGLGEQ+AASGI VWNPAFDVT 
Sbjct  280  GIPFYVAAPLTSVDLSLSSGQEIVIEERSPKELLHTRGGLGEQVAASGILVWNPAFDVTQ  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGNV  302
            A LISGIITEKGVI+K+G D FDI GFV K +GN+
Sbjct  340  AKLISGIITEKGVITKNGTDTFDIAGFVRKTAGNL  374



>ref|XP_009781605.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nicotiana 
sylvestris]
Length=374

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV ENIPATLIADSAAAALM AGRV AVIVGADR+AANGDTANKIGTY+LAV A+HH
Sbjct  220  AFELVHENIPATLIADSAAAALMNAGRVKAVIVGADRVAANGDTANKIGTYNLAVSAVHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTS+DLSLSSGQ+IVIEERSPKELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  280  GIPFYVAAPLTSIDLSLSSGQEIVIEERSPKELLHTRGGLGEQVAASGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A+LISGIITEKGVI+K G D FDI  FV K SGN
Sbjct  340  ANLISGIITEKGVITKKGTDTFDIAEFVRKTSGN  373



>ref|XP_010467106.1| PREDICTED: methylthioribose-1-phosphate isomerase [Camelina sativa]
Length=374

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  218  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  277

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHTHGGLGE+IAA GISVWNPAFDVTP
Sbjct  278  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHTHGGLGERIAAPGISVWNPAFDVTP  337

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+GNDAFDI+ F  K++GN
Sbjct  338  AELIAGIITEKGVITKNGNDAFDISSFAQKMTGN  371



>ref|NP_001077883.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05978.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=328

 Score =   237 bits (605),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  172  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  231

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKEL+HTHGGLGE+IAA GISVWNPAFD+TP
Sbjct  232  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTP  291

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+GND FDI+ F  K++GN
Sbjct  292  AELIAGIITEKGVITKNGNDTFDISSFAKKITGN  325



>ref|NP_973428.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 ref|NP_001031339.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AAM20446.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AAM91239.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05976.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 gb|AEC05977.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=326

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  170  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  229

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKEL+HTHGGLGE+IAA GISVWNPAFD+TP
Sbjct  230  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTP  289

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+GND FDI+ F  K++GN
Sbjct  290  AELIAGIITEKGVITKNGNDTFDISSFAKKITGN  323



>gb|AAM65143.1| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
Length=374

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  218  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  277

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHTHGGLGE+IAA GISVWNPAFD+TP
Sbjct  278  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHTHGGLGERIAAPGISVWNPAFDMTP  337

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+GND FDI+ F  K++GN
Sbjct  338  AELIAGIITEKGVITKNGNDTFDISSFAKKITGN  371



>ref|NP_027726.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
 sp|Q9ZUG4.2|MTNA_ARATH RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Arabidopsis 
thaliana]
 gb|AAC95160.2| putative translation initiation factor eIF-2B alpha subunit [Arabidopsis 
thaliana]
 gb|AEC05975.1| methylthioribose-1-phosphate isomerase [Arabidopsis thaliana]
Length=374

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  218  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  277

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKEL+HTHGGLGE+IAA GISVWNPAFD+TP
Sbjct  278  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELMHTHGGLGERIAAPGISVWNPAFDMTP  337

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+GND FDI+ F  K++GN
Sbjct  338  AELIAGIITEKGVITKNGNDTFDISSFAKKITGN  371



>ref|XP_010488779.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=374

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  218  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  277

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHTHGGLGE+IAA GISVWNPAFDVTP
Sbjct  278  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHTHGGLGERIAAPGISVWNPAFDVTP  337

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+ N+AFDI+ F  K++GN
Sbjct  338  AELIAGIITEKGVITKNSNNAFDISSFAQKMTGN  371



>gb|EYU28322.1| hypothetical protein MIMGU_mgv1a008441mg [Erythranthe guttata]
Length=374

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV ENIPATLIADSAAAALMKAG+V AVIVGADR+AANGDTANKIGTYSLA+ AMHH
Sbjct  220  AFELVHENIPATLIADSAAAALMKAGQVKAVIVGADRVAANGDTANKIGTYSLAISAMHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTS+DLSLSSG++IVIEERS KELLH  GGLGEQ+AASGISVWNPAFDVTP
Sbjct  280  GIPFYVAAPLTSIDLSLSSGEEIVIEERSAKELLHARGGLGEQVAASGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A++ISGIITEKGVI+KDG D+FDI  F  KVS N
Sbjct  340  ATVISGIITEKGVITKDGADSFDIKSFAEKVSSN  373



>gb|KFK39882.1| hypothetical protein AALP_AA3G300900 [Arabis alpina]
Length=374

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  218  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  277

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSL+SG++IVIEER+PKELL+THGGLGE+IAA GISVWNPAFDVTP
Sbjct  278  GIPFYVAAPLTSVDLSLTSGKEIVIEERTPKELLNTHGGLGERIAAPGISVWNPAFDVTP  337

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+GNDAFDI+ F  +++GN
Sbjct  338  AELIAGIITEKGVITKNGNDAFDISSFAQQMTGN  371



>ref|XP_002883712.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59971.1| eukaryotic translation initiation factor 2B family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=369

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  218  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  277

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHTHGGLGE+IAA GISVWNPAFDVTP
Sbjct  278  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHTHGGLGERIAAPGISVWNPAFDVTP  337

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A LI+GIITEKGVI+K+GND FDI+ F  K++
Sbjct  338  AELIAGIITEKGVITKNGNDTFDISSFAKKMT  369



>ref|XP_010412762.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Camelina 
sativa]
Length=369

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  218  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  277

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEERSPKELLHTHGGLGE+IAA GISVWNPAFD TP
Sbjct  278  GIPFYVAAPLTSVDLSLSSGKEIVIEERSPKELLHTHGGLGERIAAPGISVWNPAFDATP  337

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A LI+GIITEKGVI+K+ NDAFDI+ F  K++
Sbjct  338  AELIAGIITEKGVITKNSNDAFDISSFAQKMT  369



>ref|XP_006396133.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
 gb|ESQ36912.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
Length=372

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  219  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEER+PKELL+THGGLGE+IAA GISVWNPAFDVTP
Sbjct  279  GIPFYVAAPLTSVDLSLSSGKEIVIEERTPKELLNTHGGLGERIAAPGISVWNPAFDVTP  338

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKG+I+K GN AFDI+ F  K++GN
Sbjct  339  AELIAGIITEKGIITKSGNGAFDISSFAQKMTGN  372



>ref|XP_009102357.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brassica rapa]
Length=372

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  219  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+THGGLGE+IAA GISVWNPAFDVTP
Sbjct  279  GIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNTHGGLGERIAAPGISVWNPAFDVTP  338

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+ NDAFDI+ F  KV+GN
Sbjct  339  AELIAGIITEKGVITKNANDAFDISSFAKKVTGN  372



>emb|CDY33397.1| BnaA07g04420D [Brassica napus]
Length=373

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  220  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+THGGLGE+IAA GISVWNPAFDVTP
Sbjct  280  GIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNTHGGLGERIAAPGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+ NDAFDI+ F  KV+GN
Sbjct  340  AELIAGIITEKGVITKNANDAFDISSFAKKVTGN  373



>emb|CDY70356.1| BnaCnng67980D [Brassica napus]
Length=373

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ V+VGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  220  AFELVHEKIPATLIADSAAAALMKDGRVDGVVVGADRVASNGDTANKIGTYSLALCAKHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+THGGLGE+IAA GISVWNPAFDVTP
Sbjct  280  GIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNTHGGLGERIAAPGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKGVI+K+ NDAFDI+ F  KV+GN
Sbjct  340  AELIAGIITEKGVITKNANDAFDISSFAKKVTGN  373



>ref|XP_008242258.1| PREDICTED: methylthioribose-1-phosphate isomerase [Prunus mume]
Length=382

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATL+ DSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYSLAV A +H
Sbjct  226  AFELVHDNIPATLVVDSAAAALMKDGRVNAVVVGADRVAANGDTANKIGTYSLAVSAKYH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTSVDL+LSSGQ+I+IEERSPKELLH+ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  286  NIPFFVAAPLTSVDLALSSGQEIIIEERSPKELLHSQGGLGEQVAASGISVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A+LI+GIITEKGVI+K G DAFDI GFV K +
Sbjct  346  ANLIAGIITEKGVITKKGTDAFDIKGFVQKAA  377



>ref|XP_007202151.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
 gb|EMJ03350.1| hypothetical protein PRUPE_ppa007089mg [Prunus persica]
Length=382

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATL+ DSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYSLAV A +H
Sbjct  226  AFELVHDNIPATLVVDSAAAALMKDGRVNAVVVGADRVAANGDTANKIGTYSLAVSAKYH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTSVDL+LSSGQ+I+IEERSPKELLH+ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  286  NIPFFVAAPLTSVDLALSSGQEIIIEERSPKELLHSQGGLGEQVAASGISVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A+LI+GIITEKGVI+K G DAFDI GFV K +
Sbjct  346  ANLIAGIITEKGVITKKGTDAFDIKGFVQKAA  377



>ref|XP_009337200.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=378

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIP TLIADSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYS+AV A HH
Sbjct  222  AFELVHDNIPGTLIADSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYSVAVSAKHH  281

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTS+DLSLSSG++I+IEERSPKELL+THGGLGEQ+AASGI+VWNPAFDVTP
Sbjct  282  NIPFFVAAPLTSIDLSLSSGEEIIIEERSPKELLNTHGGLGEQVAASGIAVWNPAFDVTP  341

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A+LI+GIITEKGVI+K G DAFDI GFV K +
Sbjct  342  ANLITGIITEKGVITKKGTDAFDIKGFVQKAA  373



>ref|XP_004166700.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cucumis 
sativus]
Length=325

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP+TLIADSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYSLA+CAMHH +
Sbjct  172  ELVHEKIPSTLIADSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYSLALCAMHHKI  231

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++ GGLGEQ+AASGI+VWNPAFDVTPA 
Sbjct  232  PFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNSRGGLGEQVAASGIAVWNPAFDVTPAH  291

Query  400  LISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            LI GIITEKGVI+K G+D+F+I  FV K +G
Sbjct  292  LICGIITEKGVITKAGSDSFNIKEFVQKTAG  322



>ref|XP_008388900.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIP TLIADSAAAALMK GRVNAV+VGADR+A NGDTANKIGTYSLAV A HH
Sbjct  226  AFELVHDNIPGTLIADSAAAALMKFGRVNAVVVGADRVATNGDTANKIGTYSLAVSAKHH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTS+DLSLSSG++I+IEERSPKELL+THGGLGEQ+AASGI+VWNPAFDVTP
Sbjct  286  NIPFFVAAPLTSIDLSLSSGEEIIIEERSPKELLNTHGGLGEQVAASGIAVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A+LI+GIITEKGVI+K G DAF+I GFV K +
Sbjct  346  ANLITGIITEKGVITKKGTDAFBIKGFVQKAA  377



>gb|KJB82985.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=285

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK  RV+AVIVGADR+ ANGDTANKIGTYSLA+CAMHH
Sbjct  127  AFELVHEKIPATLIADSAAAALMKEDRVDAVIVGADRVTANGDTANKIGTYSLALCAMHH  186

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  187  HIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHTRGGLGEQVAASGISVWNPAFDVTP  246

Query  406  ASLISGIITEKGVISKD--GNDAFDITGFVHKVSGN  305
            A+LI+GIITEKGVI+K+   +DAFDI  F+ K +G 
Sbjct  247  ANLIAGIITEKGVITKNDMKDDAFDIKDFIEKATGK  282



>gb|KHG04432.1| Methylthioribose-1-phosphate isomerase [Gossypium arboreum]
Length=385

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+AV+VGADR+ ANGDTANKIGTYSLA+CAMHH
Sbjct  227  AFELVHEKIPATLIADSAAAALMKEGRVDAVVVGADRVTANGDTANKIGTYSLALCAMHH  286

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  287  HIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHTRGGLGEQVAASGISVWNPAFDVTP  346

Query  406  ASLISGIITEKGVISKD--GNDAFDITGFVHKVSGN  305
            A+LI+GIITEKGVI+K+   +DAFDI  F+ K +G 
Sbjct  347  ANLIAGIITEKGVITKNDMKDDAFDIKDFIEKATGK  382



>ref|XP_008450940.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cucumis melo]
Length=381

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP+TLIADSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYSLA+CAMHH +
Sbjct  228  ELVHEKIPSTLIADSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYSLALCAMHHKI  287

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++ GGLGEQ+AASGI+VWNPAFDVTPA 
Sbjct  288  PFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNSRGGLGEQVAASGIAVWNPAFDVTPAH  347

Query  400  LISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            LI GIITEKGVI+K G+D+F+I  FV K +G
Sbjct  348  LICGIITEKGVITKAGSDSFNIKEFVQKTAG  378



>emb|CDP03069.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATL+ DSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYSLA+CA HH
Sbjct  220  AFELVYEKIPATLLVDSAAAALMKDGRVNAVVVGADRVAANGDTANKIGTYSLALCAKHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF VAAPLTS+DLS++SG++IVIEERSPKE+LH  GGLGEQ+AASGI+VWNPAFDVTP
Sbjct  280  NIPFLVAAPLTSIDLSITSGEEIVIEERSPKEVLHARGGLGEQVAASGIAVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A +ISGIITEKGVI+K+G + FDI GFV K + N
Sbjct  340  ADIISGIITEKGVITKNGTEDFDIKGFVRKAASN  373



>gb|KGN66312.1| hypothetical protein Csa_1G597100 [Cucumis sativus]
Length=381

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IP+TLIADSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYSLA+CAMHH
Sbjct  226  AYELVHEKIPSTLIADSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYSLALCAMHH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++ GGLGEQ+AASGI+VWNPAFDVTP
Sbjct  286  KIPFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNSRGGLGEQVAASGIAVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            A LI GIITEKGVI+K G+D+F+I  FV K +G
Sbjct  346  AHLICGIITEKGVITKAGSDSFNIKEFVQKTAG  378



>ref|XP_004144039.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cucumis 
sativus]
Length=395

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP+TLIADSAAAALMK GRVNAV+VGADR+AANGDTANKIGTYSLA+CAMHH +
Sbjct  242  ELVHEKIPSTLIADSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYSLALCAMHHKI  301

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAPLTS+DLSLSSG++IVIEERSPKELL++ GGLGEQ+AASGI+VWNPAFDVTPA 
Sbjct  302  PFFVAAPLTSIDLSLSSGEEIVIEERSPKELLNSRGGLGEQVAASGIAVWNPAFDVTPAH  361

Query  400  LISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            LI GIITEKGVI+K G+D+F+I  FV K +G
Sbjct  362  LICGIITEKGVITKAGSDSFNIKEFVQKTAG  392



>ref|XP_007012613.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY30232.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 
[Theobroma cacao]
Length=424

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CAM+H
Sbjct  269  AFELVHEKIPATLIADSAAAALMKEGRVSAVIVGADRVAANGDTANKIGTYSLAICAMYH  328

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSGQ+I+IEERS KELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  329  HIPFYVAAPLTSIDLSLSSGQEIIIEERSAKELLHTRGGLGEQVAASGISVWNPAFDVTP  388

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A+LI+GIITEKGVI+K+  DAFDI  F+ K +G 
Sbjct  389  ANLIAGIITEKGVITKN-TDAFDIKNFMEKATGK  421



>gb|KJB82983.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=345

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK  RV+AVIVGADR+ ANGDTANKIGTYSLA+CAMHH
Sbjct  187  AFELVHEKIPATLIADSAAAALMKEDRVDAVIVGADRVTANGDTANKIGTYSLALCAMHH  246

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  247  HIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHTRGGLGEQVAASGISVWNPAFDVTP  306

Query  406  ASLISGIITEKGVISKD--GNDAFDITGFVHKVSGN  305
            A+LI+GIITEKGVI+K+   +DAFDI  F+ K +G 
Sbjct  307  ANLIAGIITEKGVITKNDMKDDAFDIKDFIEKATGK  342



>gb|KDP33930.1| hypothetical protein JCGZ_07501 [Jatropha curcas]
Length=382

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CAMHH
Sbjct  226  AFELVHDKIPATLIADSAAAALMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAMHH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DL LSSG QIVIEERSPKELL+T GGLGEQ+AASGIS+WNPAFDVTP
Sbjct  286  NIPFYVAAPLTSIDLCLSSGNQIVIEERSPKELLNTRGGLGEQVAASGISIWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            A+LISGIITEKGVI+K G D FDI  FV    G
Sbjct  346  ANLISGIITEKGVITKVGADYFDIKNFVKGAVG  378



>ref|XP_006280656.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
 gb|EOA13554.1| hypothetical protein CARUB_v10026616mg [Capsella rubella]
Length=370

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  219  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASNGDTANKIGTYSLALCAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSLSSG++IVIEER+ KELL+THGGLGE+IAA GISVWNPAFDVTP
Sbjct  279  GIPFYVAAPLTSVDLSLSSGKEIVIEERTAKELLNTHGGLGERIAAPGISVWNPAFDVTP  338

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A LI+GIITEKG+I+K+ NDAFDI+ F  K++
Sbjct  339  AELIAGIITEKGIITKNDNDAFDISSFAKKMT  370



>gb|KJB82981.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=385

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK  RV+AVIVGADR+ ANGDTANKIGTYSLA+CAMHH
Sbjct  227  AFELVHEKIPATLIADSAAAALMKEDRVDAVIVGADRVTANGDTANKIGTYSLALCAMHH  286

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  287  HIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHTRGGLGEQVAASGISVWNPAFDVTP  346

Query  406  ASLISGIITEKGVISKD--GNDAFDITGFVHKVSGN  305
            A+LI+GIITEKGVI+K+   +DAFDI  F+ K +G 
Sbjct  347  ANLIAGIITEKGVITKNDMKDDAFDIKDFIEKATGK  382



>ref|XP_011078119.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sesamum indicum]
Length=374

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATLIADSAAAALMK GRVNAVIVGADR+AANGDTANKIGTYSLA+ AMHH
Sbjct  220  AFELVHDNIPATLIADSAAAALMKDGRVNAVIVGADRVAANGDTANKIGTYSLALSAMHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTS+DLSLSSGQ+IVIEERS KELL++ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  280  GIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLNSRGGLGEQVAASGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVS  311
            A++ISGIITEKGVI+KD   +FDI  F  +V+
Sbjct  340  ATVISGIITEKGVITKDETGSFDIKSFAQEVA  371



>ref|XP_010090181.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
 gb|EXB38978.1| Methylthioribose-1-phosphate isomerase [Morus notabilis]
Length=371

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATLIADSAAAALMK GRV+AV+VGADR+AANGDTANKIGTYSLA+ A HH
Sbjct  219  AFELVHDNIPATLIADSAAAALMKDGRVSAVVVGADRVAANGDTANKIGTYSLALIAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPF+VAAPLTS+DLSLSSGQ+IVIEERSPKELLHT GGLGEQ+AASGI+VWNPAFDVTP
Sbjct  279  NVPFFVAAPLTSIDLSLSSGQEIVIEERSPKELLHTRGGLGEQVAASGIAVWNPAFDVTP  338

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            A+LISGIITEKGVI+K   + FDI  FV K +G
Sbjct  339  ANLISGIITEKGVITKVDTEEFDIKDFVQKTAG  371



>ref|XP_004287647.1| PREDICTED: methylthioribose-1-phosphate isomerase [Fragaria vesca 
subsp. vesca]
Length=376

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV +NIPATLIADSAAAALMK G+VNA++VGADR+A+NGDTANKIGTYSLAV A +H +
Sbjct  228  ELVHDNIPATLIADSAAAALMKDGKVNAIVVGADRVASNGDTANKIGTYSLAVSAKYHNI  287

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAPLTSVDLSLSSG +IVIEERSPKELL+THGGLGEQ+AASGISVWNPAFDVTPAS
Sbjct  288  PFFVAAPLTSVDLSLSSGGEIVIEERSPKELLNTHGGLGEQVAASGISVWNPAFDVTPAS  347

Query  400  LISGIITEKGVISKDGNDAFDITGFVH  320
            LI GIITEKGVI+K G DAFDI GFV 
Sbjct  348  LIYGIITEKGVITKKGTDAFDIKGFVQ  374



>ref|XP_010930603.1| PREDICTED: methylthioribose-1-phosphate isomerase [Elaeis guineensis]
Length=376

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLI DSAAAALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAV A +H
Sbjct  220  AFELVHDEIPATLITDSAAAALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAVSASYH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP+TS+DLSLSSGQQIVIEERSPKELL + GGLG+Q+AASGI+VWNPAFD+TP
Sbjct  280  GIPFYVAAPITSIDLSLSSGQQIVIEERSPKELLCSDGGLGKQVAASGIAVWNPAFDITP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A+L++ IITEKGVI+K   DAFDI GF+ K  GN
Sbjct  340  ANLMTAIITEKGVITKATADAFDIKGFIQKAQGN  373



>ref|XP_008337840.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Malus 
domestica]
Length=382

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATLIADSAAAALMK  RVNAV+VGA R+AANGDTANKIGTY+LAV A HH
Sbjct  226  AFELVHDNIPATLIADSAAAALMKFARVNAVVVGAYRVAANGDTANKIGTYNLAVSAKHH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTSVDLSLSSG++I+IEERSPKELL+THGGLGEQ+AA GISVWNPAFDVTP
Sbjct  286  NIPFFVAAPLTSVDLSLSSGEEIIIEERSPKELLNTHGGLGEQVAAFGISVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHK  317
            A+LI+GIITEKGVI+K G DAFDI GFV K
Sbjct  346  ANLITGIITEKGVITKKGTDAFDIKGFVQK  375



>ref|XP_010047466.1| PREDICTED: methylthioribose-1-phosphate isomerase [Eucalyptus 
grandis]
Length=380

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATL+ADSAAAAL+K GRV+AVIVGADR+AANGDTANKIGTYSLA+CA HH
Sbjct  226  AFELVHERIPATLLADSAAAALVKEGRVDAVIVGADRVAANGDTANKIGTYSLALCARHH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTSVDLSLSSGQ IVIEERS KELL++ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  286  NIPFYVAAPLTSVDLSLSSGQDIVIEERSAKELLNSRGGLGEQVAASGISVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A+LI+GIITEKGV++K G+DAFD+  F  ++ G 
Sbjct  346  ANLIAGIITEKGVVTKKGSDAFDMKAFALQLDGK  379



>ref|XP_009359722.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Pyrus 
x bretschneideri]
Length=382

