BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF028A11

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006469619.1|  PREDICTED: nucleobase-ascorbate transporter ...    244   1e-73   
gb|KDO54300.1|  hypothetical protein CISIN_1g009755mg                   244   2e-73   Citrus sinensis [apfelsine]
ref|XP_006447639.1|  hypothetical protein CICLE_v10014919mg             243   4e-73   Citrus clementina [clementine]
ref|XP_009365106.1|  PREDICTED: nucleobase-ascorbate transporter 1      241   4e-72   Pyrus x bretschneideri [bai li]
ref|XP_008379668.1|  PREDICTED: nucleobase-ascorbate transporter 1      241   4e-72   
ref|XP_008230014.1|  PREDICTED: nucleobase-ascorbate transporter 1      240   6e-72   Prunus mume [ume]
ref|XP_006357961.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   2e-71   Solanum tuberosum [potatoes]
ref|XP_006469618.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   2e-71   
gb|KDP30803.1|  hypothetical protein JCGZ_13746                         239   2e-71   Jatropha curcas
ref|XP_004243518.1|  PREDICTED: nucleobase-ascorbate transporter 1      239   3e-71   Solanum lycopersicum
ref|XP_002525330.1|  purine permease, putative                          238   3e-71   
ref|XP_009592403.1|  PREDICTED: nucleobase-ascorbate transporter 1      238   4e-71   Nicotiana tomentosiformis
ref|XP_007049166.1|  Xanthine/uracil permease family protein isof...    237   1e-70   Theobroma cacao [chocolate]
gb|KJB42851.1|  hypothetical protein B456_007G170500                    236   1e-70   Gossypium raimondii
ref|XP_009771645.1|  PREDICTED: nucleobase-ascorbate transporter 1      236   2e-70   Nicotiana sylvestris
gb|KJB42850.1|  hypothetical protein B456_007G170500                    236   3e-70   Gossypium raimondii
gb|KHG19290.1|  Nucleobase-ascorbate transporter 1 -like protein        227   5e-70   Gossypium arboreum [tree cotton]
ref|XP_010110631.1|  Nucleobase-ascorbate transporter 1                 236   6e-70   
ref|XP_002274603.1|  PREDICTED: nucleobase-ascorbate transporter ...    235   8e-70   Vitis vinifera
emb|CDP11315.1|  unnamed protein product                                235   9e-70   Coffea canephora [robusta coffee]
gb|KCW46946.1|  hypothetical protein EUGRSUZ_K00759                     231   1e-69   Eucalyptus grandis [rose gum]
gb|KHN38486.1|  Nucleobase-ascorbate transporter 1                      235   1e-69   Glycine soja [wild soybean]
ref|XP_007141637.1|  hypothetical protein PHAVU_008G212800g             233   2e-69   Phaseolus vulgaris [French bean]
ref|XP_003519453.2|  PREDICTED: nucleobase-ascorbate transporter ...    235   2e-69   Glycine max [soybeans]
ref|XP_011467773.1|  PREDICTED: nucleobase-ascorbate transporter ...    233   2e-69   Fragaria vesca subsp. vesca
ref|XP_010657232.1|  PREDICTED: nucleobase-ascorbate transporter ...    233   3e-69   Vitis vinifera
ref|XP_011086376.1|  PREDICTED: nucleobase-ascorbate transporter 1      233   4e-69   Sesamum indicum [beniseed]
ref|XP_007141636.1|  hypothetical protein PHAVU_008G212800g             233   5e-69   Phaseolus vulgaris [French bean]
ref|XP_007146103.1|  hypothetical protein PHAVU_006G012700g             233   6e-69   Phaseolus vulgaris [French bean]
ref|XP_006828104.1|  hypothetical protein AMTR_s00151p00089770          233   7e-69   Amborella trichopoda
gb|KHM99089.1|  Nucleobase-ascorbate transporter 1                      231   7e-69   Glycine soja [wild soybean]