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATLIADSAAAALMK GRVNAV+VGADR+AANGDTANKIGTY+L V A HH
Sbjct  226  AFELVHDNIPATLIADSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYNLCVSAKHH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VA PLTSVDLSLSSG++ +I+ERSPKELL+THGGLGEQ AASGISVWNPAFDVTP
Sbjct  286  NIPFFVAVPLTSVDLSLSSGEERIIDERSPKELLNTHGGLGEQFAASGISVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHK  317
            A+LI+GIITEKGVI+K G DAFDI GFV K
Sbjct  346  ANLITGIITEKGVITKKGTDAFDIKGFVQK  375



>ref|XP_008786516.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Phoenix dactylifera]
Length=376

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLI DSAAAALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAV A +H
Sbjct  220  AFELVHDKIPATLITDSAAAALMKAGRVNAVIVGADRIAANGDTANKIGTYSLAVSASYH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP+TS+DLSLSSG+QIVIEERSPKELL + GGLG+Q+AASGI+VWNPAFDVTP
Sbjct  280  GIPFYVAAPITSIDLSLSSGRQIVIEERSPKELLCSDGGLGKQVAASGIAVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A+LI+ IITEKG I+K   DAFDI GF+ K  GN
Sbjct  340  ANLITAIITEKGAITKATADAFDIKGFIQKAQGN  373



>ref|XP_002516257.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
 sp|B9RR88.1|MTNA_RICCO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Ricinus 
communis]
 gb|EEF46259.1| Methylthioribose-1-phosphate isomerase, putative [Ricinus communis]
Length=382

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATL+ADSAAAALMK  +V+AVIVGADR+AANGDTANKIGTYSLA+CAMHH
Sbjct  226  AFELVHEKIPATLVADSAAAALMKDDQVSAVIVGADRVAANGDTANKIGTYSLALCAMHH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTSVDLSLSSG+ IVIEERSPKELL++ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  286  NIPFYVAAPLTSVDLSLSSGKHIVIEERSPKELLNSRGGLGEQVAASGISVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            A+LISGIITEKGVI+K  +  FDI  FV + +G
Sbjct  346  ANLISGIITEKGVITKIDSSDFDIKNFVKRTAG  378



>ref|XP_010666847.1| PREDICTED: methylthioribose-1-phosphate isomerase [Beta vulgaris 
subsp. vulgaris]
Length=379

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATLIADSAAAALMKAG V  VIVGADR+AANGDTANKIGTYSLAV A HH
Sbjct  229  AFELVHDNIPATLIADSAAAALMKAGNVQGVIVGADRVAANGDTANKIGTYSLAVSAKHH  288

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDLSL SG+ I+IEERSPKELL++ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  289  GIPFYVAAPLTSVDLSLPSGEYIIIEERSPKELLNSRGGLGEQVAASGISVWNPAFDVTP  348

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHK  317
            A+LISGIITEKGVI+K G+ AFDI  FV K
Sbjct  349  ANLISGIITEKGVITKSGDKAFDIKDFVQK  378



>gb|KCW79381.1| hypothetical protein EUGRSUZ_C00793 [Eucalyptus grandis]
Length=461

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATL+ADSAAAAL+K GRV+AVIVGADR+AANGDTANKIGTYSLA+CA HH
Sbjct  307  AFELVHERIPATLLADSAAAALVKEGRVDAVIVGADRVAANGDTANKIGTYSLALCARHH  366

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTSVDLSLSSGQ IVIEERS KELL++ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  367  NIPFYVAAPLTSVDLSLSSGQDIVIEERSAKELLNSRGGLGEQVAASGISVWNPAFDVTP  426

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A+LI+GIITEKGV++K G+DAFD+  F  ++ G 
Sbjct  427  ANLIAGIITEKGVVTKKGSDAFDMKAFALQLDGK  460



>ref|XP_002308521.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
 sp|B9HCR2.2|MTNA_POPTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Populus 
trichocarpa]
 gb|EEE92044.2| eukaryotic translation initiation factor 2B family protein [Populus 
trichocarpa]
Length=375

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK  +V+AV+VGADR+AANGDTANKIGTYSLA+CAMHH
Sbjct  224  AFELVHEKIPATLIADSAAAALMKDSKVSAVVVGADRVAANGDTANKIGTYSLALCAMHH  283

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS D SLSSG++I+IEERSPKE+L+  GGLGEQ+AASGISVWNPAFDVTP
Sbjct  284  NIPFYVAAPLTSFDSSLSSGKEIIIEERSPKEMLNARGGLGEQVAASGISVWNPAFDVTP  343

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHK  317
            ASLISGIITEKGVI+K G D FDI  F++K
Sbjct  344  ASLISGIITEKGVITKTGMDDFDIKDFINK  373



>ref|XP_011019339.1| PREDICTED: methylthioribose-1-phosphate isomerase [Populus euphratica]
Length=380

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK  +V+AV+VGADR+ ANGDTANKIGTYSLA+CAMHH
Sbjct  224  AFELVHEKIPATLIADSAAAALMKDSKVSAVVVGADRVVANGDTANKIGTYSLALCAMHH  283

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS D SLSSG++I+IEERSPKE+L+  GGLGEQ+AASGISVWNPAFDVTP
Sbjct  284  NIPFYVAAPLTSFDSSLSSGKEIIIEERSPKEMLNARGGLGEQVAASGISVWNPAFDVTP  343

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGNV  302
            ASLISGIITEKGVI+K G D FDI  F+++  G  
Sbjct  344  ASLISGIITEKGVITKTGTDDFDIKDFINRAVGQC  378



>ref|XP_010261799.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nelumbo nucifera]
Length=377

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK+GRV+AVIVGADR+A+NGDTANKIGTYSLA+CA++H
Sbjct  226  AFELVHDKIPATLIADSAAAALMKSGRVDAVIVGADRVASNGDTANKIGTYSLALCALYH  285

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP+TS+DLSL SGQ++VIEERS KELL++ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  286  GIPFYVAAPVTSIDLSLPSGQEVVIEERSAKELLNSRGGLGEQVAASGISVWNPAFDVTP  345

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHK  317
            A+LI+ IITEKGVI+K+G ++F+I  FVHK
Sbjct  346  ANLITAIITEKGVITKNGTESFEIKDFVHK  375



>gb|AFK33839.1| unknown [Lotus japonicus]
Length=177

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPA LIADSAAAALMK+GRV+AV+VGADR+A+NGDTANKIGTYS+A+CA  H
Sbjct  25   AFELVHDKIPAALIADSAAAALMKSGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFH  84

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFYVAAPLTS+DLSLSSG++IVIEERSPKELL++ GGLGEQ+AASGISVWNPAFDVTP
Sbjct  85   NVPFYVAAPLTSIDLSLSSGEEIVIEERSPKELLNSRGGLGEQVAASGISVWNPAFDVTP  144

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVHK  317
            A++ISGIITEKGVI+K    DAFDI  F+ K
Sbjct  145  ANIISGIITEKGVITKSSAADAFDIKAFIQK  175



>ref|XP_004488081.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Cicer 
arietinum]
Length=372

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 2/152 (1%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLIADSAAAALM+AGRV+AV+VGADR+A+NGDTANKIGTYS+A+CA  H V
Sbjct  221  ELVHDKIPATLIADSAAAALMQAGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFHNV  280

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPLTS+DLSLSSG+QIVIEERSPKELL+T GGLGEQ+AASGISVWNPAFDVTPA+
Sbjct  281  PFYVAAPLTSIDLSLSSGKQIVIEERSPKELLNTRGGLGEQVAASGISVWNPAFDVTPAN  340

Query  400  LISGIITEKGVISKD--GNDAFDITGFVHKVS  311
            LISGIITEKGVI+K   G+ +FDI  FV K S
Sbjct  341  LISGIITEKGVITKTSAGDASFDIKTFVQKTS  372



>gb|AES65569.2| methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=372

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLIADSAAAALM+AGRV+AV+VGADR+A+NGDTANKIGTYS+A+CA  H V
Sbjct  222  ELVHDKIPATLIADSAAAALMQAGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFHNV  281

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAPLTS+DLSLSSGQQIVIEERSPKELL+  GGLGEQ+AASGISVWNPAFDVTPA+
Sbjct  282  PFFVAAPLTSIDLSLSSGQQIVIEERSPKELLNMRGGLGEQVAASGISVWNPAFDVTPAN  341

Query  400  LISGIITEKGVISKD-GNDAFDITGFVHK  317
            LISGIITEKGVI+K    DAFDI  FV K
Sbjct  342  LISGIITEKGVITKTPAGDAFDIKAFVQK  370



>gb|KHN12290.1| Methylthioribose-1-phosphate isomerase [Glycine soja]
Length=372

 Score =   218 bits (555),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 135/151 (89%), Gaps = 1/151 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IP TLIADSAAAALMKAG V+AV+VGADR+A+NGDTANKIGTYS+A+ A  H
Sbjct  220  AFELVHEKIPGTLIADSAAAALMKAGHVDAVVVGADRVASNGDTANKIGTYSVALSAKFH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFYVAAPLTS+DLSLSSGQ+IVIEERSPKELL+THGGLGEQIAASGISVWNPAFDVTP
Sbjct  280  NVPFYVAAPLTSIDLSLSSGQEIVIEERSPKELLNTHGGLGEQIAASGISVWNPAFDVTP  339

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVHK  317
            A+LISGIITEKGVI+K    DAFDI  FV K
Sbjct  340  ANLISGIITEKGVITKTSAGDAFDIKAFVQK  370



>ref|XP_002277806.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 ref|XP_010656105.1| PREDICTED: methylthioribose-1-phosphate isomerase [Vitis vinifera]
 sp|D7TCD0.2|MTNA_VITVI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Vitis 
vinifera]
Length=376

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATLIADSAAAALM+AGRV+AVIVGADR+AANGDTANKIGTYSLA+ A HH
Sbjct  221  AFELVHDNIPATLIADSAAAALMQAGRVDAVIVGADRVAANGDTANKIGTYSLALSAKHH  280

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTS+DL+LSSGQ+IVIEERSPKELL++ GGLGEQ+AASGI VWNPAFDVTP
Sbjct  281  HIPFFVAAPLTSIDLTLSSGQEIVIEERSPKELLNSRGGLGEQVAASGICVWNPAFDVTP  340

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGNV  302
            A LI+GIITEKGVI+K G D FDI  F+H  + + 
Sbjct  341  ADLIAGIITEKGVITKTG-DVFDIKDFIHNATSHC  374



>emb|CBI27788.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPATLIADSAAAALM+AGRV+AVIVGADR+AANGDTANKIGTYSLA+ A HH
Sbjct  263  AFELVHDNIPATLIADSAAAALMQAGRVDAVIVGADRVAANGDTANKIGTYSLALSAKHH  322

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAPLTS+DL+LSSGQ+IVIEERSPKELL++ GGLGEQ+AASGI VWNPAFDVTP
Sbjct  323  HIPFFVAAPLTSIDLTLSSGQEIVIEERSPKELLNSRGGLGEQVAASGICVWNPAFDVTP  382

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGNV  302
            A LI+GIITEKGVI+K G D FDI  F+H  + + 
Sbjct  383  ADLIAGIITEKGVITKTG-DVFDIKDFIHNATSHC  416



>ref|XP_006474713.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Citrus 
sinensis]
 gb|KDO73877.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
 gb|KDO73878.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=373

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CA  H
Sbjct  221  AFELVHDRIPATLIADSAAAALMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFH  280

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL + GGLGEQ+AASGISVWNPAFDVTP
Sbjct  281  NILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTP  340

Query  406  ASLISGIITEKGVISKDG-NDAFDITGFVHKVS  311
            A+LI+GIITEKGV++K G +DAFDI  F+ K +
Sbjct  341  ANLITGIITEKGVVTKAGADDAFDIKDFIQKTA  373



>ref|XP_006452822.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66062.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=373

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CA  H
Sbjct  221  AFELVHDRIPATLIADSAAAALMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFH  280

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL + GGLGEQ+AASGISVWNPAFDVTP
Sbjct  281  NILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTP  340

Query  406  ASLISGIITEKGVISKDG-NDAFDITGFVHKVS  311
            A+LI+GIITEKGV++K G +DAFDI  F+ K +
Sbjct  341  ANLITGIITEKGVVTKAGADDAFDIKDFIQKTA  373



>ref|XP_007138649.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
 gb|ESW10643.1| hypothetical protein PHAVU_009G226400g [Phaseolus vulgaris]
Length=373

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP+TLIADSAAAALMKAG V+AV+VGADR+A+NGDTANKIGTYS+A+ A  H V
Sbjct  223  ELVHEKIPSTLIADSAAAALMKAGSVDAVVVGADRVASNGDTANKIGTYSVALFAKFHNV  282

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPLTSVDLSLSSGQ+IVIEERSPKELL+  GGLGEQ+AASGISVWNPAFDVTPA+
Sbjct  283  PFYVAAPLTSVDLSLSSGQEIVIEERSPKELLNARGGLGEQVAASGISVWNPAFDVTPAN  342

Query  400  LISGIITEKGVISK-DGNDAFDITGFVHK  317
            LISGIITEKGVI+K    DAFDI  FV K
Sbjct  343  LISGIITEKGVITKTSAGDAFDIKAFVQK  371



>ref|XP_004979099.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Setaria 
italica]
Length=367

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  215  AFELVHEKIPATLIADSAAAALMKQGRVQAVIVGADRIAANGDTANKIGTYNLAISAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DL+L SG++IVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  GVQFYVAAPVTSIDLTLPSGEEIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKGVI+K DG+ AFDI GF+ 
Sbjct  335  ANLITAIITEKGVITKTDGDGAFDIKGFIQ  364



>ref|XP_003595318.1| Methylthioribose-1-phosphate isomerase [Medicago truncatula]
Length=382

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 135/159 (85%), Gaps = 11/159 (7%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLIADSAAAALM+AGRV+AV+VGADR+A+NGDTANKIGTYS+A+CA  H V
Sbjct  222  ELVHDKIPATLIADSAAAALMQAGRVDAVVVGADRVASNGDTANKIGTYSVALCAKFHNV  281

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAPLTS+DLSLSSGQQIVIEERSPKELL+  GGLGEQ+AASGISVWNPAFDVTPA+
Sbjct  282  PFFVAAPLTSIDLSLSSGQQIVIEERSPKELLNMRGGLGEQVAASGISVWNPAFDVTPAN  341

Query  400  LISGIITEK----------GVISKD-GNDAFDITGFVHK  317
            LISGIITEK          GVI+K    DAFDI  FV K
Sbjct  342  LISGIITEKVCLTSSVSCMGVITKTPAGDAFDIKAFVQK  380



>gb|KDO73876.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=374

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 2/154 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CA  H
Sbjct  221  AFELVHDRIPATLIADSAAAALMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFH  280

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL + GGLGEQ+AASGISVWNPAFDVTP
Sbjct  281  NILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTP  340

Query  406  ASLISGIITEK-GVISKDG-NDAFDITGFVHKVS  311
            A+LI+GIITEK GV++K G +DAFDI  F+ K +
Sbjct  341  ANLITGIITEKQGVVTKAGADDAFDIKDFIQKTA  374



>gb|EMS50123.1| Methylthioribose-1-phosphate isomerase [Triticum urartu]
Length=367

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALM  G+V AVIVGADRIAANGDTANKIGTY+L++ A HH
Sbjct  215  AFELVHDKIPATLIADSAAAALMNNGQVQAVIVGADRIAANGDTANKIGTYNLSISAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL SG+QIVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  GVQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVHK  317
            A+LI+ IITEKGVI+K D N +FDI GF+ +
Sbjct  335  ANLITAIITEKGVITKSDPNGSFDIKGFIER  365



>ref|XP_003577698.1| PREDICTED: methylthioribose-1-phosphate isomerase [Brachypodium 
distachyon]
Length=368

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALM  G++ AVIVGADRIAANGDTANKIGTY+L++ A HH
Sbjct  216  AFELVHDKIPATLIADSAAAALMNNGQIQAVIVGADRIAANGDTANKIGTYNLSISAKHH  275

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL+SG+QIVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  276  GVEFYVAAPVTSIDLSLASGKQIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  335

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKGVI+K D N  FDI GF+ 
Sbjct  336  ANLITAIITEKGVITKSDPNGTFDIKGFIK  365



>gb|ADE77025.1| unknown [Picea sitchensis]
Length=384

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL+ ++IPA LIADSAAAAL K+GRV+A+IVGADRIA NGDTANKIGTY+LA+ A HHG+
Sbjct  225  ELIHDHIPAVLIADSAAAALQKSGRVDAIIVGADRIAENGDTANKIGTYNLALSAFHHGI  284

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPLTSVDLSLSSG+QI+IEERSPKEL H  GG G+Q+A SGISVWNPAFDVTPA+
Sbjct  285  PFYVAAPLTSVDLSLSSGEQIIIEERSPKELTHALGGQGQQVAPSGISVWNPAFDVTPAN  344

Query  400  LISGIITEKGVIS-KDGNDAFDITGFV  323
            LI+ IITEKGVI+ KD +  FDI GFV
Sbjct  345  LITAIITEKGVITKKDSSTTFDIKGFV  371



>gb|KJB82984.1| hypothetical protein B456_013G223100 [Gossypium raimondii]
Length=367

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK  RV+AVIVGADR+ ANGDTANKIGTYSLA+CAMHH
Sbjct  227  AFELVHEKIPATLIADSAAAALMKEDRVDAVIVGADRVTANGDTANKIGTYSLALCAMHH  286

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSGQ+IVIEERS KELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  287  HIPFYVAAPLTSIDLSLSSGQEIVIEERSAKELLHTRGGLGEQVAASGISVWNPAFDVTP  346

Query  406  ASLISGIITEK  374
            A+LI+GIITEK
Sbjct  347  ANLIAGIITEK  357



>ref|XP_006662829.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Oryza 
brachyantha]
Length=367

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  215  AFELVHEKIPATLIADSAAAALMKNGRVQAVIVGADRIAANGDTANKIGTYNLAISAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL SG +IVIEERSPKELL+T GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  GVQFYVAAPVTSIDLSLPSGDEIVIEERSPKELLNTEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKG+++K D ++ F+I  F+ 
Sbjct  335  ANLITAIITEKGLVTKSDADETFNIKDFMQ  364



>ref|XP_009406483.1| PREDICTED: methylthioribose-1-phosphate isomerase {ECO:0000255|HAMAP-Rule:MF_03119} 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSA AALMKAG VNAVIVGADRIAANGDTANKIGTY++A+ A HH
Sbjct  227  AFELVHDRIPATLIADSAVAALMKAGCVNAVIVGADRIAANGDTANKIGTYNVALSAFHH  286

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+ FYVAAP+TS+DLS+SSG+QIVIEERS KELLH+ GG G+Q+AASGISVWNPAFDVTP
Sbjct  287  GIQFYVAAPITSIDLSISSGEQIVIEERSAKELLHSDGGRGKQVAASGISVWNPAFDVTP  346

Query  406  ASLISGIITEKGVISKDGND-AFDITGFVH  320
            A LI+ IITEKGVI K  +D AFDI GF+ 
Sbjct  347  ARLITAIITEKGVIIKKASDEAFDIKGFIE  376



>ref|XP_007012614.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOY30233.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 2 
[Theobroma cacao]
Length=458

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CAM+H
Sbjct  269  AFELVHEKIPATLIADSAAAALMKEGRVSAVIVGADRVAANGDTANKIGTYSLAICAMYH  328

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSGQ+I+IEERS KELLHT GGLGEQ+AASGISVWNPAFDVTP
Sbjct  329  HIPFYVAAPLTSIDLSLSSGQEIIIEERSAKELLHTRGGLGEQVAASGISVWNPAFDVTP  388

Query  406  ASLISGIITEKGVIS  362
            A+LI+GIITEK  +S
Sbjct  389  ANLIAGIITEKVSLS  403



>ref|XP_001754539.1| predicted protein [Physcomitrella patens]
 gb|EDQ80509.1| predicted protein, partial [Physcomitrella patens]
Length=362

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPA L+ADSAAA+L   GRV+AV+VGADRIAANGDTANKIGTYSLA+ A HH
Sbjct  211  AFELVHDKIPAILVADSAAASLQSLGRVDAVVVGADRIAANGDTANKIGTYSLALSAFHH  270

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPFYVA+PLT++D +  SG++I+IEERSPKEL H+HGG G QIAA G+ VWNPAFDVTP
Sbjct  271  GVPFYVASPLTTIDTATKSGKEIIIEERSPKELTHSHGGQGTQIAADGVGVWNPAFDVTP  330

Query  406  ASLISGIITEKGVISKDGN-DAFDITGFVHK  317
            A LI+GIIT++GVI+K+GN D FDI  F+ +
Sbjct  331  ARLITGIITDQGVITKEGNSDVFDIPSFIAR  361



>sp|B6TZD1.1|MTNA_MAIZE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=ZmIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Zea mays]
 gb|ACG42464.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AFW60581.1| methylthioribose-1-phosphate isomerase isoform 1 [Zea mays]
 gb|AFW60582.1| methylthioribose-1-phosphate isomerase isoform 2 [Zea mays]
Length=367

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK G V AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  215  AFELVHEKIPATLIADSAAAALMKQGHVQAVIVGADRIAANGDTANKIGTYNLAISAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             V FYV+AP+TS+DLSL SG +IVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  SVQFYVSAPVTSIDLSLPSGDEIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFV  323
            A+LI+ IITEKGVI+K D + +FDI GF+
Sbjct  335  ANLITAIITEKGVITKTDADGSFDIKGFL  363



>ref|XP_010541997.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Tarenaya hassleriana]
Length=367

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 131/153 (86%), Gaps = 7/153 (5%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATLIADSAAAALM  GRV+AVIVGADR+A+NGDTANKIGTYSLA+CA HH
Sbjct  219  AFELVHETPPATLIADSAAAALMNDGRVDAVIVGADRVASNGDTANKIGTYSLALCAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTS+DLSLSSG++IVIEERSPKELL+THGGLGE+I ASGISVWNPA     
Sbjct  279  GIPFYVAAPLTSIDLSLSSGKEIVIEERSPKELLNTHGGLGERIGASGISVWNPA----X  334

Query  406  ASLISGIITEKGVISKDGNDA--FDITGFVHKV  314
            A L+SGIITEKGVI+K G DA  FDI  F  K+
Sbjct  335  AELVSGIITEKGVITK-GTDASSFDIRSFARKM  366



>gb|EMT32201.1| Methylthioribose-1-phosphate isomerase [Aegilops tauschii]
Length=452

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 133/150 (89%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALM  G+V AVIVGADRIAANGDTANKIGTY+L++ A HH
Sbjct  300  AFELVHDKIPATLIADSAAAALMNNGQVQAVIVGADRIAANGDTANKIGTYNLSISAKHH  359

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+ FYVAAP+TS+DLSL SG+QIVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  360  GMQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  419

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKGVI+K D N +FDI GF+ 
Sbjct  420  ANLITAIITEKGVITKSDPNGSFDIKGFIE  449



>dbj|BAJ86257.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALM  G+V AVIVGADRIAANGDTANKIGTY+L++ A HH
Sbjct  215  AFELVHDKIPATLIADSAAAALMNNGQVQAVIVGADRIAANGDTANKIGTYNLSIAAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL SG+QIVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  GVQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKGVI+K D +  FDI  F+ 
Sbjct  335  ANLITAIITEKGVITKSDPDGTFDIKSFIE  364



>sp|Q9AYT7.1|MTNA_HORVU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=HvIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Hordeum vulgare]
 dbj|BAB21393.1| IDI2 [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALM  G+V AVIVGADRIAANGDTANKIGTY+L++ A HH
Sbjct  215  AFELVHDKIPATLIADSAAAALMNNGQVQAVIVGADRIAANGDTANKIGTYNLSIAAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL SG+QIVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  GVQFYVAAPVTSIDLSLPSGKQIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A LI+ IITEKGVI+K D +  FDI  F+ 
Sbjct  335  ADLITAIITEKGVITKSDPDGTFDIKSFIE  364



>ref|NP_001105275.1| methylthioribose-1-phosphate isomerase [Zea mays]
 gb|AAU86895.1| isopentenyl-diphosphate delta isomerase 2 [Zea mays]
Length=367

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK G V AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  215  AFELVHEKIPATLIADSAAAALMKQGHVQAVIVGADRIAANGDTANKIGTYNLAISAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             V  YVAAP+TS+DLSL SG +IVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  SVQVYVAAPVTSIDLSLPSGDEIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFV  323
            A+LI+ IITEKGVI+K D + +FDI GF+
Sbjct  335  ANLITAIITEKGVITKTDADGSFDIKGFL  363



>gb|ACG37871.1| methylthioribose-1-phosphate isomerase [Zea mays]
Length=367

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK G V AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  215  AFELVHEKIPATLIADSAAAALMKQGHVQAVIVGADRIAANGDTANKIGTYNLAISAKHH  274

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             V  YVAAP+TS+DLSL SG +IVIEERSPKELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  275  SVQVYVAAPVTSIDLSLPSGDEIVIEERSPKELLNSEGGLGKQVAASGISVWNPAFDVTP  334

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFV  323
            A+LI+ IITEKGVI+K D + +FDI GF+
Sbjct  335  ANLITAIITEKGVITKTDADGSFDIKGFL  363



>ref|NP_001067511.1| Os11g0216900 [Oryza sativa Japonica Group]
 sp|Q0ITU1.1|MTNA_ORYSJ RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=Protein IRON DEFICIENCY 
INDUCIBLE 2; Short=OsIDI2; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation 
initiation factor eIF-2B subunit alpha/beta/delta-like protein 
[Oryza sativa Japonica Group]
 dbj|BAF27874.1| Os11g0216900 [Oryza sativa Japonica Group]
 tpd|FAA00313.1| TPA: eukaryotic translation initiation factor 2B-like putative 
methylthioribose-1-phosphate isomerase [Oryza sativa Japonica 
Group]
 gb|EEE51856.1| hypothetical protein OsJ_33377 [Oryza sativa Japonica Group]
Length=374

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PATLIADSAAAALMK+G + AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  216  AFELVHDKVPATLIADSAAAALMKSGCIQAVIVGADRIAANGDTANKIGTYNLAISAKHH  275

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL SG+QIVIEERSP ELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  276  GVQFYVAAPITSIDLSLPSGEQIVIEERSPNELLNSEGGLGKQVAASGISVWNPAFDVTP  335

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKGVI+K D ++ F+I  F+ 
Sbjct  336  ANLITAIITEKGVITKSDADETFNIKDFIQ  365



>sp|A2ZCP0.1|MTNA_ORYSI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Oryza 
sativa Indica Group]
 gb|EAY80374.1| hypothetical protein OsI_35550 [Oryza sativa Indica Group]
Length=374

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PATLIADSAAAALMK+G + AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  216  AFELVHDKVPATLIADSAAAALMKSGCIQAVIVGADRIAANGDTANKIGTYNLAISAKHH  275

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL SG+QIVIEERSP ELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  276  GVQFYVAAPITSIDLSLPSGEQIVIEERSPNELLNSEGGLGKQVAASGISVWNPAFDVTP  335

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKGVI+K D ++ F+I  F+ 
Sbjct  336  ANLITAIITEKGVITKSDADETFNIKDFIQ  365



>ref|XP_006842716.1| hypothetical protein AMTR_s00147p00099160 [Amborella trichopoda]
 gb|ERN04391.1| hypothetical protein AMTR_s00147p00099160 [Amborella trichopoda]
Length=372

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLI DSAAAALMKAGRV+AVIVGADRIAANGDTANKIGTYS A+ A +HGV
Sbjct  226  ELVHDKIPATLITDSAAAALMKAGRVDAVIVGADRIAANGDTANKIGTYSHAISASYHGV  285

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+DLSL+SG QI IEERS KEL H  GG GEQ+  +GIS WNPAFDVTPAS
Sbjct  286  PFYVAAPFTSIDLSLTSGDQITIEERSAKELTHARGGQGEQVVVNGISAWNPAFDVTPAS  345

Query  400  LISGIITEKGVISKDGNDAFDITGFVH  320
            LI+ IITEKGVI+K   + F I  F+H
Sbjct  346  LITAIITEKGVITKASANDFKIRDFIH  372



>gb|ABA92066.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA92067.2| Initiation factor 2 subunit family protein, expressed [Oryza 
sativa Japonica Group]
Length=508

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 132/150 (88%), Gaps = 1/150 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PATLIADSAAAALMK+G + AVIVGADRIAANGDTANKIGTY+LA+ A HH
Sbjct  350  AFELVHDKVPATLIADSAAAALMKSGCIQAVIVGADRIAANGDTANKIGTYNLAISAKHH  409

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP+TS+DLSL SG+QIVIEERSP ELL++ GGLG+Q+AASGISVWNPAFDVTP
Sbjct  410  GVQFYVAAPITSIDLSLPSGEQIVIEERSPNELLNSEGGLGKQVAASGISVWNPAFDVTP  469

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVH  320
            A+LI+ IITEKGVI+K D ++ F+I  F+ 
Sbjct  470  ANLITAIITEKGVITKSDADETFNIKDFIQ  499



>ref|XP_002992382.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
 gb|EFJ06532.1| hypothetical protein SELMODRAFT_135203, partial [Selaginella 
moellendorffii]
Length=368

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPA L+ADSAAA+L  +GRV+AVIVGADR+AANGDTANKIGTYSLAV A  H
Sbjct  219  AFELVHDNIPAVLVADSAAASLQSSGRVDAVIVGADRVAANGDTANKIGTYSLAVSASRH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PF VAAPLTSVDLS+SSG QI IEERS  EL HT GG G ++AA GISVWNPAFDVTP
Sbjct  279  GIPFLVAAPLTSVDLSISSGDQISIEERSALELTHTQGGQGHRVAAEGISVWNPAFDVTP  338

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFV  323
            A+LIS IIT+KGVI+K D +  FDI  FV
Sbjct  339  AALISAIITDKGVITKADESGTFDIPAFV  367



>ref|XP_002967758.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
 gb|EFJ31105.1| hypothetical protein SELMODRAFT_87975, partial [Selaginella moellendorffii]
Length=368

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV +NIPA L+ADSAAA+L  +GRV+AVIVGADR+AANGDTANKIGTYSLAV A  H
Sbjct  219  AFELVHDNIPAVLVADSAAASLQSSGRVDAVIVGADRVAANGDTANKIGTYSLAVSASRH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PF VAAPLTSVDLS+SSG QI IEERS  EL HT GG G ++AA GISVWNPAFDVTP
Sbjct  279  GIPFLVAAPLTSVDLSISSGDQISIEERSALELTHTQGGQGHRVAAEGISVWNPAFDVTP  338

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFV  323
            A+LIS IIT+KGVI+K D +  FDI  FV
Sbjct  339  AALISAIITDKGVITKADESGTFDIPAFV  367



>gb|KDO73879.1| hypothetical protein CISIN_1g017293mg [Citrus sinensis]
Length=358

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CA  H
Sbjct  221  AFELVHDRIPATLIADSAAAALMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFH  280

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL + GGLGEQ+AASGISVWNPAFDVTP
Sbjct  281  NILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTP  340

Query  406  ASLISGIITEKGVIS  362
            A+LI+GIITEK  +S
Sbjct  341  ANLITGIITEKVSVS  355



>ref|XP_006452823.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
 gb|ESR66063.1| hypothetical protein CICLE_v10008682mg [Citrus clementina]
Length=358

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK GRV+AVIVGADR+AANGDTANKIGTYSLA+CA  H
Sbjct  221  AFELVHDRIPATLIADSAAAALMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFH  280

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             + FYVAAPLTS+DL+LSSGQ+IVIEERS KELL + GGLGEQ+AASGISVWNPAFDVTP
Sbjct  281  NILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTP  340

Query  406  ASLISGIITEKGVIS  362
            A+LI+GIITEK  +S
Sbjct  341  ANLITGIITEKVSVS  355



>gb|KJB07314.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
 gb|KJB07316.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
Length=325

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK  R++AVIVGAD +AANGDTANKI TYSLAVCAMHH
Sbjct  170  AFELVHDKIPATLIADSAAAALMKESRLSAVIVGADPVAANGDTANKIRTYSLAVCAMHH  229

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFY+AA L+S+DLSLSSG++IVIEERS KELLH+ GGLGEQ+AASGI VWNPAFDVTP
Sbjct  230  HIPFYIAASLSSIDLSLSSGEEIVIEERSSKELLHSRGGLGEQVAASGILVWNPAFDVTP  289

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GI+TEKGVI+K+ NDAF+I  FV K +G 
Sbjct  290  AYLITGIVTEKGVITKN-NDAFNIKDFVEKAAGK  322



>gb|EPS64192.1| methylthioribose-1-phosphate isomerase, partial [Genlisea aurea]
Length=341

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV ++IPATLIADSAAAALM AGRV+ V+VGADR+AANGDTANKIGTYSL++ A HH
Sbjct  211  AFELVHDSIPATLIADSAAAALMNAGRVDVVVVGADRVAANGDTANKIGTYSLSLSAAHH  270

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPLTSVDL L SG++I IEERSP+ELL+  GGLGE++AASGISVWNPAFDVTP
Sbjct  271  GIPFYVAAPLTSVDLLLPSGKEIAIEERSPEELLNARGGLGERVAASGISVWNPAFDVTP  330

Query  406  ASLISGIITEK  374
            A+LISGIITEK
Sbjct  331  AALISGIITEK  341



>emb|CBV37018.1| 5-methylthioribose-1-phosphate isomerase [Plantago major]
Length=163

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK G V+AVIVGADR+AANGDTANKIGTY+LA+CAMH 
Sbjct  48   AFELVHEKIPATLIADSAAAALMKGGHVSAVIVGADRVAANGDTANKIGTYNLALCAMHG  107

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAF  419
             +PFYVAAPLTSVDL+LSSGQ+IVIEERSPKELL+  GGLGEQ+AASGISVWNPAF
Sbjct  108  HIPFYVAAPLTSVDLTLSSGQEIVIEERSPKELLNAEGGLGEQVAASGISVWNPAF  163



>gb|KHG23802.1| Methylthioribose-1-phosphate isomerase [Gossypium arboreum]
Length=215

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 118/154 (77%), Gaps = 22/154 (14%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK  RV+AVIVGADR+AANGDTANKIGTYSLA+CAMHH
Sbjct  81   AFELVHDKIPATLIADSAAAALMKESRVSAVIVGADRVAANGDTANKIGTYSLALCAMHH  140

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPLTS+DLSLSSG++IVIEERS KELLH+ GGLGEQ+AASGI           
Sbjct  141  HIPFYVAAPLTSIDLSLSSGEEIVIEERSAKELLHSQGGLGEQVAASGI-----------  189

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
                       GVI+K+ NDAF+I  FV K +G 
Sbjct  190  ----------LGVITKN-NDAFNIKDFVEKAAGK  212



>ref|XP_004993054.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
 gb|EGD74153.1| methylthioribose-1-phosphate isomerase [Salpingoeca rosetta]
Length=378

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 114/149 (77%), Gaps = 4/149 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELVTE IP+TL+ADS  + LMK   ++AV+VGADR+ ANGDTANKIGTY +A+ A HHGV
Sbjct  226  ELVTEKIPSTLVADSMVSVLMKEKDISAVVVGADRVVANGDTANKIGTYQIAIAAKHHGV  285

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP+TSVDL L  G  IVIEER   EL H     G+++AA GI+ WNPAFDVTPAS
Sbjct  286  PFYVAAPITSVDLDLPDGSHIVIEERKGDELTHI---FGKRLAAPGINTWNPAFDVTPAS  342

Query  400  LISGIITEKGVISK-DGNDAFDITGFVHK  317
            LI+GI+TE+GV+ K DG   FD+  FV +
Sbjct  343  LITGIVTERGVVKKPDGAPEFDMHAFVQE  371



>ref|XP_001742754.1| hypothetical protein [Monosiga brevicollis MX1]
 sp|A9UQ62.1|MTNA_MONBE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Monosiga 
brevicollis]
 gb|EDQ92992.1| predicted protein [Monosiga brevicollis MX1]
Length=361

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 4/152 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELVTE IP TL+ADS  + LMK   ++AV+VGADR+ ANGDTANKIGTY +A+ A HH
Sbjct  210  AYELVTEGIPGTLVADSMVSLLMKQKGISAVVVGADRVVANGDTANKIGTYQIAIAAKHH  269

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPF+VAAPLTSVDL LS G +I IEER  KEL H     G+Q+AA GI  WNPAFDVTP
Sbjct  270  GVPFFVAAPLTSVDLKLSHGSEITIEERPGKELTHI---FGQQLAAPGIGTWNPAFDVTP  326

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVHKV  314
            A LI+GIITE+GV  K +G   FD+  F   V
Sbjct  327  ADLITGIITERGVAYKAEGQQEFDMASFAASV  358



>gb|KJB07315.1| hypothetical protein B456_001G015800 [Gossypium raimondii]
Length=298

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLIADSAAAALMK  R++AVIVGAD +AANGDTANKI TYSLAVCAMHH
Sbjct  170  AFELVHDKIPATLIADSAAAALMKESRLSAVIVGADPVAANGDTANKIRTYSLAVCAMHH  229

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFY+AA L+S+DLSLSSG++IVIEERS KELLH+ GGLGEQ+AASGI VWNPAFDVTP
Sbjct  230  HIPFYIAASLSSIDLSLSSGEEIVIEERSSKELLHSRGGLGEQVAASGILVWNPAFDVTP  289

Query  406  ASLISG  389
            A LI+G
Sbjct  290  AYLITG  295



>gb|EHJ70136.1| eIF2B-alpha-like protein [Danaus plexippus]
Length=351

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 109/136 (80%), Gaps = 5/136 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATL+ DS  AA+M A  ++AV+VGADR+AANGDTANKIGTY +A+ A HH V
Sbjct  213  ELVHEKIPATLVVDSMVAAIMHARNISAVVVGADRVAANGDTANKIGTYQIAIVAKHHNV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAPLTS+D+SL SG +I IEER  +E+ H    +GE +IAA GI+ WNP+FDVTPA
Sbjct  273  PFYVAAPLTSIDMSLKSGDRIKIEERPDREMTH----IGEHRIAAPGINCWNPSFDVTPA  328

Query  403  SLISGIITEKGVISKD  356
            +LI+GIITEKGV + D
Sbjct  329  ALITGIITEKGVFAPD  344



>ref|XP_011184740.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184741.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184742.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184743.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
 ref|XP_011184744.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
cucurbitae]
Length=356

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 108/134 (81%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + +PATL+ DS  AALM+A  + AV+VGADR+AANGDTANKIGTY +AV A HHGV
Sbjct  213  ELVHDKLPATLVLDSMVAALMRAKNIAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PF+VAAPLTS+DL + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPA
Sbjct  273  PFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPA  328

Query  403  SLISGIITEKGVIS  362
            SLISGIITE+GV S
Sbjct  329  SLISGIITERGVFS  342



>ref|XP_002072272.1| GK22419 [Drosophila willistoni]
 sp|B4NG41.1|MTNA_DROWI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
willistoni]
 gb|EDW83258.1| GK22419 [Drosophila willistoni]
Length=365

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 107/135 (79%), Gaps = 5/135 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+AANGDTANKIGTY +AV A HH
Sbjct  220  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHH  279

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
            GVPFYVAAPLTS+DL + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  280  GVPFYVAAPLTSIDLQIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  335

Query  409  PASLISGIITEKGVI  365
            PASLI+GIITE+GV 
Sbjct  336  PASLITGIITERGVF  350



>ref|XP_004530069.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Ceratitis capitata]
 ref|XP_004530070.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Ceratitis capitata]
 ref|XP_004530071.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X3 [Ceratitis capitata]
Length=356

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + +PATL+ DS  AALM+A  + AV+VGADR+AANGDTANKIGTY +AV A HHGV
Sbjct  213  ELVHDKLPATLVLDSMVAALMRAKNIAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PF+VAAPLTS+DL + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPA
Sbjct  273  PFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPA  328

Query  403  SLISGIITEKGVIS  362
            +LISGIITE+GV S
Sbjct  329  ALISGIITERGVFS  342



>ref|XP_011210381.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
dorsalis]
 ref|XP_011210382.1| PREDICTED: methylthioribose-1-phosphate isomerase [Bactrocera 
dorsalis]
Length=356

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (81%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + +PATL+ DS  AALM+A  + AV+VGADR+AANGDTANKIGTY +AV A HHGV
Sbjct  213  ELVHDKLPATLVLDSMVAALMRAKNIAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PF+VAAPLTS+DL + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPA
Sbjct  273  PFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPA  328

Query  403  SLISGIITEKGVIS  362
            +LISGIITE+GV S
Sbjct  329  ALISGIITERGVFS  342



>ref|NP_001037650.1| methylthioribose-1-phosphate isomerase [Bombyx mori]
 sp|Q0ZB81.1|MTNA_BOMMO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Bombyx 
mori]
 gb|ABG54283.1| eIF2B-alpha-like protein [Bombyx mori]
Length=364

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 109/136 (80%), Gaps = 5/136 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP+TL+ DS  +ALM   +++AVIVGADR+AANGDTANK+GTY +A+ A +H V
Sbjct  213  ELVHEKIPSTLMVDSMVSALMHTRKIHAVIVGADRVAANGDTANKMGTYQIAIVAKYHDV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAPLTS+D+SL  G++I IEER  +E+ H    +GE +IAA GI+ WNP+FDVTPA
Sbjct  273  PFYVAAPLTSIDMSLPYGEKIKIEERPDREMTH----IGEHRIAAPGINCWNPSFDVTPA  328

Query  403  SLISGIITEKGVISKD  356
            SLI+GIITEKGV + D
Sbjct  329  SLIAGIITEKGVFAPD  344



>ref|XP_001357949.1| GA10928 [Drosophila pseudoobscura pseudoobscura]
 sp|Q29BB3.1|MTNA_DROPS RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
pseudoobscura pseudoobscura]
 gb|EAL27085.1| GA10928 [Drosophila pseudoobscura pseudoobscura]
Length=362

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+AANGDTANKIGTY +AV A HH
Sbjct  217  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHH  276

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
            GVPF+VAAPLTS+DL + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  277  GVPFFVAAPLTSIDLHIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  332

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  333  PASLITGIITERGVFQ  348



>ref|XP_002023756.1| GL27236 [Drosophila persimilis]
 sp|B4GYU1.1|MTNA_DROPE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
persimilis]
 gb|EDW27959.1| GL27236 [Drosophila persimilis]
Length=362

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+AANGDTANKIGTY +AV A HH
Sbjct  217  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHH  276

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
            GVPF+VAAPLTS+DL + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  277  GVPFFVAAPLTSIDLHIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  332

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  333  PASLITGIITERGVFQ  348



>ref|XP_005185612.1| PREDICTED: methylthioribose-1-phosphate isomerase [Musca domestica]
 ref|XP_005185613.1| PREDICTED: methylthioribose-1-phosphate isomerase [Musca domestica]
Length=356

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 107/134 (80%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + +PATL+ DS  AAL++A  V AV+VGADR+AANGDTANKIGTY +AV A HHGV
Sbjct  213  ELVHDKLPATLVLDSMVAALLRAKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PF+VAAPLTS+DL + SG  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVTPA
Sbjct  273  PFFVAAPLTSIDLQIPSGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVTPA  328

Query  403  SLISGIITEKGVIS  362
            SLI+GIITE+GV  
Sbjct  329  SLITGIITERGVFK  342



>emb|CDS04006.1| hypothetical protein LRAMOSA06961 [Absidia idahoensis var. thermophila]
Length=372

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 116/154 (75%), Gaps = 8/154 (5%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAG-RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHG  584
            ELV E+IPATLI DS A+AL++    V A+IVGADR+AANGDTANKIGTY LA+ A HHG
Sbjct  218  ELVYESIPATLICDSMASALLRLNPSVQAIIVGADRVAANGDTANKIGTYQLAITAKHHG  277

Query  583  VPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQ------IAASGISVWNPA  422
            + F VAAP TS+DLS+SSG++IVIEER  KEL+ T G L ++       AA GI VWNP+
Sbjct  278  ILFIVAAPSTSIDLSMSSGKEIVIEERPAKELVTTTGVLDDKSSATVHTAAEGIQVWNPS  337

Query  421  FDVTPASLISGIITEKGV-ISKDGNDAFDITGFV  323
            FDVTP+ LIS I+TEKGV + + G+  FD+  F+
Sbjct  338  FDVTPSELISAIVTEKGVAVKQSGHTEFDLAAFL  371



>ref|XP_001418690.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 sp|A4S068.1|MTNA_OSTLU RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO96983.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=365

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IP TLI D+ AAALM  G V+A++VGADR+AANGD ANKIGTYSLAV A HH
Sbjct  214  AYELVYEKIPGTLICDNMAAALMARGDVDAIVVGADRVAANGDFANKIGTYSLAVNAKHH  273