ref|XP_004304090.1|  PREDICTED: nucleobase-ascorbate transporter ...    232   8e-69   Fragaria vesca subsp. vesca
ref|XP_003555666.1|  PREDICTED: nucleobase-ascorbate transporter ...    232   9e-69   Glycine max [soybeans]
ref|XP_010035524.1|  PREDICTED: nucleobase-ascorbate transporter 1      232   1e-68   Eucalyptus grandis [rose gum]
ref|XP_006595824.1|  PREDICTED: nucleobase-ascorbate transporter ...    231   1e-68   
ref|XP_006595825.1|  PREDICTED: nucleobase-ascorbate transporter ...    231   2e-68   Glycine max [soybeans]
gb|KHN08001.1|  Nucleobase-ascorbate transporter 1                      228   2e-68   Glycine soja [wild soybean]
gb|AES71659.2|  nucleobase-ascorbate transporter-like protein           231   2e-68   Medicago truncatula
ref|XP_003601408.1|  Nucleobase ascorbate transporter                   231   3e-68   
ref|XP_003545573.2|  PREDICTED: nucleobase-ascorbate transporter ...    231   4e-68   Glycine max [soybeans]
ref|XP_004502044.1|  PREDICTED: nucleobase-ascorbate transporter ...    230   5e-68   Cicer arietinum [garbanzo]
ref|XP_006595823.1|  PREDICTED: nucleobase-ascorbate transporter ...    231   9e-68   Glycine max [soybeans]
ref|XP_008456412.1|  PREDICTED: nucleobase-ascorbate transporter ...    229   1e-67   Cucumis melo [Oriental melon]
ref|XP_006297434.1|  hypothetical protein CARUB_v10013457mg             229   1e-67   Capsella rubella
gb|KHN41326.1|  Nucleobase-ascorbate transporter 1                      229   1e-67   Glycine soja [wild soybean]
ref|XP_003542318.1|  PREDICTED: nucleobase-ascorbate transporter ...    229   1e-67   Glycine max [soybeans]
gb|EYU43133.1|  hypothetical protein MIMGU_mgv1a004837mg                228   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_010533013.1|  PREDICTED: nucleobase-ascorbate transporter 1      228   4e-67   Tarenaya hassleriana [spider flower]
ref|XP_004149274.1|  PREDICTED: nucleobase-ascorbate transporter ...    228   4e-67   Cucumis sativus [cucumbers]
ref|XP_011047203.1|  PREDICTED: nucleobase-ascorbate transporter 1      227   6e-67   Populus euphratica
gb|KJB08649.1|  hypothetical protein B456_001G095500                    227   7e-67   Gossypium raimondii
ref|XP_002883707.1|  xanthine/uracil permease family protein            226   2e-66   
ref|XP_010424560.1|  PREDICTED: nucleobase-ascorbate transporter ...    223   2e-66   
ref|XP_010490176.1|  PREDICTED: nucleobase-ascorbate transporter ...    225   2e-66   Camelina sativa [gold-of-pleasure]
ref|NP_178636.1|  nucleobase-ascorbate transporter 1                    225   3e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18053.1|  BnaC07g04170D                                          225   5e-66   Brassica napus [oilseed rape]
ref|XP_002320481.1|  xanthine/uracil permease family protein            225   5e-66   Populus trichocarpa [western balsam poplar]
ref|XP_006396141.1|  hypothetical protein EUTSA_v10002485mg             224   6e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010467086.1|  PREDICTED: nucleobase-ascorbate transporter 1      224   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010252545.1|  PREDICTED: nucleobase-ascorbate transporter 1      224   8e-66   Nelumbo nucifera [Indian lotus]
gb|KFK39879.1|  hypothetical protein AALP_AA3G300500                    224   1e-65   Arabis alpina [alpine rockcress]
gb|EYU34044.1|  hypothetical protein MIMGU_mgv1a004592mg                223   4e-65   Erythranthe guttata [common monkey flower]