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVP + AAP+T++D   ++G  I IEER  +E+ H+   LG+++AA GI VWNP+FDVTP
Sbjct  274  GVPMFTAAPVTTLDPETATGADIHIEERPGEEVTHS---LGKRVAAEGIDVWNPSFDVTP  330

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            A+L++G+ITE GVI K+ +  F +  FV +  G
Sbjct  331  AALLTGVITEHGVIEKNASGLFPVADFVAQAKG  363



>emb|CEF98703.1| Putative translation initiation factor,aIF-2BI/5-methylthioribose-1-phosphate 
isomerase [Ostreococcus tauri]
Length=798

 Score =   160 bits (405),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP TLI D+ AAALM  G V+A++VGADR+AANGD ANKIGTYSLAV A HHGV
Sbjct  216  ELVYEKIPGTLICDNMAAALMARGDVDAIVVGADRVAANGDFANKIGTYSLAVNAKHHGV  275

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            P + AAP+T++D   ++G  I IEER   E+ H+   LG+++AA GI VWNP+FDVTPA+
Sbjct  276  PMFTAAPVTTLDPETATGADIHIEERPADEVTHS---LGKRVAAEGIDVWNPSFDVTPAA  332

Query  400  LISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            L+SGIITE GVI K+    F ++ FV  V G
Sbjct  333  LLSGIITESGVIEKNVKGFFPVSEFVANVKG  363



>ref|XP_001641945.1| predicted protein [Nematostella vectensis]
 sp|A7RF00.1|MTNA_NEMVE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Nematostella 
vectensis]
 gb|EDO49882.1| predicted protein [Nematostella vectensis]
Length=350

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP+TLIADSA +  MK  +++AV+VGADRIA NGDTANKIGTY LA+ A HH +
Sbjct  208  ELVYEKIPSTLIADSAVSMAMKTKKISAVVVGADRIACNGDTANKIGTYQLALAAKHHEI  267

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP+TS+D SL +G  IVIEERSP EL       G  +AASGI VWNPAFDVTPA 
Sbjct  268  PFYVAAPVTSIDFSLVNGDAIVIEERSPLELTSVK---GIPVAASGIGVWNPAFDVTPAG  324

Query  400  LISGIITEKGVIS  362
            LI+GI+TE G  S
Sbjct  325  LITGIVTEHGTFS  337



>ref|XP_001953494.1| GF17194 [Drosophila ananassae]
 sp|B3M098.1|MTNA_DROAN RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
ananassae]
 gb|EDV42055.1| GF17194 [Drosophila ananassae]
Length=364

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 107/138 (78%), Gaps = 5/138 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V  V+VGADR+AANGDTANKIGTY +AV A HH
Sbjct  219  AYELVHEKFPATLVLDSMVAALLRAKNVAGVVVGADRVAANGDTANKIGTYQIAVVAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
            GVPFYVAAPLTS+DL++  G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  279  GVPFYVAAPLTSIDLAIPGGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  334

Query  409  PASLISGIITEKGVISKD  356
            PASLI+GIITE+GV   +
Sbjct  335  PASLITGIITERGVFKPE  352



>ref|WP_027718288.1| methylthioribose-1-phosphate isomerase [Desulfovirgula thermocuniculi]
Length=347

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            S EL+ E IP TL+ D  A  LM  G V+AVIVGADRIAANGD ANKIGTY LAV A +H
Sbjct  200  SWELLQEGIPVTLVTDGMAGYLMAQGMVDAVIVGADRIAANGDVANKIGTYGLAVLASYH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAPL++VDL+L SG +I IEERSP+E+ H     G ++A  G+ VWNPAFDVTP
Sbjct  260  GLPFYVAAPLSTVDLTLESGAEIPIEERSPQEVTHL---CGVRVAPEGVGVWNPAFDVTP  316

Query  406  ASLISGIITEKGV  368
            A LI+ IIT++GV
Sbjct  317  AELITAIITDRGV  329



>ref|XP_006396132.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
 gb|ESQ36911.1| hypothetical protein EUTSA_v10002579mg [Eutrema salsugineum]
Length=341

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 111/154 (72%), Gaps = 31/154 (20%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAAALMK GRV+ VIVGADR+A+N                   
Sbjct  219  AFELVHEKIPATLIADSAAAALMKDGRVDGVIVGADRVASN-------------------  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
                        VDLSLSSG++IVIEER+PKELL+THGGLGE+IAA GISVWNPAFDVTP
Sbjct  260  ------------VDLSLSSGKEIVIEERTPKELLNTHGGLGERIAAPGISVWNPAFDVTP  307

Query  406  ASLISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            A LI+GIITEKG+I+K GN AFDI+ F  K++GN
Sbjct  308  AELIAGIITEKGIITKSGNGAFDISSFAQKMTGN  341



>ref|XP_001993776.1| GH21593 [Drosophila grimshawi]
 sp|B4JRX2.1|MTNA_DROGR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
grimshawi]
 gb|EDV94512.1| GH21593 [Drosophila grimshawi]
Length=363

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 104/134 (78%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E +PATL+ DS  AAL +   V AV+VGADR+AANGDTANKIGTY +AV A HHGV
Sbjct  220  ELVHEKLPATLVLDSMVAALFRVKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGV  279

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAPLTS+DL + SG+ I+IE R  +E+ H    +GE +IAA GI+ WNPAFDVTPA
Sbjct  280  PFYVAAPLTSIDLQIPSGEHIIIEVRPDREMTH----VGEHRIAAPGINCWNPAFDVTPA  335

Query  403  SLISGIITEKGVIS  362
            SLI+GIITE GV  
Sbjct  336  SLITGIITEHGVFK  349



>emb|CAD27760.1| putative translation initiation factor [Anopheles gambiae]
Length=348

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PATL+ DS  AAL+ + +++A+IVGADR+AANGDTANKIGTY +AV A HH
Sbjct  206  AYELVHDKLPATLVTDSMVAALLNSRKIDAIIVGADRVAANGDTANKIGTYQMAVVAKHH  265

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPFYVAAP TS+D+++  G  I IEER   EL  TH G G++IAA GI  WNPAFDVTP
Sbjct  266  GVPFYVAAPFTSIDVAIEDGSHIKIEERPEHEL--THIG-GQRIAAPGIGCWNPAFDVTP  322

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITE+GV+ 
Sbjct  323  AELITGIITERGVLK  337



>ref|XP_011143671.1| PREDICTED: methylthioribose-1-phosphate isomerase [Harpegnathos 
saltator]
 ref|XP_011143672.1| PREDICTED: methylthioribose-1-phosphate isomerase [Harpegnathos 
saltator]
Length=361

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLI D   AAL+K+ ++ AV+VGADR+AANGDTANKIGTY +A+ A HHGV
Sbjct  213  ELVHDKIPATLICDDMVAALLKSKQITAVVVGADRVAANGDTANKIGTYQIAILAKHHGV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D +++SG QIVIEER  +E+ H      ++IAA GI  WNPAFDVTPA 
Sbjct  273  PFYVAAPRTSIDFAIASGDQIVIEERPEREMTHIK---NQRIAAPGIQCWNPAFDVTPAH  329

Query  400  LISGIITEKGV  368
            LI+GIITE GV
Sbjct  330  LIAGIITEVGV  340



>ref|XP_321518.1| AGAP001589-PA [Anopheles gambiae str. PEST]
 sp|Q7PKS9.1|MTNA_ANOGA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Anopheles 
gambiae]
 gb|EAA43149.1| AGAP001589-PA [Anopheles gambiae str. PEST]
Length=351

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PATL+ DS  AAL+ + +++A+IVGADR+AANGDTANKIGTY +AV A HH
Sbjct  209  AYELVHDKLPATLVTDSMVAALLNSRKIDAIIVGADRVAANGDTANKIGTYQMAVVAKHH  268

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPFYVAAP TS+D+++  G  I IEER   EL  TH G G++IAA GI  WNPAFDVTP
Sbjct  269  GVPFYVAAPFTSIDVAIEDGSHIKIEERPEHEL--THIG-GQRIAAPGIGCWNPAFDVTP  325

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITE+GV+ 
Sbjct  326  AELITGIITERGVLK  340



>ref|XP_011052943.1| PREDICTED: methylthioribose-1-phosphate isomerase [Acromyrmex 
echinatior]
 gb|EGI66416.1| Methylthioribose-1-phosphate isomerase [Acromyrmex echinatior]
Length=362

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 4/139 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLI D   AALMK  ++ AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  216  ELVHDKIPATLICDDMVAALMKTKQITAVVVGADRVAANGDTANKIGTYQIAILAKYHDV  275

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPLTS+DL++S+G QIVIEERS +E+ H +    ++IAA GI+ WNPAFDVTPAS
Sbjct  276  PFYVAAPLTSIDLNVSNGDQIVIEERSEQEMTHMN---DKRIAAEGITCWNPAFDVTPAS  332

Query  400  LISGIITEKGVIS-KDGND  347
            LI GII   GV    DG+D
Sbjct  333  LIRGIIMNIGVSKPSDGSD  351



>emb|CBY10943.1| unnamed protein product [Oikopleura dioica]
Length=335

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATLIADS  +A +K  R+N ++VGADR+A NGD+ANKIGT+ LAV A H G+
Sbjct  197  ELVYEKIPATLIADSMVSAAIKEKRINCIVVGADRVAKNGDSANKIGTFQLAVVAKHFGI  256

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAP T++D +  SG +IVIEER+ KEL  T  G G++IAA GI VWNPAFDV PA+
Sbjct  257  PFFVAAPFTTIDFNCESGDEIVIEERNSKEL--TEIG-GKRIAAEGIQVWNPAFDVAPAN  313

Query  400  LISGIITEKGVIS  362
            LI GIITE+GV  
Sbjct  314  LIEGIITERGVFK  326



>ref|XP_002001025.1| GI10562 [Drosophila mojavensis]
 sp|B4K8A4.1|MTNA_DROMO RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
mojavensis]
 gb|EDW16486.1| GI10562 [Drosophila mojavensis]
Length=362

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E +PATL+ DS  AAL++   V AV+VGADR+AANGDTANKIGTY +AV A HHGV
Sbjct  219  ELVHEKLPATLVLDSMVAALLRVKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHHGV  278

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAPLTS+DL + SG  I+IE R  +E+ H    +GE +IAA GI+ WNPAFDVTPA
Sbjct  279  PFYVAAPLTSIDLEIPSGDHIIIEVRPDREMTH----VGEHRIAAPGINCWNPAFDVTPA  334

Query  403  SLISGIITEKGVISKDG  353
            SLI+GIITE GV   + 
Sbjct  335  SLITGIITEHGVFKPEA  351



>ref|XP_002054225.1| GJ22917 [Drosophila virilis]
 sp|B4LWZ8.1|MTNA_DROVI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
virilis]
 gb|EDW67745.1| GJ22917 [Drosophila virilis]
Length=362

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E +PATL+ DS  AAL++   V AV+VGADR+AANGDTANKIGTY +AV A HH
Sbjct  217  AYELVHEKLPATLVLDSMVAALLRVKNVAAVVVGADRVAANGDTANKIGTYQIAVVAKHH  276

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
            GVPFYVAAPLTSVDL + SG  I+IE R  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  277  GVPFYVAAPLTSVDLQIPSGDHIIIEVRPDREMTH----VGEHRIAAPGINCWNPAFDVT  332

Query  409  PASLISGIITEKGVIS  362
            PASL++GIITE GV  
Sbjct  333  PASLVTGIITEHGVFK  348



>emb|CDH49387.1| methylthioribose-1-phosphate isomerase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=398

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 116/154 (75%), Gaps = 8/154 (5%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAG-RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHG  584
            ELV E+IPATL+ DS A+AL++    V A+IVGADR+AANGDTANKIGTY LA+ A HHG
Sbjct  244  ELVYESIPATLVCDSMASALLRLNPSVQAIIVGADRVAANGDTANKIGTYQLAITAKHHG  303

Query  583  VPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQ------IAASGISVWNPA  422
            + F VAAP TS+DLS++SG++IVIEER  KEL+ T G L ++       AA GI VWNP+
Sbjct  304  ILFVVAAPSTSIDLSMASGKEIVIEERPAKELVTTTGVLDDKSSATVRTAAEGIQVWNPS  363

Query  421  FDVTPASLISGIITEKGV-ISKDGNDAFDITGFV  323
            FDVTP+ LIS I+TEKGV + + G+  FD+  F+
Sbjct  364  FDVTPSELISAIVTEKGVAVKQPGHTEFDLAAFL  397



>ref|XP_006560809.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Apis mellifera]
Length=339

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV ENIPATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  197  ELVYENIPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  256

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D S+ SG  I+IEER  +EL H +    ++IAA GI  WNPAFDVTPA+
Sbjct  257  PFYVAAPRTSIDFSIPSGDHIIIEERPERELTHIN---DQRIAAPGIQCWNPAFDVTPAN  313

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  314  LIKGIITEVGV  324



>ref|XP_002037477.1| GM12085 [Drosophila sechellia]
 sp|B4I029.1|MTNA_DROSE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
sechellia]
 gb|EDW53636.1| GM12085 [Drosophila sechellia]
Length=364

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH
Sbjct  219  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
             VPFYVAAPLTS+DL++  G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  279  DVPFYVAAPLTSIDLAIPGGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  334

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  335  PASLITGIITERGVFK  350



>ref|WP_015263041.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium dichloroeliminans]
 gb|AGA70070.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium dichloroeliminans 
LMG P-21439]
Length=345

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ + IP TLIAD+ A  LM+ G+++ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  TLELMNDKIPVTLIADNMAGFLMQQGKIDLVIVGADRIAANGDTANKIGTYSLAVLAQAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL + SGQ I IEER+P+E+       G Q+A + + V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVPSGQDIPIEERNPQEMREV---FGVQVAPADVPVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            + LI+GIITEKG++S
Sbjct  317  SKLITGIITEKGIVS  331



>ref|XP_002105622.1| GD16414 [Drosophila simulans]
 sp|B4QSM8.1|MTNA_DROSI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
simulans]
 gb|EDX15125.1| GD16414 [Drosophila simulans]
Length=364

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH
Sbjct  219  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
             VPFYVAAPLTS+DL++  G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  279  DVPFYVAAPLTSIDLAIPGGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  334

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  335  PASLITGIITERGVFK  350



>ref|XP_001943893.1| PREDICTED: methylthioribose-1-phosphate isomerase [Acyrthosiphon 
pisum]
Length=363

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IP+TL+ DS  A LMK  ++NAV+VGADR+AANGDTANKIGTY +AV A HH V
Sbjct  213  ELVHDKIPSTLVCDSTVAYLMKTAQINAVVVGADRVAANGDTANKIGTYQIAVVAKHHEV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPLTS+D ++++G  IVIEER   E+ H +     +IA+ G++ WNPAFDVTPA 
Sbjct  273  PFYVAAPLTSIDFNVNTGDNIVIEERPQVEMTHINNI---RIASPGVTCWNPAFDVTPAR  329

Query  400  LISGIITEKGVI  365
            LI+GIITEKGV 
Sbjct  330  LITGIITEKGVF  341



>ref|XP_002424016.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB11278.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=357

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP+TLI DS  AALMK   ++AV+VGADR+AANGDTANKIGTY +AV A  HG+
Sbjct  213  ELVHEKIPSTLICDSMVAALMKTRNISAVVVGADRVAANGDTANKIGTYQIAVLAKFHGI  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAP  S+DLS+ SG+ I+IEER  +E+ H    +G+ +IAA GI  WNPAFDVTPA
Sbjct  273  PFYVAAPANSIDLSIPSGEHIIIEERPDREMTH----IGDMRIAARGIGCWNPAFDVTPA  328

Query  403  SLISGIITEKGVI  365
            SLI+GI+TEKGV 
Sbjct  329  SLITGIVTEKGVF  341



>ref|XP_969152.1| PREDICTED: methylthioribose-1-phosphate isomerase [Tribolium 
castaneum]
 gb|EFA12349.1| hypothetical protein TcasGA2_TC002054 [Tribolium castaneum]
Length=354

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLI DS  AALMK   V+AV+VGADR+A+NGDTANKIGTY +AV A  HGV
Sbjct  213  ELVHDKIPATLIVDSMVAALMKHRNVSAVVVGADRVASNGDTANKIGTYQIAVLAKFHGV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAP TS+D+ + SG  IVIEER   E+ H    +GE +IAA GI+ WNPAFDVTPA
Sbjct  273  PFYVAAPFTSIDMKIVSGDHIVIEERPDHEMTH----VGEHRIAAKGITCWNPAFDVTPA  328

Query  403  SLISGIITEKGVI  365
            SLI+GIITEKGV 
Sbjct  329  SLIAGIITEKGVF  341



>ref|XP_006621214.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Apis dorsata]
Length=339

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV ENIPATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  197  ELVYENIPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  256

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D S+ SG  I+IEER  +EL H +    ++IAA GI  WNPAFD+TPA+
Sbjct  257  PFYVAAPRTSIDFSIPSGDHIIIEERPERELTHIN---DQRIAAPGIQCWNPAFDITPAN  313

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  314  LIKGIITEVGV  324



>ref|XP_392553.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X4 [Apis mellifera]
Length=355

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV ENIPATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  213  ELVYENIPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D S+ SG  I+IEER  +EL H +    ++IAA GI  WNPAFDVTPA+
Sbjct  273  PFYVAAPRTSIDFSIPSGDHIIIEERPERELTHIN---DQRIAAPGIQCWNPAFDVTPAN  329

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  330  LIKGIITEVGV  340



>ref|XP_002099512.1| GE23315 [Drosophila yakuba]
 sp|B4PNE2.1|MTNA_DROYA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
yakuba]
 gb|EDW99224.1| GE23315 [Drosophila yakuba]
Length=364

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH
Sbjct  219  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
             VPFYVAAPLTS+DL++  G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  279  DVPFYVAAPLTSIDLAIPGGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  334

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  335  PASLITGIITERGVFK  350



>ref|NP_651868.1| CG11334, isoform B [Drosophila melanogaster]
 ref|NP_733430.1| CG11334, isoform A [Drosophila melanogaster]
 ref|NP_001263144.1| CG11334, isoform C [Drosophila melanogaster]
 sp|Q9V9X4.1|MTNA_DROME RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
melanogaster]
 gb|AAF57154.1| CG11334, isoform A [Drosophila melanogaster]
 gb|AAF57155.1| CG11334, isoform B [Drosophila melanogaster]
 gb|AAL28212.1| GH08894p [Drosophila melanogaster]
 gb|ACL85874.1| CG11334-PA, partial [synthetic construct]
 gb|AGB96523.1| CG11334, isoform C [Drosophila melanogaster]
Length=364

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH
Sbjct  219  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
             VPFYVAAPLTS+DL++  G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  279  DVPFYVAAPLTSIDLAIPGGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  334

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  335  PASLITGIITERGVFK  350



>ref|XP_001981082.1| GG11866 [Drosophila erecta]
 sp|B3P538.1|MTNA_DROER RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Drosophila 
erecta]
 gb|EDV52952.1| GG11866 [Drosophila erecta]
Length=364

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E  PATL+ DS  AAL++A  V AV+VGADR+A+NGDTANKIGTY +AV A HH
Sbjct  219  AYELVHEKFPATLVLDSMVAALLRAKNVAAVVVGADRVASNGDTANKIGTYQIAVVAKHH  278

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
             VPFYVAAPLTS+DL++  G  I+IEER  +E+ H    +GE +IAA GI+ WNPAFDVT
Sbjct  279  DVPFYVAAPLTSIDLAIPGGDHIIIEERPDREMTH----VGEHRIAAPGINCWNPAFDVT  334

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  335  PASLITGIITERGVFK  350



>gb|AEE61699.1| unknown [Dendroctonus ponderosae]
 gb|ENN76653.1| hypothetical protein YQE_06832, partial [Dendroctonus ponderosae]
Length=357

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL+ + IP+TLI DS  +ALMK+  ++AV+VGADR+AANGDTANKIGTY +AV A +H
Sbjct  213  AFELIHDKIPSTLICDSMVSALMKSRNISAVVVGADRVAANGDTANKIGTYQIAVVAKYH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
             VPFYVAAP TS+D  +S+G+ IVIEER  +E+ H    +GE +IAA GI  WNPAFDVT
Sbjct  273  AVPFYVAAPFTSIDAKVSTGEHIVIEERPDREMTH----VGEHRIAAKGIPCWNPAFDVT  328

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  329  PASLIAGIITERGVFK  344



>gb|KDR24083.1| Methylthioribose-1-phosphate isomerase [Zootermopsis nevadensis]
Length=359

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 102/132 (77%), Gaps = 3/132 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATL+ DS  +ALM+A  + AV+VGADR+A NGDTANKIGTY +AV A HHGV
Sbjct  213  ELVHDKIPATLVCDSMVSALMRARNITAVVVGADRVATNGDTANKIGTYQIAVVAKHHGV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
             FYVAAP TS+D S+ SG+ I+IEER   E+ H       +IAA+GIS WNPAFDVTPAS
Sbjct  273  LFYVAAPFTSIDFSIPSGEHILIEERPEHEMSHV---ADHRIAATGISCWNPAFDVTPAS  329

Query  400  LISGIITEKGVI  365
            LI+GIITEKGV 
Sbjct  330  LITGIITEKGVF  341



>gb|ETN63911.1| translation initiation factor eif-2b [Anopheles darlingi]
Length=351

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PATL+ DS  AAL+   +++A+IVGADR+AANGDTANKIGTY +AV A HH
Sbjct  209  AYELVHDQLPATLVTDSMVAALLHTRKIDAIIVGADRVAANGDTANKIGTYQIAVVAKHH  268

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFYVAAP TS+D  +  G +I IEER  KEL  TH G G++IAA GI  WNPAFDVTP
Sbjct  269  QVPFYVAAPFTSIDFDIEDGSRIRIEERPEKEL--THLG-GQRIAAPGIGCWNPAFDVTP  325

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITE GV  
Sbjct  326  AELITGIITESGVFK  340



>gb|EHL06398.1| S-methyl-5-thioribose-1-phosphate isomerase [Desulfitobacterium 
hafniense DP7]
Length=339

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ ++IP TLIAD+ A  LM+ G ++ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  194  ALELMNDHIPVTLIADNMAGFLMQQGNIDLVIVGADRIAANGDTANKIGTYSLAVLAHAH  253

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL + SGQ I IEER+PKEL       G Q+A   + V+NPAFDVTP
Sbjct  254  GIPFYVAAPTSTIDLKVPSGQDIPIEERNPKELREV---FGVQVAPPEVPVYNPAFDVTP  310

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITEKG+++
Sbjct  311  AKLITGIITEKGIVT  325



>gb|KHN06061.1| Methylthioribose-1-phosphate isomerase [Glycine soja]
Length=238

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 108/151 (72%), Gaps = 26/151 (17%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IP TLI+DSAAAALMKAG V+AV+VGADR+A+NGDTANKIGTYS+A+ A  H
Sbjct  111  AFELVHEKIPGTLISDSAAAALMKAGHVDAVVVGADRVASNGDTANKIGTYSVALSAKFH  170

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFY                         KELL+THGGLGEQIAASGI VWNPAFDVTP
Sbjct  171  NVPFY-------------------------KELLNTHGGLGEQIAASGIFVWNPAFDVTP  205

Query  406  ASLISGIITEKGVISK-DGNDAFDITGFVHK  317
            A+LISGIITEKGV++K     AFDI  FV K
Sbjct  206  ANLISGIITEKGVVTKTTAGGAFDIKAFVQK  236



>ref|WP_005998427.1| methylthioribose-1-phosphate isomerase [Desulfuromonas acetoxidans]
 gb|EAT16472.1| Putative translation initiation factor, aIF-2BI/5-methylthioribose-1-phosphate 
isomerase [Desulfuromonas acetoxidans DSM 
684]
Length=345

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL+ ++IP T+I D+ A  LM+ GRV+AVIVGADRI ANGD ANKIGTY++AV A  HG+
Sbjct  204  ELMQDDIPVTVICDNMAGYLMQQGRVDAVIVGADRITANGDVANKIGTYTVAVLAKEHGI  263

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP++++DLSL+ G QI IEER P+E+  TH G   Q+A  G+ V+NPAFDVTP+ 
Sbjct  264  PFYVAAPMSTIDLSLTDGSQIPIEERDPREV--THCG-DTQLAPDGVKVYNPAFDVTPSH  320

Query  400  LISGIITEKGVISKD  356
            L++ IITE+GV+  D
Sbjct  321  LVTAIITERGVVQGD  335



>ref|XP_006621213.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Apis dorsata]
Length=355

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV ENIPATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  213  ELVYENIPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D S+ SG  I+IEER  +EL H +    ++IAA GI  WNPAFD+TPA+
Sbjct  273  PFYVAAPRTSIDFSIPSGDHIIIEERPERELTHIN---DQRIAAPGIQCWNPAFDITPAN  329

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  330  LIKGIITEVGV  340



>ref|WP_018210953.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium hafniense]
Length=345

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ ++IP TLIAD+ A  LM+ G ++ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  ALELMNDHIPVTLIADNMAGFLMQQGNIDLVIVGADRIAANGDTANKIGTYSLAVLAHAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL + SGQ I IEER+PKEL       G Q+A   + V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVPSGQDIPIEERNPKELREV---FGVQVAPPEVPVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITEKG+++
Sbjct  317  AKLITGIITEKGIVT  331



>ref|WP_035214189.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium hafniense]
 emb|CDX02701.1| Methylthioribose-1-phosphate isomerase [Desulfitobacterium hafniense]
Length=345

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ ++IP TLIAD+ A  LM+ G ++ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  ALELMNDHIPVTLIADNMAGFLMQQGNIDLVIVGADRIAANGDTANKIGTYSLAVLAHAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL + SGQ I IEER+PKEL       G Q+A   + V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVPSGQDIPIEERNPKELREV---FGVQVAPPEVPVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITEKG+++
Sbjct  317  AKLITGIITEKGIVT  331



>ref|WP_015944768.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium hafniense]
 sp|B8FRM1.1|MTNA_DESHD RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase [Desulfitobacterium hafniense DCB-2]
 gb|ACL21781.1| translation initiation factor, aIF-2BI family [Desulfitobacterium 
hafniense DCB-2]
Length=345

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ ++IP TLIAD+ A  LM+ G ++ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  ALELMNDHIPVTLIADNMAGFLMQQGNIDLVIVGADRIAANGDTANKIGTYSLAVLAHAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL + SGQ I IEER+PKEL       G Q+A   + V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVPSGQDIPIEERNPKELREV---FGVQVAPPEVPVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITEKG+++
Sbjct  317  AKLITGIITEKGIVT  331



>ref|WP_011460451.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium hafniense]
 sp|Q24UA0.1|MTNA_DESHY RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase [Desulfitobacterium hafniense Y51]
 dbj|BAE84392.1| hypothetical protein [Desulfitobacterium hafniense Y51]
Length=345

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ ++IP TLIAD+ A  LM+ G ++ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  ALELMNDHIPVTLIADNMAGFLMQQGNIDLVIVGADRIAANGDTANKIGTYSLAVLAHAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL + SGQ I IEER+PKEL       G Q+A   + V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVPSGQDIPIEERNPKELREV---FGVQVAPPEVPVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A LI+GIITEKG+++
Sbjct  317  AKLITGIITEKGIVT  331



>ref|XP_001604505.1| PREDICTED: methylthioribose-1-phosphate isomerase [Nasonia vitripennis]
Length=350

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP+TLI D   AALMK+  ++AV+VGADR+ ANGDTANKIGTY +AV A HH
Sbjct  210  AYELVHDKIPSTLICDDMVAALMKSKNISAVVVGADRVVANGDTANKIGTYQIAVLAKHH  269

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFYVAAP T++D S+ +G+ I IEER   EL H +   G +IAA GI+VWNPAFDVTP
Sbjct  270  NVPFYVAAPFTTIDFSIPTGEGIKIEERPANELTHVN---GTRIAAEGINVWNPAFDVTP  326

Query  406  ASLISGIITEKGV  368
            A LI+GI+TEKGV
Sbjct  327  AELITGIVTEKGV  339



>gb|KJE93735.1| translation initiation factor eif-2b [Capsaspora owczarzaki ATCC 
30864]
Length=361

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATLI DS  AALM + +++AV+VGADR+ ANGDTANKIGTY LA+ A  H V
Sbjct  216  ELVYERIPATLITDSMVAALMASRKIDAVVVGADRVVANGDTANKIGTYQLAIVAKFHNV  275

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+DL  + G  I IEER   EL   +   G +IAA+ I VWNP FDVTPA+
Sbjct  276  PFYVAAPTTSIDLDKADGSMITIEERPASELTQLN---GVRIAAADIGVWNPGFDVTPAA  332

Query  400  LISGIITEKGVISKDGND-AFDITGFVHK  317
            LI+GI+TE GVIS    D +FD+  F+ +
Sbjct  333  LITGIVTENGVISARREDGSFDVQSFLSR  361



>ref|XP_003080319.1| methylthioribose kinase (ISS) [Ostreococcus tauri]
Length=1089

 Score =   158 bits (399),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP TLI D+ AAALM  G V+A++VGADR+AANGD ANKIGTYSLAV A HHGV
Sbjct  507  ELVYEKIPGTLICDNMAAALMARGDVDAIVVGADRVAANGDFANKIGTYSLAVNAKHHGV  566

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            P + AAP+T++D   ++G  I IEER   E+ H+   LG+++AA GI VWNP+FDVTPA+
Sbjct  567  PMFTAAPVTTLDPETATGADIHIEERPADEVTHS---LGKRVAAEGIDVWNPSFDVTPAA  623

Query  400  LISGIITEKGVISKDGNDAFDITGFVHKVSG  308
            L+SGIITE GVI K+    F ++ FV  V G
Sbjct  624  LLSGIITESGVIEKNVKGFFPVSEFVANVKG  654



>ref|WP_042225012.1| methylthioribose-1-phosphate isomerase [Leptospirillum sp. Group 
II 'C75']
Length=349

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  205  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  264

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  265  GIPFYVAAPFSTIDFSLQSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  322

Query  406  ASLISGIITEKGVISKD  356
               I+ IITEKGV   D
Sbjct  323  GDFITAIITEKGVFRPD  339



>gb|AFS53499.1| translation initiation factor, aIF-2BI/5-methylthioribose-1-phosphate 
isomerase [Leptospirillum ferriphilum ML-04]
Length=350

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  206  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  265

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  266  GIPFYVAAPFSTIDFSLKSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  323

Query  406  ASLISGIITEKGVISKD  356
               I+ IITEKGV   D
Sbjct  324  GEFITAIITEKGVFRPD  340



>ref|WP_011878387.1| methylthioribose-1-phosphate isomerase [Desulfotomaculum reducens]
 sp|A4J678.1|MTNA_DESRM RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase [Desulfotomaculum reducens MI-1]
 gb|ABO50581.1| methylthioribose-1-phosphate isomerase [Desulfotomaculum reducens 
MI-1]
Length=346

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            S E+V E IP TLI D+ A  LM    V+ ++VGADRI ANGD ANKIGTY +AV A HH
Sbjct  200  SWEMVQEGIPVTLITDNMAGYLMSKKMVDCIVVGADRITANGDVANKIGTYGVAVLANHH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAPL+++D+SLSSG++I IEER P+E+ H HG  G+ +A  G+ VWNPAFDVTP
Sbjct  260  NIPFYVAAPLSTIDMSLSSGEEIPIEERDPQEVTH-HG--GQPMAPEGVQVWNPAFDVTP  316

Query  406  ASLISGIITEKGVI  365
             SL+  IITE+GV+
Sbjct  317  NSLVKAIITERGVV  330



>ref|XP_002500043.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas sp. RCC299]
 gb|ACO61301.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas sp. RCC299]
Length=799

 Score =   156 bits (395),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 89/152 (59%), Positives = 118/152 (78%), Gaps = 3/152 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E+  E +P TLI DSAAAALM  G+V+AV+VGADR+A NGDTANKIGTY+LAV A +H V
Sbjct  216  EIAFEKMPGTLICDSAAAALMAKGKVDAVVVGADRVADNGDTANKIGTYNLAVSAAYHDV  275

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAP++++D S + G  IVIE+R   E+ H+   LG+++AA GI VWNP+FDVTPA+
Sbjct  276  PFFVAAPISTLDPSTAKGADIVIEDRPATEITHS---LGKRVAAEGIDVWNPSFDVTPAA  332

Query  400  LISGIITEKGVISKDGNDAFDITGFVHKVSGN  305
            LI+GIITEKGV+ K  +  F +  FV +V+G+
Sbjct  333  LIAGIITEKGVVRKTASGDFAVGKFVAEVTGS  364



>gb|EAY56266.1| translation initiation factor, aIF-2BI/5-methylthioribose-1- 
phosphate isomerase [Leptospirillum rubarum]
 gb|EIJ75732.1| Translation initiation factor, aIF-2BI/5-methylthioribose-1- 
phosphate isomerase [Leptospirillum sp. Group II 'C75']
Length=350

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  206  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  265

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  266  GIPFYVAAPFSTIDFSLQSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  323

Query  406  ASLISGIITEKGVISKD  356
               I+ IITEKGV   D
Sbjct  324  GDFITAIITEKGVFRPD  340



>gb|EDZ38932.1| Translation initiation factor, aIF-2BI/5- methylthioribose-1- 
phosphate isomerase [Leptospirillum sp. Group II '5-way CG']
 gb|AIA30501.1| methylthioribose-1-phosphate isomerase [Leptospirillum ferriphilum 
YSK]
Length=350

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  206  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  265

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  266  GIPFYVAAPFSTIDFSLQSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  323

Query  406  ASLISGIITEKGVISKD  356
               I+ IITEKGV   D
Sbjct  324  GEFITAIITEKGVFRPD  340



>gb|KGA93509.1| Methylthioribose-1-phosphate isomerase [Leptospirillum ferriphilum]
Length=350

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  206  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  265

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  266  GIPFYVAAPFSTIDFSLQSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  323

Query  406  ASLISGIITEKGVISKD  356
               I+ IITEKGV   D
Sbjct  324  GEFITAIITEKGVFRPD  340



>gb|ERL94382.1| hypothetical protein D910_11661, partial [Dendroctonus ponderosae]
Length=424

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 107/136 (79%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL+ + IP+TLI DS  +ALMK+  ++AV+VGADR+AANGDTANKIGTY +AV A +H
Sbjct  213  AFELIHDKIPSTLICDSMVSALMKSRNISAVVVGADRVAANGDTANKIGTYQIAVVAKYH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVT  410
             VPFYVAAP TS+D  +S+G+ IVIEER  +E+ H    +GE +IAA GI  WNPAFDVT
Sbjct  273  AVPFYVAAPFTSIDAKVSTGEHIVIEERPDREMTH----VGEHRIAAKGIPCWNPAFDVT  328

Query  409  PASLISGIITEKGVIS  362
            PASLI+GIITE+GV  
Sbjct  329  PASLIAGIITERGVFK  344



>ref|XP_003726311.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase-like [Strongylocentrotus purpuratus]
Length=376

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPA+LI DS A+  M    V AV+VGADR+ ANGDTANKIGTY LA+ A HH +
Sbjct  232  ELVYECIPASLITDSMASFCMLKKGVTAVVVGADRVVANGDTANKIGTYQLALAARHHNI  291

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP+TS DLSL+SG +IVIEER   EL   +   G QIAA GI  WNPAFDVTPA 
Sbjct  292  PFYVAAPVTSCDLSLTSGDEIVIEERDQSELTKIN---GMQIAAPGIRGWNPAFDVTPAD  348

Query  400  LISGIITEKGVIS  362
            LI+GI+TE GV  
Sbjct  349  LITGIVTEHGVFK  361



>ref|XP_003697763.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Apis 
florea]
Length=355

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV ENIPATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  213  ELVYENIPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D S+ +G  I+IEER  +EL H +    ++IAA GI  WNPAFDVTPA+
Sbjct  273  PFYVAAPRTSIDFSIPNGDHIIIEERPERELTHIN---DQRIAAPGIQCWNPAFDVTPAN  329

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  330  LIKGIITEVGV  340



>ref|WP_027356529.1| methylthioribose-1-phosphate isomerase [Desulfotomaculum thermocisternum]
Length=344

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL+ ENIP TLI D+ AA LM  G V+ V+VGADRIA+NGD ANKIGTY LAV A  HGV
Sbjct  202  ELLQENIPVTLITDNMAAYLMARGMVDLVVVGADRIASNGDVANKIGTYGLAVLAREHGV  261

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPL+++DLSL SG+ I IEER P+E+ H  G     +A  GI VWNPAFD+TPA 
Sbjct  262  PFYVAAPLSTIDLSLDSGKDIPIEERRPEEVTHLAGI---PVAPRGIKVWNPAFDITPAR  318

Query  400  LISGIITEKGV  368
            LI+ IIT++GV
Sbjct  319  LITAIITDQGV  329



>ref|WP_002650338.1| methylthioribose-1-phosphate isomerase [Blastopirellula marina]
 gb|EAQ80781.1| putative translation initiation factor [Blastopirellula marina 
DSM 3645]
Length=358

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 3/110 (3%)
 Frame = -3

Query  691  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  512
            GRV A++ GADRIAANGD+ANKIGTYSLAV A  HG+PFY+AAP+++ D+++ SG +I I
Sbjct  238  GRVEAIVTGADRIAANGDSANKIGTYSLAVLAKAHGIPFYIAAPISTFDMAIESGDEIPI  297

Query  511  EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  362
            EER+ +E+ H   G G Q A +GI+V+NPAFDVTPA LI+GIITE+GVIS
Sbjct  298  EERAAEEITH---GFGRQTAPAGINVYNPAFDVTPAELIAGIITERGVIS  344



>ref|XP_003700639.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Megachile 
rotundata]
Length=355

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  213  ELVYEKIPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D S+ SG  I+IEER  +EL H +    +++AA GI  WNPAFDVTPAS
Sbjct  273  PFYVAAPRTSIDFSIPSGDHIIIEERPERELTHIN---NQRVAAPGIQCWNPAFDVTPAS  329

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  330  LIRGIITEVGV  340



>ref|XP_004348313.2| translation initiation factor eif-2b [Capsaspora owczarzaki ATCC 
30864]
Length=389

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATLI DS  AALM + +++AV+VGADR+ ANGDTANKIGTY LA+ A  H V
Sbjct  244  ELVYERIPATLITDSMVAALMASRKIDAVVVGADRVVANGDTANKIGTYQLAIVAKFHNV  303

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+DL  + G  I IEER   EL   +   G +IAA+ I VWNP FDVTPA+
Sbjct  304  PFYVAAPTTSIDLDKADGSMITIEERPASELTQLN---GVRIAAADIGVWNPGFDVTPAA  360

Query  400  LISGIITEKGVISKDGND-AFDITGFVHK  317
            LI+GI+TE GVIS    D +FD+  F+ +
Sbjct  361  LITGIVTENGVISARREDGSFDVQSFLSR  389



>ref|XP_003760740.1| PREDICTED: methylthioribose-1-phosphate isomerase [Sarcophilus 
harrisii]
Length=358

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS  AA +    V AVIVGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  213  AYELVYEKIPATLITDSMVAAAIAHKEVGAVIVGADRVVANGDTANKVGTYQLAIVAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVA P++S DLSL +GQ+IVIEER  +EL +     G +IAA GI VWNPAFDVTP
Sbjct  273  GIPFYVATPVSSCDLSLKTGQEIVIEERPGQELTNL---CGTRIAAPGIGVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE+GV S
Sbjct  330  HELITGGIITERGVFS  345



>gb|EFN81802.1| Translation initiation factor eIF-2B subunit alpha/beta/delta-like 
protein [Harpegnathos saltator]
Length=363

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTY--SLAVCAMHH  587
            ELV + IPATLI D   AAL+K+ ++ AV+VGADR+AANGDTANKIGTY  S+A+ A HH
Sbjct  213  ELVHDKIPATLICDDMVAALLKSKQITAVVVGADRVAANGDTANKIGTYQASIAILAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPFYVAAP TS+D +++SG QIVIEER  +E+ H      ++IAA GI  WNPAFDVTP
Sbjct  273  GVPFYVAAPRTSIDFAIASGDQIVIEERPEREMTHIK---NQRIAAPGIQCWNPAFDVTP  329

Query  406  ASLISGIITEKGV  368
            A LI+GIITE GV
Sbjct  330  AHLIAGIITEVGV  342



>emb|CBY31516.1| unnamed protein product [Oikopleura dioica]
Length=342

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATLIADS  +A +K  R+N ++VGADR+A NGD+ANKIGT+ LAV A + G+
Sbjct  204  ELVYEKIPATLIADSMVSAAIKEKRINCIVVGADRVAKNGDSANKIGTFQLAVVAKYFGI  263

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAP T++D +  +G +IVIEER  KEL  T  G G++IAA GI VWNPAFDV PA+
Sbjct  264  PFFVAAPFTTIDFNCENGDEIVIEERDSKEL--TEIG-GKRIAAEGIQVWNPAFDVAPAN  320

Query  400  LISGIITEKGVIS  362
            LI GIITE+GV  
Sbjct  321  LIEGIITERGVFK  333



>ref|XP_008546891.1| PREDICTED: methylthioribose-1-phosphate isomerase [Microplitis 
demolitor]
Length=355

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IP TLI D   AALMK+ ++NAV+VGADR+AANGDTANKIGTY +A+ A HH V
Sbjct  213  ELVHEKIPGTLICDGMVAALMKSRKINAVVVGADRVAANGDTANKIGTYQIAILAKHHEV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D  + +G +I IEER  +E+ H +    ++IAA GI  WNPAFDVTP  
Sbjct  273  PFYVAAPRTSIDFEIVAGDKIPIEERPEREMTHMN---DQRIAAKGIQCWNPAFDVTPGD  329

Query  400  LISGIITEKGVIS  362
            LI+GIITE GVI 
Sbjct  330  LITGIITEVGVIK  342



>ref|XP_001366752.1| PREDICTED: methylthioribose-1-phosphate isomerase [Monodelphis 
domestica]
Length=355

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV ENIPATLI DS  A  M    V AVIVGADR+ ANGDTANK+GTY LA+ A +H
Sbjct  213  AYELVYENIPATLITDSMGATAMAHKDVKAVIVGADRVVANGDTANKVGTYQLAITAKYH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP++S DLSL +GQ+IVIEER  +EL       G +IAA GI VWNP+FDVTP
Sbjct  273  GIPFYVAAPVSSCDLSLKTGQEIVIEERPSQELTSLG---GTRIAAPGIGVWNPSFDVTP  329

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE+GV S
Sbjct  330  HELITGGIITERGVFS  345



>ref|XP_661894.1| hypothetical protein AN4290.2 [Aspergillus nidulans FGSC A4]
 sp|Q5B590.1|MTNA_EMENI RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aspergillus 
nidulans FGSC A4]
 gb|EAA60042.1| hypothetical protein AN4290.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF77829.1| TPA: translation initiation factor, putative (AFU_orthologue; 
AFUA_4G05830) [Aspergillus nidulans FGSC A4]
Length=379

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 90/129 (70%), Gaps = 11/129 (9%)
 Frame = -3

Query  688  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  509
            RVNA++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG  IVIE
Sbjct  246  RVNAIVVGADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATKSGGDIVIE  305

Query  508  ERSPKELLHTHGGLGE-----------QIAASGISVWNPAFDVTPASLISGIITEKGVIS  362
            ER P E+    G   +            IAA GI+VWNPAFDVTP+ LI GIITEKGV  
Sbjct  306  ERPPSEVTRVKGSREDDTTGDVRLETISIAAEGINVWNPAFDVTPSELIDGIITEKGVAE  365

Query  361  KDGNDAFDI  335
            KD +  F +
Sbjct  366  KDTDGRFHL  374



>ref|XP_005648557.1| hypothetical protein COCSUDRAFT_65695 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24013.1| hypothetical protein COCSUDRAFT_65695 [Coccomyxa subellipsoidea 
C-169]
Length=1818

 Score =   157 bits (396),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 6/151 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PA LIADSAAAALM   +V+A++VGADRIAANGDTANKIGT+SLAV A HH
Sbjct  178  AYELVHDGLPAMLIADSAAAALMAQRKVDAIVVGADRIAANGDTANKIGTFSLAVNAAHH  237

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFY+AAP  +VD SL  G  I IEERS  EL H     G+++AA GI+VWNPAFDVTP
Sbjct  238  GIPFYIAAPTMTVDPSLPDGTLIPIEERSSTELTHHQ---GQRVAAPGINVWNPAFDVTP  294

Query  406  ASLISGIITEKGVI-SKDGNDAFDITGFVHK  317
            ASLI+GIITE+G+I  +DG  A D+  F+ +
Sbjct  295  ASLITGIITEQGIIQQRDG--AIDVNSFLRE  323



>ref|XP_003389526.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Amphimedon 
queenslandica]
Length=352

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 104/134 (78%), Gaps = 4/134 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELVTE IP TLI DS AA LMK   V+AV+VGADR+ ANGDTANKIGTY LAV A +HG+
Sbjct  213  ELVTEGIPGTLICDSMAACLMKERHVSAVVVGADRVVANGDTANKIGTYQLAVVARYHGI  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFY+AAP T++D S+SSG +IVIEER  +E++      G++IA  GI+ WNPAFDVTP  
Sbjct  273  PFYIAAPFTTIDFSISSGSEIVIEERKKEEMICFA---GKRIAPEGINCWNPAFDVTPGE  329

Query  400  LIS-GIITEKGVIS  362
            LI+ GIITE+GV +
Sbjct  330  LITGGIITERGVFT  343



>gb|EDL92228.1| similar to hypothetical protein MGC3207, isoform CRA_b [Rattus 
norvegicus]
Length=179

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANKIGTY LA+ A HH
Sbjct  23   AFELVYEKIPATLITDSMAAAAMVHQGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHH  82

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +G++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  83   GIPFYVAAPSSSCDLRLETGKEIVIEERPSQELTDLN---GVRIAAQGIRVWNPAFDVTP  139

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  140  HELITGGIITELGVFAPE  157



>ref|WP_041772593.1| methylthioribose-1-phosphate isomerase, partial [Leptospirillum 
ferriphilum]
Length=335

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  205  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  264

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  265  GIPFYVAAPFSTIDFSLKSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  322

Query  406  ASLISGIITEKGV  368
               I+ IITEKGV
Sbjct  323  GEFITAIITEKGV  335



>ref|WP_036082877.1| methylthioribose-1-phosphate isomerase, partial [Leptospirillum 
ferriphilum]
Length=335

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  205  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  264

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  265  GIPFYVAAPFSTIDFSLQSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  322

Query  406  ASLISGIITEKGV  368
               I+ IITEKGV
Sbjct  323  GEFITAIITEKGV  335



>ref|XP_006003718.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X1 [Latimeria chalumnae]
Length=357

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 105/134 (78%), Gaps = 4/134 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E+IP+TLIADS  +  MKA  ++AV+VGADR+ ANGDTANKIGTY LA+ A +HG+
Sbjct  213  ELVYEHIPSTLIADSMVSIAMKAKGISAVVVGADRVVANGDTANKIGTYQLAIAAKYHGI  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS DL+L +G+QIVIEERS  EL   +   G +IAA GI+VWNPAFDVTP  
Sbjct  273  PFYVAAPSTSCDLTLENGEQIVIEERSHSELTDVN---GMRIAAPGIAVWNPAFDVTPCD  329

Query  400  LIS-GIITEKGVIS  362
            LI+ GIITE GV S
Sbjct  330  LITGGIITEFGVFS  343



>ref|WP_014795021.1| MULTISPECIES: methylthioribose-1-phosphate isomerase [Desulfitobacterium]
 gb|AFM01541.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium dehalogenans 
ATCC 51507]
Length=345

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL+ + IP TLIAD+ A  LM+ G+++ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  AFELMNDQIPVTLIADNMAGFLMQQGKIDLVIVGADRIAANGDTANKIGTYSLAVLAHAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL +  GQ I IEER PKEL       G Q+A   + V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVPGGQDIPIEERHPKELREV---FGVQVAPMEVPVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            + LI+GIITEKG++S
Sbjct  317  SKLITGIITEKGIVS  331



>ref|WP_038506986.1| methylthioribose-1-phosphate isomerase, partial [Leptospirillum 
ferriphilum]
Length=335

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IP TLI D   A+LM   +++AVIVGADR+ ANGD ANKIGTY+LAV A  H
Sbjct  205  AYELVEDGIPTTLITDGMGASLMAKKKIDAVIVGADRVTANGDVANKIGTYALAVLARAH  264

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++D SL SG QI IEERSP+E+  TH G   +IA  G+SV+NPAFDVTP
Sbjct  265  GIPFYVAAPFSTIDFSLQSGSQIPIEERSPREI--THFGPDVRIAPEGVSVYNPAFDVTP  322

Query  406  ASLISGIITEKGV  368
               I+ IITEKGV
Sbjct  323  GEFITAIITEKGV  335



>ref|NP_001090076.1| methylthioribose-1-phosphate isomerase [Xenopus laevis]
 sp|Q4FZP2.1|MTNA_XENLA RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Xenopus 
laevis]
 gb|AAH99301.1| MGC116493 protein [Xenopus laevis]
Length=354

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 103/142 (73%), Gaps = 7/142 (5%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS A+  M+  +V AV+VGADR+ ANGDTANKIGTY LA+ A +H
Sbjct  211  AYELVYEKIPATLITDSMASVTMRERKVTAVVVGADRVVANGDTANKIGTYQLAIIAKYH  270

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS DLSL +G  IVIEER   EL   +   G +IAA GI VWNPAFDVTP
Sbjct  271  GIPFYVAAPSTSCDLSLPTGGSIVIEERPSHELTDIN---GIRIAAPGIDVWNPAFDVTP  327

Query  406  ASLISGIITEKGVIS----KDG  353
              LI+GIITE+GV      KDG
Sbjct  328  HELITGIITERGVFKPEELKDG  349



>gb|AII98097.1| BLTX771 [Nephila pilipes]
Length=244

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 4/133 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV +NIP+TLI DS  A+LM++G+V+AVIVGADR+  NGDTANKIGTY +AVCA +H +
Sbjct  96   ELVHDNIPSTLICDSMVASLMQSGKVSAVIVGADRVVCNGDTANKIGTYQIAVCAKYHNI  155

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVA P +++D +L SG  I IEER PKE+L T   +G  IAA GI  WNPAFD+TPAS
Sbjct  156  PFYVACPRSTLDFTLESGNLIPIEERPPKEML-TINSIG--IAAEGIKCWNPAFDITPAS  212

Query  400  LIS-GIITEKGVI  365
            LI+ GI+TE GV 
Sbjct  213  LITGGIVTEIGVF  225



>ref|XP_001664017.1| AAEL013828-PA [Aedes aegypti]
 sp|Q16I17.1|MTNA_AEDAE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Aedes 
aegypti]
 gb|EAT33907.1| AAEL013828-PA [Aedes aegypti]
Length=360

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + +PATLI D+  A+L K+ RV AV+VGADR+AANGDTANKIGTY + V A +H V
Sbjct  213  ELVHDKLPATLILDNMVASLFKSRRVAAVVVGADRVAANGDTANKIGTYQIGVVAKYHDV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAP TS+DL + SG +IVIEER  +E+ H    +GE +IAA GI+ WNPAFDVT A
Sbjct  273  PFYVAAPFTSIDLKIPSGDRIVIEERPDREMTH----VGEHRIAAPGIACWNPAFDVTTA  328

Query  403  SLISGIITEKGVIS  362
             LI+GIITEKGV  
Sbjct  329  DLITGIITEKGVFK  342



>sp|Q0VFN1.1|MTNA_XENTR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Xenopus 
(Silurana) tropicalis]
 gb|AAI18768.1| Translation initiation factor eIF-2B subunit alpha/beta/delta-like 
protein [Xenopus (Silurana) tropicalis]
Length=354

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS A+A ++  +V AV+VGADR+ ANGDTANKIGTY LA+ A +H
Sbjct  211  AYELVYEKIPATLITDSMASAAIRDRKVTAVVVGADRVVANGDTANKIGTYQLAITARYH  270

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS DLSL +G  IVIEER   EL   +   G +IAA GI VWNPAFDVTP
Sbjct  271  GIPFYVAAPSTSCDLSLPTGGSIVIEERPSHELTDIN---GVRIAAPGIGVWNPAFDVTP  327

Query  406  ASLISGIITEKGVISKD  356
              LI+GIITE+GV   +
Sbjct  328  HELITGIITERGVFKPE  344



>ref|XP_003397603.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Bombus 
terrestris]
Length=355

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E++PATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  213  ELVYEDVPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D ++ +G  IVIEER  +E+ H +    ++IAA GI  WNPAFDVTPAS
Sbjct  273  PFYVAAPRTSIDFTIPNGDHIVIEERPEREMTHIN---DQRIAAPGIQCWNPAFDVTPAS  329

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  330  LIKGIITEVGV  340



>ref|XP_003486247.1| PREDICTED: methylthioribose-1-phosphate isomerase-like [Bombus 
impatiens]
Length=355

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E++PATLI D   AALMK+  ++AV+VGADR+AANGDTANKIGTY +A+ A +H V
Sbjct  213  ELVYEDVPATLICDDMVAALMKSRNISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNV  272

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D ++ +G  IVIEER  +E+ H +    ++IAA GI  WNPAFDVTPAS
Sbjct  273  PFYVAAPRTSIDFTIPNGDHIVIEERPEREMTHIN---DQRIAAPGIQCWNPAFDVTPAS  329

Query  400  LISGIITEKGV  368
            LI GIITE GV
Sbjct  330  LIKGIITEVGV  340



>ref|NP_001016877.1| methylthioribose-1-phosphate isomerase [Xenopus (Silurana) tropicalis]
 emb|CAJ83906.1| novel protein containing Initiation factor 2 subunit family domain 
[Xenopus (Silurana) tropicalis]
Length=354

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS A+A ++  +V AV+VGADR+ ANGDTANKIGTY LA+ A +H
Sbjct  211  AYELVYEKIPATLITDSMASAAIRDRKVTAVVVGADRVVANGDTANKIGTYQLAITARYH  270

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS DLSL +G  IVIEER   EL   +   G +IAA GI VWNPAFDVTP
Sbjct  271  GIPFYVAAPSTSCDLSLPTGGSIVIEERPSHELTDIN---GVRIAAPGIGVWNPAFDVTP  327

Query  406  ASLISGIITEKGVISKD  356
              LI+GIITE+GV   +
Sbjct  328  HELITGIITERGVFKPE  344



>ref|WP_024545108.1| methylthioribose-1-phosphate isomerase [Synechococcus sp. NKBG15041c]
Length=346

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 99/136 (73%), Gaps = 5/136 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E V E IP T I D+ AA  M+ GR++AV+VGADRI ANGD ANKIGTYSLA+ A  H V
Sbjct  208  ECVQEGIPVTQICDNMAAHCMQQGRIDAVVVGADRITANGDAANKIGTYSLAIVAKAHNV  267

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAPL++VD SLS G QI IEER PKE+      +G+ +I   G+  +NPAFDVTPA
Sbjct  268  PFYVAAPLSTVDFSLSDGSQIPIEERDPKEIYQ----IGDTRICPEGVQFYNPAFDVTPA  323

Query  403  SLISGIITEKGVISKD  356
             LI+ IITEKG +S D
Sbjct  324  HLITAIITEKGAVSPD  339



>ref|WP_012910912.1| methylthioribose-1-phosphate isomerase [Pirellula staleyi]
 gb|ADB16649.1| translation initiation factor, aIF-2BI family [Pirellula staleyi 
DSM 6068]
Length=357

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV   I ATLI DS AA +M+ G+V AVIVGADRI ANGDTANKIGTYS+A  A  H
Sbjct  208  AFELVQRGIRATLICDSMAAQVMREGKVQAVIVGADRITANGDTANKIGTYSVATLAKAH  267

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP T+ DL+L +G+ I IE+RS  E+ H   G G Q A +G+ V+NPAFDVTP
Sbjct  268  GIPFYVAAPTTTFDLTLETGEGIPIEQRSGTEITH---GFGRQTAPAGVEVYNPAFDVTP  324

Query  406  ASLISGIITEKGVISKDGND  347
            A LI+GI+TE+GVIS    D
Sbjct  325  AELITGIVTERGVISPVTRD  344



>gb|KFB37657.1| AGAP001589-PA-like protein [Anopheles sinensis]
Length=351

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + +PATLI DS  AAL+ + +++A+IVGADR+AANGDTANKIGTY +AV A HH V
Sbjct  211  ELVHDKLPATLITDSMVAALLNSRKIDAIIVGADRVAANGDTANKIGTYQMAVVAKHHQV  270

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAP TS+D++++ G  I IEER  +EL H    +GE +IAA GI  WNPAFDVTPA
Sbjct  271  PFYVAAPFTSIDVAIADGSHIKIEERPERELTH----IGELRIAAPGIGCWNPAFDVTPA  326

Query  403  SLISGIITEKGVIS  362
             LI+GIITE GV  
Sbjct  327  ELITGIITEVGVFK  340



>gb|EWM30107.1| Methylthioribose kinase [Nannochloropsis gaditana]
Length=866

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +P TLI DS  + LM    ++A++VGADRIAANGDTANKIGTY LAV A HH
Sbjct  241  AFELVQDQLPGTLITDSMVSFLMATQGLDAIVVGADRIAANGDTANKIGTYQLAVTAKHH  300

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP TS DLSL+SG QI IEER  +EL       G Q+A   I+VWNP FDVTP
Sbjct  301  GVAFYVAAPFTSFDLSLASGDQIEIEERPARELTQVQ---GIQVAPQEIAVWNPGFDVTP  357

Query  406  ASLISGIITEKGVI  365
            ASLI+GIITEKGVI
Sbjct  358  ASLITGIITEKGVI  371



>ref|WP_014067125.1| methylthioribose-1-phosphate isomerase [Rhodothermus marinus]
 gb|AEN73469.1| Methylthioribose-1-phosphate isomerase [Rhodothermus marinus 
SG0.5JP17-172]
Length=353

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 105/140 (75%), Gaps = 3/140 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL+   +PATLI DS AA +M+ G V+AVIVGADRIAANGD ANKIGTY LAV A  HG+
Sbjct  200  ELLKAGVPATLITDSMAAHVMQQGWVDAVIVGADRIAANGDVANKIGTYGLAVLARAHGI  259

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYV+AP++++D    SG++IVIEER P+E+ H   G G Q A  GI V+NPAFDVTPA 
Sbjct  260  PFYVSAPVSTIDFETPSGKEIVIEERDPREITH---GFGRQTAPEGIRVYNPAFDVTPAE  316

Query  400  LISGIITEKGVISKDGNDAF  341
            L++ IIT++G++    ++A 
Sbjct  317  LVTAIITDRGILRPPYSEAL  336



>ref|XP_005855554.1| methylthioribose-1-phosphate isomerase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU20803.1| methylthioribose-1-phosphate isomerase [Nannochloropsis gaditana 
CCMP526]
Length=852

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +P TLI DS  + LM    ++A++VGADRIAANGDTANKIGTY LAV A HH
Sbjct  241  AFELVQDQLPGTLITDSMVSFLMATQGLDAIVVGADRIAANGDTANKIGTYQLAVTAKHH  300

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GV FYVAAP TS DLSL+SG QI IEER  +EL       G Q+A   I+VWNP FDVTP
Sbjct  301  GVAFYVAAPFTSFDLSLASGDQIEIEERPARELTQVQ---GIQVAPQEIAVWNPGFDVTP  357

Query  406  ASLISGIITEKGVI  365
            ASLI+GIITEKGVI
Sbjct  358  ASLITGIITEKGVI  371



>ref|XP_001865446.1| translation initiation factor eif-2b [Culex quinquefasciatus]
 gb|EDS41718.1| translation initiation factor eif-2b, partial [Culex quinquefasciatus]
Length=328

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E V + IPATL+ DS  A+L K+ ++ AV+VGADR+A+NGDTANKIGTY +AV A HH V
Sbjct  188  EFVHDKIPATLVLDSMVASLFKSRKIAAVVVGADRVASNGDTANKIGTYQIAVVAKHHAV  247

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PFYVAAP TS+D  +S G +I IE+R  +E+ H    +GE +IAA GI  WNPAFDVTPA
Sbjct  248  PFYVAAPSTSIDFEISEGDRIEIEQRPDREMTH----IGEHRIAAPGIRCWNPAFDVTPA  303

Query  403  SLISGIITEKGVIS  362
            +LI+GIITEKGV +
Sbjct  304  NLITGIITEKGVFA  317



>ref|WP_003542966.1| methylthioribose-1-phosphate isomerase [Desulfotomaculum nigrificans]
Length=346

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E+V E IP TLI D  A  LM   +V+ VIVGADRI ANGD ANKIGTY +AV A +H +
Sbjct  202  EMVQEGIPVTLITDGMAGYLMAKKKVDCVIVGADRITANGDVANKIGTYGVAVLANYHKI  261

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPL+++D++LSSG++I IEER PKE+ H H   G+ +A  G+ VWNPAFDVTP S
Sbjct  262  PFYVAAPLSTIDMTLSSGEEIPIEERDPKEVTH-HA--GQAMAPDGVQVWNPAFDVTPNS  318

Query  400  LISGIITEKGVI  365
            L++ IITE G+I
Sbjct  319  LVTAIITEMGII  330



>ref|XP_001510432.2| PREDICTED: methylthioribose-1-phosphate isomerase [Ornithorhynchus 
anatinus]
Length=324

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADS  +  M    V+AV+VGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  179  AYELVYEKIPATLIADSMVSVAMARRGVSAVVVGADRVVANGDTANKVGTYQLAIAAKHH  238

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS D SL SG++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  239  GIPFYVAAPSTSCDPSLPSGREIVIEERPERELTDLN---GVRIAAPGIGVWNPAFDVTP  295

Query  406  ASLIS-GIITEKGVISKD  356
              LIS GI+TE+GV S +
Sbjct  296  HELISGGIVTEQGVFSPE  313



>ref|WP_013810013.1| methylthioribose-1-phosphate isomerase [Desulfotomaculum carboxydivorans]
 gb|AEF93963.1| Methylthioribose-1-phosphate isomerase [Desulfotomaculum carboxydivorans 
CO-1-SRB]
Length=346

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E+V E IP TLI D  A  LM   +V+ VIVGADRI ANGD ANKIGTY +AV A +H +
Sbjct  202  EMVQEGIPVTLITDGMAGYLMAKKKVDCVIVGADRITANGDVANKIGTYGVAVLANYHKI  261

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPL+++D++LSSG++I IEER PKE+ H H   G+ +A  G+ VWNPAFDVTP S
Sbjct  262  PFYVAAPLSTIDMTLSSGEEIPIEERDPKEVTH-HA--GQAMAPDGVQVWNPAFDVTPNS  318

Query  400  LISGIITEKGVI  365
            L++ IITE G+I
Sbjct  319  LVTAIITEMGII  330



>ref|WP_012843989.1| methylthioribose-1-phosphate isomerase [Rhodothermus marinus]
 gb|ACY48378.1| translation initiation factor, aIF-2BI family [Rhodothermus marinus 
DSM 4252]
Length=353

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 103/133 (77%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL+   +PATLI DS AA +M+ G V+AVIVGADRIAANGD ANKIGTY LAV A  HG+
Sbjct  200  ELLKAGVPATLITDSMAAHVMQQGWVDAVIVGADRIAANGDVANKIGTYGLAVLARAHGI  259

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYV+AP++++D    SG++IVIEER P+E+ H   G G+Q A  GI V+NPAFDVTPA 
Sbjct  260  PFYVSAPVSTIDFETPSGKEIVIEERDPREITH---GFGQQTAPEGIRVYNPAFDVTPAE  316

Query  400  LISGIITEKGVIS  362
            L++ IIT++G++ 
Sbjct  317  LVTAIITDRGILR  329



>ref|WP_014186905.1| methylthioribose-1-phosphate isomerase [Desulfosporosinus orientis]
 gb|AET70098.1| S-methyl-5-thioribose-1-phosphate isomerase [Desulfosporosinus 
orientis DSM 765]
Length=345

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ ENI  TLIAD+ A  LM+ G+V+ VIVGADRIAANGDTANKIGTYS+AV A  H
Sbjct  200  ALELIEENISVTLIADNMAGYLMQQGKVDLVIVGADRIAANGDTANKIGTYSVAVLAHAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL +++GQ+I IEER  KE+       G  +A  G+ V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVATGQEIPIEERPAKEMREC---FGVPVAPEGVQVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A  I+GIITEKG++S
Sbjct  317  AKYITGIITEKGIVS  331



>ref|WP_018086583.1| hypothetical protein [Desulfurispora thermophila]
Length=343

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E+  E IP TL+ D+ A  LM  G+V+ VIVGADRI  NGD ANKIGTY +AV A  HG+
Sbjct  202  EMSQEGIPVTLLTDNMAGYLMALGKVDVVIVGADRITRNGDVANKIGTYGVAVLAREHGI  261

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPL+++DLSLSSG++I IE+R P+E+ H  GG+  ++A  G+ VWNPAFDVTPA 
Sbjct  262  PFYVAAPLSTIDLSLSSGREIPIEQRQPEEVTHI-GGV--RVAPEGVQVWNPAFDVTPAR  318

Query  400  LISGIITEKGV  368
            L++ IITE+GV
Sbjct  319  LVTAIITERGV  329



>gb|ADU64905.1| translation initiation factor, aIF-2BI family [Desulfurispirillum 
indicum S5]
Length=347

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL+ +NIP TL+ D+   +LM  G++ AV+VGADRIAANGDTANKIGTY++A+ A  H
Sbjct  202  AFELLQDNIPVTLLCDNMVGSLMAQGKIQAVVVGADRIAANGDTANKIGTYTIAIVAKEH  261

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+P Y+AAP +++DL ++SG QIVIE+R P E+ H     G  IAA+G+ V NP+FDVTP
Sbjct  262  GIPVYIAAPCSTIDLQIASGDQIVIEQRDPAEVTHLQ---GHHIAAAGVQVENPSFDVTP  318

Query  406  ASLISGIITEKGV  368
            A  IS IIT+KGV
Sbjct  319  ARFISAIITDKGV  331



>ref|XP_008049359.1| PREDICTED: methylthioribose-1-phosphate isomerase, partial [Tarsius 
syrichta]
Length=244

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E+IPATLIADSA AA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  88   AFELVYEHIPATLIADSAVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIAAKHH  147

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS DL L SGQ+IV+EER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  148  GIPFYVAAPSTSCDLHLESGQEIVVEERPSQELTDVN---GVRIAAPGIGVWNPAFDVTP  204

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  205  HDLITGGIITELGVFAPE  222



>gb|EQD24052.1| hypothetical protein D084_Lepto4C00613G0001, partial [Leptospirillum 
sp. Group IV 'UBA BS']
Length=334

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 100/132 (76%), Gaps = 5/132 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL  +NIP TLI DS AA +M  G+VNAVIVGADRIAANGDTANKIGTY LAV A  H
Sbjct  207  AYELAADNIPVTLITDSMAAMVMAQGKVNAVIVGADRIAANGDTANKIGTYGLAVLAREH  266

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQ-IAASGISVWNPAFDVT  410
            G+PFYVAAP +++D +  SG+ I IEERSP+E+ H     GE  +A  GISV+NPAFDVT
Sbjct  267  GIPFYVAAPFSTIDPATPSGRTIPIEERSPREITHA----GETPMAPEGISVFNPAFDVT  322

Query  409  PASLISGIITEK  374
            PA  I+ IITEK
Sbjct  323  PARYITAIITEK  334



>ref|WP_041726234.1| methylthioribose-1-phosphate isomerase [Desulfurispirillum indicum]
Length=343

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL+ +NIP TL+ D+   +LM  G++ AV+VGADRIAANGDTANKIGTY++A+ A  H
Sbjct  198  AFELLQDNIPVTLLCDNMVGSLMAQGKIQAVVVGADRIAANGDTANKIGTYTIAIVAKEH  257

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+P Y+AAP +++DL ++SG QIVIE+R P E+ H     G  IAA+G+ V NP+FDVTP
Sbjct  258  GIPVYIAAPCSTIDLQIASGDQIVIEQRDPAEVTHLQ---GHHIAAAGVQVENPSFDVTP  314

Query  406  ASLISGIITEKGV  368
            A  IS IIT+KGV
Sbjct  315  ARFISAIITDKGV  327



>ref|XP_003057882.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas pusilla CCMP1545]
 gb|EEH57833.1| translation initiation factor fusion with methylthioribose kinase 
[Micromonas pusilla CCMP1545]
Length=815

 Score =   152 bits (385),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 88/149 (59%), Positives = 112/149 (75%), Gaps = 3/149 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E+  E +P TLI DSAAAALM  G+V+AV+VGADR+A NGDTANKIGTY+LAV   +HGV
Sbjct  230  EIAFEKMPGTLICDSAAAALMAKGKVDAVVVGADRVADNGDTANKIGTYNLAVSCAYHGV  289

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAP T++D + ++G  IVIE+R   E+ H+   LG ++AA GI VWNP+FDVTP S
Sbjct  290  PFFVAAPSTTLDANTATGADIVIEDRPSTEVTHS---LGTRVAAEGIDVWNPSFDVTPGS  346

Query  400  LISGIITEKGVISKDGNDAFDITGFVHKV  314
            LI GIITE GV  K+ + AF+I  F+  V
Sbjct  347  LIEGIITESGVARKNADGAFEIGKFIRDV  375



>gb|KIZ04682.1| isopentenyl-diphosphate Delta-isomerase [Monoraphidium neglectum]
Length=582

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + +PATLI DSAAAALM AG V+AV+VGADR+ ANGDTANKIGTY+L + A HH
Sbjct  223  AFELVHDGLPATLICDSAAAALMGAGDVDAVVVGADRVVANGDTANKIGTYALGIAAAHH  282

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PF+VAAP T++D SL SG  IVIE+R P+E+ H     G+++AA GI +WNP FDV P
Sbjct  283  SLPFFVAAPTTTLDASLPSGAAIVIEQRPPEEITHFR---GQRVAAEGIGIWNPCFDVVP  339

Query  406  ASLISGIITEKGVISKD  356
             SL+ GI+TE+GV+ +D
Sbjct  340  GSLVEGIVTERGVVPRD  356



>ref|XP_004688304.1| PREDICTED: methylthioribose-1-phosphate isomerase [Condylura 
cristata]
Length=358

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADS AAA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  213  AFELVYEQIPATLIADSMAAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAILAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L SGQ+IVIEER  +EL   H   G +IAA GI VWNPAFDVTP
Sbjct  273  GIPFYVAAPSSSCDLHLDSGQEIVIEERPGQELTDVH---GIRIAAPGIGVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  330  RDLITGGIITELGVFT  345



>ref|WP_040198990.1| methylthioribose-1-phosphate isomerase [Geoalkalibacter subterraneus]
 gb|AJF05608.1| methylthioribose-1-phosphate isomerase [Geoalkalibacter subterraneus]
Length=347

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL+ + IP TLI D+ A  LM  G ++ VIVGADRIAANGDTANKIGTY++AV A  HG+
Sbjct  204  ELMKDRIPVTLICDNMAGYLMSRGEIDCVIVGADRIAANGDTANKIGTYTVAVLAREHGI  263

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP++++DLSL  G QI IEER P+E+  TH G G Q+A   I V NPAFDVTPA 
Sbjct  264  PFYVAAPISTIDLSLPDGSQIPIEERGPREV--THMG-GRQLAPDSIGVRNPAFDVTPAR  320

Query  400  LISGIITEKGVISKD  356
            LI+ IITE GV+  +
Sbjct  321  LITAIITEHGVVRDN  335



>ref|WP_034610423.1| methylthioribose-1-phosphate isomerase [Desulfosporosinus sp. 
Tol-M]
 gb|KGP77215.1| methylthioribose-1-phosphate isomerase [Desulfosporosinus sp. 
Tol-M]
Length=345

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ + IP TLIAD+ A  LM+ G+V+ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  TMELMQDKIPVTLIADNMAGYLMQQGKVDLVIVGADRIAANGDTANKIGTYSLAVLAQAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAP +++DL +++GQ+I IEER  KE+       G Q+A + ++V+NPAFDVTP
Sbjct  260  AIPFYVAAPTSTIDLKVATGQEIPIEERPDKEMREC---FGVQVAPAEVNVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A  I+GIITEKG+++
Sbjct  317  AKYITGIITEKGIMT  331



>ref|WP_008411947.1| Methylthioribose-1-phosphate isomerase [Desulfotomaculum hydrothermale]
 emb|CCO08490.1| Methylthioribose-1-phosphate isomerase [Desulfotomaculum hydrothermale 
Lam5 = DSM 18033]
Length=350

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E++   IP TLI D+ A  LM   +V+ VIVGADRI ANGD ANKIGTY +AV A HH +
Sbjct  206  EMLQAGIPVTLITDNMAGYLMAKQQVDCVIVGADRITANGDVANKIGTYGVAVLAKHHNI  265

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPL+++DL LSSG +I IEER P+E+ H HG  G+ +A  G+ VWNPAFDVTP  
Sbjct  266  PFYVAAPLSTIDLRLSSGDEIPIEERDPREVTH-HG--GQAMAPEGVQVWNPAFDVTPHQ  322

Query  400  LISGIITEKGVI  365
            L++ IITE+GVI
Sbjct  323  LVTAIITEQGVI  334



>ref|WP_015195030.1| methylthioribose-1-phosphate isomerase [Stanieria cyanosphaera]
 gb|AFZ37371.1| methylthioribose-1-phosphate isomerase [Stanieria cyanosphaera 
PCC 7437]
Length=354

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E V E IP T+I DS AA  M+ G ++AVIVGADRIAANGDTANKIGTYSLA+ A  H +
Sbjct  212  ECVQEGIPVTVITDSMAAHCMQQGMIDAVIVGADRIAANGDTANKIGTYSLAIVAQAHNI  271

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PF+VAAP ++VD S+S G QI IEER P E+         +I ASG+  +NPAFDVTPAS
Sbjct  272  PFFVAAPFSTVDFSISDGSQIPIEERHPSEIYQIG---NTEICASGVEFYNPAFDVTPAS  328

Query  400  LISGIITEKGVIS  362
            LI  IITEKG IS
Sbjct  329  LIKAIITEKGAIS  341



>ref|WP_030007368.1| methylthioribose-1-phosphate isomerase [Synechococcus sp. NKBG042902]
Length=346

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E V E IP T I D+ AA  M+ GR++AV+VGADRI ANGD ANKIGTYSLA+ A  H V
Sbjct  208  ECVQEGIPVTQICDNMAAHCMQQGRIDAVVVGADRITANGDAANKIGTYSLAIVAKAHNV  267

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PF+VAAPL++VD SLS G+QI IEER PKE+      +G+ +I   G+  +NPAFDVTPA
Sbjct  268  PFFVAAPLSTVDFSLSDGKQIPIEERDPKEVYQ----IGDTRICPEGVQFYNPAFDVTPA  323

Query  403  SLISGIITEKGVISKD  356
             LI+ IITEKG ++ D
Sbjct  324  HLITAIITEKGAVAPD  339



>ref|WP_029717928.1| methylthioribose-1-phosphate isomerase [Atribacteria bacterium 
SCGC AAA255-G05]
Length=345

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL  E IP TLI D+ A  LM   +V+ +IVGADRIA NGD  NKIGTYSL+V A  + V
Sbjct  202  ELTQEKIPFTLITDNMAGFLMYRKKVDLIIVGADRIARNGDVVNKIGTYSLSVLARENKV  261

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP++S+D+SL SG++I IEER+PKE+ H    LG+QIA +G+ V+NPAFD+TP  
Sbjct  262  PFYVAAPISSIDMSLKSGEEIPIEERNPKEVTHI---LGKQIAPAGVKVFNPAFDLTPNG  318

Query  400  LISGIITEKGVISK  359
             +  IITEKG+I K
Sbjct  319  YVEAIITEKGIIRK  332



>ref|WP_022245755.1| methylthioribose-1-phosphate isomerase [Clostridium sp. CAG:306]
 emb|CDC17999.1| methylthioribose-1-phosphate isomerase [Clostridium sp. CAG:306]
Length=355

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL  + IP TLI D  +   M  G ++ V+VGADRIA+NGDTANKIGTY+LA+ A +H
Sbjct  210  TFELAMDGIPVTLITDGMSGYFMNKGMIDMVVVGADRIASNGDTANKIGTYNLAIVANYH  269

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFY+AAPL+++D S+SSG+QI IEER  KE+ H +   G+ + A G++V NP FDVTP
Sbjct  270  NVPFYIAAPLSTIDTSISSGKQIPIEERDHKEVTHIN---GKSVCAEGVNVINPGFDVTP  326

Query  406  ASLISGIITEKGVI  365
            A LI GIITEKGV+
Sbjct  327  AELIKGIITEKGVL  340



>ref|XP_006139228.1| PREDICTED: methylthioribose-1-phosphate isomerase [Pelodiscus 
sinensis]
Length=194

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 101/135 (75%), Gaps = 4/135 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E+IPATLIADS  +  MK   ++AVIVGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  51   AYELVYEHIPATLIADSMVSVAMKEKGLSAVIVGADRVVANGDTANKVGTYQLAIAAKHH  110

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS DLSL+ G  IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  111  GIPFYVAAPSTSCDLSLAEGSDIVIEERPSQELTDVN---GVRIAAPGIGVWNPAFDVTP  167

Query  406  ASLIS-GIITEKGVI  365
              LI+ GI+TE GV 
Sbjct  168  HELITGGIVTEFGVF  182



>ref|WP_041443958.1| methylthioribose-1-phosphate isomerase [Synechococcus sp. PCC 
7002]
 sp|B1XJK0.2|MTNA_SYNP2 RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase [Synechococcus sp. PCC 7002]
Length=346

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E V E IP T I D+ AA  M+ GR++AV+VGADRI ANGD ANKIGTYSLA+ A  H V
Sbjct  208  ECVQEGIPVTQICDNMAAHCMQQGRIDAVVVGADRITANGDAANKIGTYSLAIVAKAHNV  267

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PF+VAAPL++VD SLS G+QI IEER PKE+      +G+ +I   G+  +NPAFDVTPA
Sbjct  268  PFFVAAPLSTVDFSLSDGKQIPIEERDPKEVYQ----IGDTRICPEGVQFYNPAFDVTPA  323

Query  403  SLISGIITEKGVISKD  356
             LI+ IITEKG ++ D
Sbjct  324  HLITAIITEKGAVAPD  339



>dbj|BAC33016.1| unnamed protein product [Mus musculus]
Length=369

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANKIGTY LA+ A HH
Sbjct  213  AFELVYEQIPATLITDSMAAAAMAHQGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPFYVAAP +S DL L SG++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  273  GVPFYVAAPSSSCDLHLESGKEIVIEERPSQELTDLN---GVRIAAQGIRVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  330  HELITGGIITELGVFAPE  347



>ref|XP_006918814.1| PREDICTED: methylthioribose-1-phosphate isomerase [Pteropus alecto]
 gb|ELK06741.1| Methylthioribose-1-phosphate isomerase [Pteropus alecto]
Length=361

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AVIVGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  214  AFELVYEQIPATLITDSMAAAAMAHQGVSAVIVGADRVVANGDTANKVGTYQLAIAAKHH  273

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +GQQIVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  274  GIPFYVAAPSSSCDLHLETGQQIVIEERPGQELTDVN---GVRIAAPGIGVWNPAFDVTP  330

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  331  HDLITGGIITELGVFA  346



>ref|XP_011380861.1| PREDICTED: methylthioribose-1-phosphate isomerase [Pteropus vampyrus]
Length=361

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AVIVGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  214  AFELVYEQIPATLITDSMAAAAMAHQGVSAVIVGADRVVANGDTANKVGTYQLAIAAKHH  273

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +GQQIVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  274  GIPFYVAAPSSSCDLHLETGQQIVIEERPGQELTDVN---GVRIAAPGIGVWNPAFDVTP  330

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  331  HDLITGGIITELGVFA  346



>ref|WP_014828515.1| methylthioribose-1-phosphate isomerase [Desulfosporosinus acidiphilus]
 gb|AFM42527.1| methylthioribose-1-phosphate isomerase [Desulfosporosinus acidiphilus 
SJ4]
Length=345

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ + IP TLIAD+ A  LM+ G+V+ VIVGADRIAANGDTANKIGTYSLAV A  H
Sbjct  200  ALELMNDKIPVTLIADNMAGFLMQQGKVDLVIVGADRIAANGDTANKIGTYSLAVLAQAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFYVAAP +++DL +++GQ+I IEER+ KE+       G  +A   +SV+NPAFDVTP
Sbjct  260  EVPFYVAAPTSTIDLKVATGQEIPIEERAAKEMREC---FGVPMAPDEVSVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A  I+GIITEKG+++
Sbjct  317  AKYITGIITEKGIVT  331



>ref|WP_006716525.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium metallireducens]
 gb|AHF07602.1| methylthioribose-1-phosphate isomerase [Desulfitobacterium metallireducens 
DSM 15288]
Length=345

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL+ +NI  TLIAD+ A  LM+ G+++ VIVGADRIAANGDTANKIGTYS+AV A  H
Sbjct  200  TFELMKDNISVTLIADNMAGYLMQQGKIDLVIVGADRIAANGDTANKIGTYSVAVLAHAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFY+AAP +++DL + SGQ+I IEER+P+EL       G Q A   + V+NPAFDVTP
Sbjct  260  GIPFYIAAPTSTIDLKVPSGQEIPIEERNPQELREL---FGVQTAPLDVPVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A  I+GIITEKG++S
Sbjct  317  AKYITGIITEKGIVS  331



>ref|XP_008104502.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X2 
[Anolis carolinensis]
Length=341

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 101/134 (75%), Gaps = 4/134 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATLIADS  +  MK  +++AVIVGADR+ ANGDTANK+GTY LA+ A HHG+
Sbjct  196  ELVYEEIPATLIADSMVSMAMKEKKISAVIVGADRVVANGDTANKVGTYQLAIAAKHHGI  255

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS DLSL  G QI+IEER  +EL   +   G ++AA GI VWNPAFDVTP  
Sbjct  256  PFYVAAPSTSCDLSLEHGGQIIIEERPSQELTDIN---GVRVAAPGIGVWNPAFDVTPHD  312

Query  400  LIS-GIITEKGVIS  362
            LI+ GI+TE GV +
Sbjct  313  LITGGIVTELGVFA  326



>gb|EHA19257.1| hypothetical protein ASPNIDRAFT_54270 [Aspergillus niger ATCC 
1015]
Length=382

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 94/137 (69%), Gaps = 11/137 (8%)
 Frame = -3

Query  688  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  509
            +V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG +I+IE
Sbjct  244  KVDAIVVGADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATPSGNEIIIE  303

Query  508  ERSPKELLHTHGGLGE-----------QIAASGISVWNPAFDVTPASLISGIITEKGVIS  362
            ER+  E+ +  G               +IAA GI VWNPAFDVTP++LI GIITE+GV+ 
Sbjct  304  ERAASEVTNVRGPRASNSTNGIELETVRIAADGIDVWNPAFDVTPSTLIDGIITERGVVE  363

Query  361  KDGNDAFDITGFVHKVS  311
            KD +  F +       S
Sbjct  364  KDASGQFHLEDLFRNSS  380



>ref|XP_006779623.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase 1, partial [Myotis davidii]
Length=263

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A +H
Sbjct  107  AFELVYEQIPATLITDSMAAATMAHRDVSAVVVGADRVVANGDTANKVGTYQLAIAAKYH  166

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L  GQQIVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  167  GIPFYVAAPSSSCDLRLEMGQQIVIEERPGQELTDVN---GVRIAAPGIGVWNPAFDVTP  223

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  224  HDLITGGIITELGVFT  239



>ref|XP_011342004.1| PREDICTED: methylthioribose-1-phosphate isomerase [Cerapachys 
biroi]
 gb|EZA61921.1| Methylthioribose-1-phosphate isomerase [Cerapachys biroi]
Length=369

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV + IPATLI D   AA ++  ++ AV+VGADR+AANGDTANKIGTY +AV A +H
Sbjct  214  AYELVHDKIPATLICDDMVAAALRKKQITAVVVGADRVAANGDTANKIGTYQIAVLAKYH  273

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             +PFYVAAP TS+DL++ SG  +VIEER  +E+ H +   G ++AA  I  WNPAFDVTP
Sbjct  274  KIPFYVAAPRTSIDLTMPSGDDMVIEERPVREMTHIN---GRRVAAKDIDCWNPAFDVTP  330

Query  406  ASLISGIITEKGVIS  362
            ASLI+GIIT+ GV  
Sbjct  331  ASLITGIITDIGVFK  345



>ref|XP_006560811.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X3 [Apis mellifera]
Length=311

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -3

Query  685  VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  506
            ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEE
Sbjct  194  ISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEE  253

Query  505  RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  368
            R  +EL H +    ++IAA GI  WNPAFDVTPA+LI GIITE GV
Sbjct  254  RPERELTHIN---DQRIAAPGIQCWNPAFDVTPANLIKGIITEVGV  296



>ref|WP_025322587.1| methylthioribose-1-phosphate isomerase [Deferrisoma camini]
Length=344

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (71%), Gaps = 3/141 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            EL  + IP TLI D  A   MK G V+AV+VGADRI  +GD ANKIGTY+LAV A  HGV
Sbjct  203  ELRKDGIPVTLITDGMAGYRMKRGGVDAVVVGADRITRSGDVANKIGTYTLAVLAREHGV  262

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAPL++VD  LSSG +I IEER P E+  TH G G ++A  G+ VWNPAFDVTPA 
Sbjct  263  PFYVAAPLSTVDFELSSGDEIPIEERDPAEV--THCG-GTRVAPEGVEVWNPAFDVTPAR  319

Query  400  LISGIITEKGVISKDGNDAFD  338
            L++ I+TE+GV      ++ D
Sbjct  320  LVTAIVTERGVARPPYTESLD  340



>ref|XP_005881674.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Myotis brandtii]
Length=305

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A +H
Sbjct  149  AFELVYEQIPATLITDSMAAAAMAHRDVSAVVVGADRVVANGDTANKVGTYQLAIAAKYH  208

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +GQQIVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  209  GIPFYVAAPSSSCDLRLETGQQIVIEERPGQELTDVN---GVRIAAPGIGVWNPAFDVTP  265

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  266  HDLITGGIITELGVFT  281



>ref|XP_003501976.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Cricetulus griseus]
 gb|EGW00630.1| Methylthioribose-1-phosphate isomerase [Cricetulus griseus]
 gb|ERE78254.1| methylthioribose-1-phosphate isomerase [Cricetulus griseus]
Length=369

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANKIGTY LA+ A HH
Sbjct  213  AFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +G++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  273  GIPFYVAAPSSSCDLQLETGREIVIEERPSQELTDLN---GVRIAAQGIQVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  330  HELITGGIITELGVFAPE  347



>ref|WP_041533752.1| methylthioribose-1-phosphate isomerase, partial [Pelotomaculum 
thermopropionicum]
Length=348

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E++ E IP TLI DS A  L+  G+ + V+VGADRIAANGD ANKIGTYSLAV A  H +
Sbjct  203  EMLQEGIPVTLITDSMAGYLLAKGKADLVVVGADRIAANGDVANKIGTYSLAVLAREHKI  262

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP++++DLSL+SG++I IEER   E+ H     G  +A  G++VWNPAFDVTPA 
Sbjct  263  PFYVAAPVSTIDLSLASGEEIPIEERDSSEVTHLA---GRPVAPEGVNVWNPAFDVTPAR  319

Query  400  LISGIITEKGVIS  362
            LI+ IIT++G++ 
Sbjct  320  LITAIITDRGIVK  332



>ref|XP_003218379.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
 ref|XP_008104501.1| PREDICTED: methylthioribose-1-phosphate isomerase isoform X1 
[Anolis carolinensis]
Length=359

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 101/134 (75%), Gaps = 4/134 (3%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV E IPATLIADS  +  MK  +++AVIVGADR+ ANGDTANK+GTY LA+ A HHG+
Sbjct  214  ELVYEEIPATLIADSMVSMAMKEKKISAVIVGADRVVANGDTANKVGTYQLAIAAKHHGI  273

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS DLSL  G QI+IEER  +EL   +   G ++AA GI VWNPAFDVTP  
Sbjct  274  PFYVAAPSTSCDLSLEHGGQIIIEERPSQELTDIN---GVRVAAPGIGVWNPAFDVTPHD  330

Query  400  LIS-GIITEKGVIS  362
            LI+ GI+TE GV +
Sbjct  331  LITGGIVTELGVFA  344



>ref|XP_006560810.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Apis mellifera]
Length=327

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -3

Query  685  VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  506
            ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEE
Sbjct  210  ISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEE  269

Query  505  RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  368
            R  +EL H +    ++IAA GI  WNPAFDVTPA+LI GIITE GV
Sbjct  270  RPERELTHIN---DQRIAAPGIQCWNPAFDVTPANLIKGIITEVGV  312



>ref|XP_006993155.1| PREDICTED: methylthioribose-1-phosphate isomerase [Peromyscus 
maniculatus bairdii]
Length=368

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANKIGTY LA+ A HH
Sbjct  213  AFELVYEQIPATLITDSMAAAAMAHQGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +G++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  273  GIPFYVAAPSSSCDLHLETGREIVIEERPSQELTDVN---GVRIAAQGIRVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  330  HELITGGIITELGVFAPE  347



>ref|XP_005310723.1| PREDICTED: methylthioribose-1-phosphate isomerase [Chrysemys 
picta bellii]
Length=359

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E+IPATLIADS  +  MK   V+AVIVGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  212  AYELVYEHIPATLIADSMVSVAMKEKGVSAVIVGADRVVANGDTANKVGTYQLAIAAKHH  271

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS DLSL+ G +IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  272  GIPFYVAAPSTSCDLSLAEGAEIVIEERPSQELTDVN---GVRIAAPGIGVWNPAFDVTP  328

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV   +
Sbjct  329  HELITGGIITELGVFRPE  346



>ref|WP_009620316.1| methylthioribose-1-phosphate isomerase [Desulfosporosinus sp. 
OT]
 gb|EGW38612.1| methylthioribose-1-phosphate isomerase [Desulfosporosinus sp. 
OT]
Length=345

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL+ + IP TLI D+ A  LM+ G+V+ VIVGADRIAANGDTANKIGTYS+AV A  H
Sbjct  200  ALELLRDKIPVTLITDNMAGYLMQQGKVDLVIVGADRIAANGDTANKIGTYSVAVLAQAH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +++DL ++SGQ+I IEER  KE+       G  +A   ++V+NPAFDVTP
Sbjct  260  GIPFYVAAPTSTIDLKVASGQEIPIEERPSKEVREC---FGSAVAPEEVNVYNPAFDVTP  316

Query  406  ASLISGIITEKGVIS  362
            A  I+GIITEKG+++
Sbjct  317  AKYITGIITEKGIVT  331



>sp|A5D1G8.1|MTNA_PELTS RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase [Pelotomaculum thermopropionicum 
SI]
 dbj|BAF59911.1| predicted translation initiation factor 2B subunit [Pelotomaculum 
thermopropionicum SI]
Length=364

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E++ E IP TLI DS A  L+  G+ + V+VGADRIAANGD ANKIGTYSLAV A  H +
Sbjct  204  EMLQEGIPVTLITDSMAGYLLAKGKADLVVVGADRIAANGDVANKIGTYSLAVLAREHKI  263

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP++++DLSL+SG++I IEER   E+ H     G  +A  G++VWNPAFDVTPA 
Sbjct  264  PFYVAAPVSTIDLSLASGEEIPIEERDSSEVTHLA---GRPVAPEGVNVWNPAFDVTPAR  320

Query  400  LISGIITEKGVIS  362
            LI+ IIT++G++ 
Sbjct  321  LITAIITDRGIVK  333



>ref|NP_001010947.1| methylthioribose-1-phosphate isomerase [Rattus norvegicus]
 sp|Q5HZE4.1|MTNA_RAT RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Rattus 
norvegicus]
 gb|AAH89060.1| Translation initiation factor eIF-2B subunit alpha/beta/delta-like 
protein [Rattus norvegicus]
 gb|EDL92227.1| similar to hypothetical protein MGC3207, isoform CRA_a [Rattus 
norvegicus]
Length=369

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANKIGTY LA+ A HH
Sbjct  213  AFELVYEKIPATLITDSMAAAAMVHQGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +G++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  273  GIPFYVAAPSSSCDLRLETGKEIVIEERPSQELTDLN---GVRIAAQGIRVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  330  HELITGGIITELGVFAPE  347



>ref|XP_006621216.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X4 [Apis dorsata]
Length=311

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -3

Query  685  VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  506
            ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEE
Sbjct  194  ISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEE  253

Query  505  RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  368
            R  +EL H +    ++IAA GI  WNPAFD+TPA+LI GIITE GV
Sbjct  254  RPERELTHIN---DQRIAAPGIQCWNPAFDITPANLIKGIITEVGV  296



>gb|ACB00286.1| translation initiation factor, putative, aIF-2BI family [Synechococcus 
sp. PCC 7002]
Length=380

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            E V E IP T I D+ AA  M+ GR++AV+VGADRI ANGD ANKIGTYSLA+ A  H V
Sbjct  242  ECVQEGIPVTQICDNMAAHCMQQGRIDAVVVGADRITANGDAANKIGTYSLAIVAKAHNV  301

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGE-QIAASGISVWNPAFDVTPA  404
            PF+VAAPL++VD SLS G+QI IEER PKE+      +G+ +I   G+  +NPAFDVTPA
Sbjct  302  PFFVAAPLSTVDFSLSDGKQIPIEERDPKEVYQ----IGDTRICPEGVQFYNPAFDVTPA  357

Query  403  SLISGIITEKGVISKD  356
             LI+ IITEKG ++ D
Sbjct  358  HLITAIITEKGAVAPD  373



>ref|XP_011262788.1| PREDICTED: methylthioribose-1-phosphate isomerase [Camponotus 
floridanus]
Length=353

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 3/133 (2%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGV  581
            ELV + IPATLI D   AA++K  ++ AV+VGADR+  NGDTANKIGTY +A+ A +H V
Sbjct  216  ELVHDKIPATLICDDMVAAVLKTKKITAVVVGADRVTLNGDTANKIGTYQIAILAKYHNV  275

Query  580  PFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPAS  401
            PFYVAAP TS+D ++  G  I+IE+RS +E+ H +G    +IAA GI  WNPAFDVTPAS
Sbjct  276  PFYVAAPRTSIDTNMYKGDDIIIEKRSAEEITHINGN---RIAAEGIECWNPAFDVTPAS  332

Query  400  LISGIITEKGVIS  362
            LI+GIITE G  S
Sbjct  333  LITGIITEIGTFS  345



>ref|NP_080699.3| methylthioribose-1-phosphate isomerase [Mus musculus]
 sp|Q9CQT1.1|MTNA_MOUSE RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Mus 
musculus]
 dbj|BAB27014.1| unnamed protein product [Mus musculus]
 dbj|BAB29034.1| unnamed protein product [Mus musculus]
 gb|AAH25049.1| Methylthioribose-1-phosphate isomerase homolog (S. cerevisiae) 
[Mus musculus]
 dbj|BAE37957.1| unnamed protein product [Mus musculus]
 gb|EDL10941.1| RIKEN cDNA 2410018C20, isoform CRA_b [Mus musculus]
Length=369

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANKIGTY LA+ A HH
Sbjct  213  AFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPFYVAAP +S DL L +G++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  273  GVPFYVAAPSSSCDLHLETGKEIVIEERPSQELTDLN---GVRIAAQGIRVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  330  HELITGGIITELGVFAPE  347



>ref|XP_002679019.1| predicted protein [Naegleria gruberi]
 sp|D2VAA9.1|MTNA_NAEGR RecName: Full=Methylthioribose-1-phosphate isomerase; Short=M1Pi; 
Short=MTR-1-P isomerase; AltName: Full=S-methyl-5-thioribose-1-phosphate 
isomerase; AltName: Full=Translation initiation 
factor eIF-2B subunit alpha/beta/delta-like protein [Naegleria 
gruberi]
 gb|EFC46275.1| predicted protein [Naegleria gruberi]
Length=380

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IP+TLI DSA + L K  +++A+IVGADR+  NGDTANKIGTY +AV A HH
Sbjct  222  AFELVYEKIPSTLICDSAVSYLFKTKKIDAIIVGADRVCNNGDTANKIGTYHIAVSAKHH  281

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP TS+DL+L+SG  I IEERS KE+ H      E+     I VWNP FDVT 
Sbjct  282  GIPFYVAAPFTSIDLTLASGDLITIEERSEKEITHYRNN-DERAVVENIGVWNPGFDVTT  340

Query  406  ASLISGIITEKGVIS  362
            A LISG  T+ GV +
Sbjct  341  ADLISGFFTDIGVFT  355



>ref|XP_004009303.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Ovis aries]
Length=291

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  135  AFELVYEQIPATLITDSMAAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAITAKHH  194

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +GQ+IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  195  GIPFYVAAPSSSCDLRLETGQEIVIEERPGQELTDIN---GIRIAAPGIGVWNPAFDVTP  251

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  252  HDLITGGIITELGVFA  267



>ref|XP_006621215.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X3 [Apis dorsata]
Length=327

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -3

Query  685  VNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIEE  506
            ++AV+VGADR+AANGDTANKIGTY +A+ A +H VPFYVAAP TS+D S+ SG  I+IEE
Sbjct  210  ISAVVVGADRVAANGDTANKIGTYQIAIVAKYHNVPFYVAAPRTSIDFSIPSGDHIIIEE  269

Query  505  RSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGV  368
            R  +EL H +    ++IAA GI  WNPAFD+TPA+LI GIITE GV
Sbjct  270  RPERELTHIN---DQRIAAPGIQCWNPAFDITPANLIKGIITEVGV  312



>gb|EPY88013.1| hypothetical protein CB1_000201003 [Camelus ferus]
Length=263

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADS AAA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  118  AFELVYEQIPATLIADSMAAAAMAHQGVSAVVVGADRVVANGDTANKVGTYQLAIAAKHH  177

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +GQ+I+IEER  +EL   +   G +IAA GI++WNPAFDVTP
Sbjct  178  GIPFYVAAPSSSCDLRLETGQEIIIEERPGQELTDVN---GVRIAAPGIAIWNPAFDVTP  234

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  235  HDLITGGIITELGVFAPE  252



>gb|KIL43486.1| methylthioribose-1-phosphate isomerase [Jeotgalibacillus alimentarius]
Length=350

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 3/111 (3%)
 Frame = -3

Query  688  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  509
            +++A++VGADRI ANGDTANKIGTY LA+ A  HG+PFYVAAPL+++DL+ ++G +IVIE
Sbjct  229  KIDAILVGADRITANGDTANKIGTYGLAILAKAHGIPFYVAAPLSTIDLNTATGDEIVIE  288

Query  508  ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKD  356
            ER   E+ H     G++IA  GI+V+NPAFDVTP  LISGIITEKG++S D
Sbjct  289  ERHADEITHL---AGKRIAPEGINVFNPAFDVTPHELISGIITEKGIVSGD  336



>ref|WP_041123830.1| methylthioribose-1-phosphate isomerase [Jeotgalibacillus alimentarius]
Length=345

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 3/111 (3%)
 Frame = -3

Query  688  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  509
            +++A++VGADRI ANGDTANKIGTY LA+ A  HG+PFYVAAPL+++DL+ ++G +IVIE
Sbjct  224  KIDAILVGADRITANGDTANKIGTYGLAILAKAHGIPFYVAAPLSTIDLNTATGDEIVIE  283

Query  508  ERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISKD  356
            ER   E+ H     G++IA  GI+V+NPAFDVTP  LISGIITEKG++S D
Sbjct  284  ERHADEITHL---AGKRIAPEGINVFNPAFDVTPHELISGIITEKGIVSGD  331



>ref|XP_006003719.1| PREDICTED: methylthioribose-1-phosphate isomerase-like isoform 
X2 [Latimeria chalumnae]
Length=298

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 4/111 (4%)
 Frame = -3

Query  691  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  512
            G   AV+VGADR+ ANGDTANKIGTY LA+ A +HG+PFYVAAP TS DL+L +G+QIVI
Sbjct  177  GTALAVVVGADRVVANGDTANKIGTYQLAIAAKYHGIPFYVAAPSTSCDLTLENGEQIVI  236

Query  511  EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLIS-GIITEKGVIS  362
            EERS  EL   +   G +IAA GI+VWNPAFDVTP  LI+ GIITE GV S
Sbjct  237  EERSHSELTDVN---GMRIAAPGIAVWNPAFDVTPCDLITGGIITEFGVFS  284



>ref|XP_003798062.1| PREDICTED: methylthioribose-1-phosphate isomerase [Otolemur garnettii]
Length=364

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    ++AV+VGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  213  AFELVYEQIPATLITDSMAAAAMIHKGISAVVVGADRVVANGDTANKVGTYQLAIAAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +GQ+I+IEER  +EL   +   G +IAA GI+VWNPAFDVTP
Sbjct  273  GIPFYVAAPSSSCDLRLQTGQEIIIEERPGQELTDVN---GVRIAAPGIAVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  330  HELITGGIITELGVFAPE  347



>dbj|GAA90121.1| translation initiation factor [Aspergillus kawachii IFO 4308]
Length=340

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 92/137 (67%), Gaps = 11/137 (8%)
 Frame = -3

Query  688  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  509
            +V+A++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++DL+  SG +I+IE
Sbjct  202  QVDAIVVGADRVAANGDTANKIGTYGLAVLARYHGVKFLVAAPLTTIDLATPSGHEIIIE  261

Query  508  ERSPKELLHTHGGLGEQ-----------IAASGISVWNPAFDVTPASLISGIITEKGVIS  362
            ER+  E+    G    +           IAA GI VWNPAFDVTP++LI GIITEKGV  
Sbjct  262  ERAASEVTTVRGPRANKSTNGIELETVRIAADGIDVWNPAFDVTPSTLIDGIITEKGVAE  321

Query  361  KDGNDAFDITGFVHKVS  311
            KD +  F +       S
Sbjct  322  KDADGQFHLEDLFRNSS  338



>ref|WP_021916583.1| methylthioribose-1-phosphate isomerase [Brachyspira sp. CAG:484]
 emb|CCY23457.1| methylthioribose-1-phosphate isomerase [Brachyspira sp. CAG:484]
Length=351

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            ++EL  + IP TLI D   +  MK G ++ V+VGADRIAANGDTANKIGTY++A+ A +H
Sbjct  208  TLELTMDGIPTTLITDGMCSYFMKKGMIDMVVVGADRIAANGDTANKIGTYTVAIAAKYH  267

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
             VPFY+AAPL+++D S+ SG +IVIEERS +E+ H +G +   I A  ++V NP FDVTP
Sbjct  268  NVPFYIAAPLSTIDRSIKSGDEIVIEERSREEVTHINGKI---ICAPEVNVINPGFDVTP  324

Query  406  ASLISGIITEKGVISKDGNDA  344
              LI+GIITEKG++  D N +
Sbjct  325  HELITGIITEKGILRPDYNKS  345



>gb|EIE81164.1| S-methyl-5-thioribose-1-phosphate isomerase [Rhizopus delemar 
RA 99-880]
Length=377

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 112/156 (72%), Gaps = 11/156 (7%)
 Frame = -3

Query  760  ELVTENIPatliadsaaaalmkAG-RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHG  584
            ELV ENIPATLI DS A+AL+K   +V A++VGADR+AANGDTANKIGTY LA+ A HHG
Sbjct  222  ELVYENIPATLICDSMASALLKQNPQVQAIVVGADRVAANGDTANKIGTYQLAITAKHHG  281

Query  583  VPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQ--------IAASGISVWN  428
            + F VAAP TS+DL+  SG  IVIE+R P E L T  G+  Q         AA  I VWN
Sbjct  282  ILFIVAAPSTSIDLNTKSGDAIVIEQR-PSEELVTVAGIRVQDAQPTTIRTAAENIGVWN  340

Query  427  PAFDVTPASLISGIITEKGVISK-DGNDAFDITGFV  323
            P+FDVTP+ LIS I+TEKGV++K +G+  FD+  F+
Sbjct  341  PSFDVTPSELISAIVTEKGVVTKQEGSTQFDLASFL  376



>ref|XP_005370998.1| PREDICTED: methylthioribose-1-phosphate isomerase [Microtus ochrogaster]
Length=369

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANKIGTY LA+ A HH
Sbjct  213  AFELVYEQIPATLITDSMAAAAMAHQGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +G++IVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  273  GIPFYVAAPSSSCDLHLETGKEIVIEERPSQELTDLN---GIRIAAQGIRVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVISKD  356
              LI+ GIITE GV + +
Sbjct  330  HELITGGIITELGVFAPE  347



>emb|CDM34949.1| Methylthioribose-1-phosphate isomerase [Penicillium roqueforti 
FM164]
Length=382

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 12/133 (9%)
 Frame = -3

Query  688  RVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVIE  509
            RVNA++VGADR+AANGDTANKIGTY LAV A +HGV F VAAPLT++D++  SG+ IVIE
Sbjct  244  RVNAIVVGADRVAANGDTANKIGTYGLAVLAKYHGVKFLVAAPLTTIDMATKSGRDIVIE  303

Query  508  ERSPKELLHTHGGLGE------------QIAASGISVWNPAFDVTPASLISGIITEKGVI  365
            +R+  E+    G                +IAA GI+VWNPAFD+TPASLI GIITE GV 
Sbjct  304  QRAASEVTSIKGPRAGSEATDQIVIETVKIAAPGINVWNPAFDITPASLIDGIITEVGVA  363

Query  364  SKDGNDAFDITGF  326
             K G+  F + G 
Sbjct  364  EKLGDGKFHLAGL  376



>ref|XP_006023465.1| PREDICTED: methylthioribose-1-phosphate isomerase [Alligator 
sinensis]
Length=387

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLIADSAAA  +K   ++A++VGADR+ ANGDTANK+GTY LA+ AMHH
Sbjct  213  AYELVYEGIPATLIADSAAALALKEKGISAIVVGADRVVANGDTANKVGTYQLAIAAMHH  272

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            GVPFYVAAP TS DLSL++G QI+IEER  +EL   +   G +IAA  I VWNPAFDVTP
Sbjct  273  GVPFYVAAPSTSCDLSLATGDQIIIEERPSQELTDIN---GIRIAAPDIGVWNPAFDVTP  329

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  330  HDLITGGIITELGVFA  345



>ref|WP_029420357.1| methylthioribose-1-phosphate isomerase [Alicyclobacillus macrosporangiidus]
Length=355

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 101/136 (74%), Gaps = 3/136 (2%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + EL+ + IP TLI D+ AA  M+ G+V+AV+VGADRIAANGDTANKIGTY LAV   HH
Sbjct  200  AYELLADGIPFTLITDNMAAHFMRQGQVDAVVVGADRIAANGDTANKIGTYGLAVLCRHH  259

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP T+ DL++ SG  I IEERS  E+ H    LG  +A SG+   +PAFDVTP
Sbjct  260  GIPFYVAAPSTTFDLTIPSGDHIPIEERSEHEVTHV---LGHPLAPSGVRAAHPAFDVTP  316

Query  406  ASLISGIITEKGVISK  359
            A LI+ IITE+GV+ +
Sbjct  317  ADLITAIITEEGVVER  332



>ref|XP_003123394.2| PREDICTED: methylthioribose-1-phosphate isomerase [Sus scrofa]
Length=397

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E+IPATLI DS AAA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A HH
Sbjct  252  AFELVYEHIPATLITDSMAAAAMAHKGVSAVVVGADRVVANGDTANKVGTYQLAIAAKHH  311

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L SGQ+I+IEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  312  GIPFYVAAPSSSCDLRLESGQEIIIEERPGQELTDVN---GVRIAAPGIGVWNPAFDVTP  368

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  369  HDLITGGIITELGVFA  384



>ref|WP_025681854.1| methylthioribose-1-phosphate isomerase [Paenibacillus sp. 1-49]
Length=349

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = -3

Query  691  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  512
            G+V+AVIVG DRIAANGDTANKIGTY LAV A  H +PFYVA+PL+++DL  ++G +I I
Sbjct  231  GKVDAVIVGCDRIAANGDTANKIGTYGLAVLAQKHNIPFYVASPLSTIDLETTTGAEIPI  290

Query  511  EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVIS  362
            EERS  E+ H   G G+Q A  G+ V+NPAFDVTP  LI+ IITEKG+I 
Sbjct  291  EERSSAEITH---GFGKQTAPDGVKVFNPAFDVTPNELITAIITEKGIIQ  337



>dbj|GAN33575.1| methylthioribose-1-phosphate isomerase [Candidatus Brocadia sinica 
JPN1]
Length=352

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = -3

Query  691  GRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHHGVPFYVAAPLTSVDLSLSSGQQIVI  512
            G+V  VIVGADRIAANGDTANKIGTY +++ A  HG+PFYVAAP+++ DLS+ SG  I I
Sbjct  230  GKVQCVIVGADRIAANGDTANKIGTYGVSILAKEHGIPFYVAAPVSTFDLSIKSGNDIPI  289

Query  511  EERSPKELLHTHGGLGEQIAASGISVWNPAFDVTPASLISGIITEKGVISK  359
            EERSP+E+ +   G G + A  G+ V+NPAFDVTPA  I+ IITEKGVI+K
Sbjct  290  EERSPEEITN---GFGRKTAPEGVKVFNPAFDVTPAKNITAIITEKGVITK  337



>ref|XP_006100374.1| PREDICTED: LOW QUALITY PROTEIN: methylthioribose-1-phosphate 
isomerase [Myotis lucifugus]
Length=370

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 102/136 (75%), Gaps = 4/136 (3%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            + ELV E IPATLI DS AAA M    V+AV+VGADR+ ANGDTANK+GTY LA+ A +H
Sbjct  214  AFELVYEQIPATLITDSMAAAAMAHRDVSAVVVGADRVVANGDTANKVGTYQLAIAAKYH  273

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQIAASGISVWNPAFDVTP  407
            G+PFYVAAP +S DL L +GQQIVIEER  +EL   +   G +IAA GI VWNPAFDVTP
Sbjct  274  GIPFYVAAPSSSCDLRLETGQQIVIEERPGQELTDVN---GVRIAAPGIGVWNPAFDVTP  330

Query  406  ASLIS-GIITEKGVIS  362
              LI+ GIITE GV +
Sbjct  331  HDLITGGIITELGVFT  346



>ref|WP_015185955.1| methylthioribose-1-phosphate isomerase [Microcoleus sp. PCC 7113]
 gb|AFZ21827.1| methylthioribose-1-phosphate isomerase [Microcoleus sp. PCC 7113]
Length=352

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = -3

Query  766  SIELVTENIPatliadsaaaalmkAGRVNAVIVGADRIAANGDTANKIGTYSLAVCAMHH  587
            S E V E IP T+I D+ AA  M  G ++AVIVGADRIAANGDTANKIGTYSLA+ A  H
Sbjct  208  SWECVHEGIPVTVITDNMAAHCMNRGMIDAVIVGADRIAANGDTANKIGTYSLAIVAKAH  267

Query  586  GVPFYVAAPLTSVDLSLSSGQQIVIEERSPKELLHTHGGLGEQ-IAASGISVWNPAFDVT  410
             +PFYVAAPL++VD  LS+G +I IEER P E+      +GE  +   G+  +NPAFDVT
Sbjct  268  NIPFYVAAPLSTVDFKLSNGMEIPIEERHPSEIYQ----IGETLVCPPGVEFYNPAFDVT  323

Query  409  PASLISGIITEKGVIS  362
            PA LI+GIITEKGV++
Sbjct  324  PADLITGIITEKGVVT  339



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940