ref|XP_010928524.1|  PREDICTED: nucleobase-ascorbate transporter ...    216   2e-64   
ref|XP_008799349.1|  PREDICTED: nucleobase-ascorbate transporter ...    219   5e-64   Phoenix dactylifera
emb|CDY50943.1|  BnaC03g74430D                                          218   2e-63   Brassica napus [oilseed rape]
emb|CDX93090.1|  BnaA03g38120D                                          216   1e-62   
ref|XP_009136180.1|  PREDICTED: nucleobase-ascorbate transporter 1      216   1e-62   Brassica rapa
gb|ABR17751.1|  unknown                                                 216   2e-62   Picea sitchensis
ref|XP_008803524.1|  PREDICTED: nucleobase-ascorbate transporter ...    216   2e-62   Phoenix dactylifera
ref|XP_009395859.1|  PREDICTED: nucleobase-ascorbate transporter ...    215   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415455.1|  PREDICTED: nucleobase-ascorbate transporter ...    215   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943259.1|  PREDICTED: nucleobase-ascorbate transporter 1      214   4e-62   Elaeis guineensis
ref|XP_010691485.1|  PREDICTED: nucleobase-ascorbate transporter ...    211   3e-61   
ref|XP_010691484.1|  PREDICTED: nucleobase-ascorbate transporter ...    211   1e-60   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN70193.1|  hypothetical protein VITISV_004001                     209   3e-60   Vitis vinifera
gb|KDO77883.1|  hypothetical protein CISIN_1g0098371mg                  199   4e-58   Citrus sinensis [apfelsine]
ref|XP_006830254.1|  hypothetical protein AMTR_s00130p00100230          203   1e-57   Amborella trichopoda
ref|XP_010274460.1|  PREDICTED: nucleobase-ascorbate transporter ...    202   2e-57   Nelumbo nucifera [Indian lotus]
gb|EEC83487.1|  hypothetical protein OsI_29016                          206   2e-57   Oryza sativa Indica Group [Indian rice]
ref|NP_001061653.1|  Os08g0369000                                       197   4e-57   
ref|XP_008443418.1|  PREDICTED: nucleobase-ascorbate transporter 2      201   6e-57   Cucumis melo [Oriental melon]
ref|XP_004150216.1|  PREDICTED: nucleobase-ascorbate transporter ...    201   6e-57   Cucumis sativus [cucumbers]
ref|XP_010924597.1|  PREDICTED: nucleobase-ascorbate transporter ...    201   8e-57   Elaeis guineensis
gb|ACN26147.1|  unknown                                                 189   1e-56   Zea mays [maize]
ref|XP_008225311.1|  PREDICTED: nucleobase-ascorbate transporter 2      200   1e-56   Prunus mume [ume]
ref|XP_007211779.1|  hypothetical protein PRUPE_ppa004190mg             200   2e-56   Prunus persica
ref|XP_008793044.1|  PREDICTED: nucleobase-ascorbate transporter ...    199   2e-56   Phoenix dactylifera
ref|XP_006467632.1|  PREDICTED: nucleobase-ascorbate transporter ...    199   3e-56   Citrus sinensis [apfelsine]
ref|XP_010920318.1|  PREDICTED: nucleobase-ascorbate transporter ...    197   4e-56   Elaeis guineensis
ref|XP_010245958.1|  PREDICTED: nucleobase-ascorbate transporter ...    199   4e-56   Nelumbo nucifera [Indian lotus]
ref|XP_004956567.1|  PREDICTED: nucleobase-ascorbate transporter ...    199   5e-56   Setaria italica
ref|XP_006660533.1|  PREDICTED: nucleobase-ascorbate transporter ...    198   6e-56   Oryza brachyantha
emb|CDM84318.1|  unnamed protein product                                204   6e-56   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011101410.1|  PREDICTED: nucleobase-ascorbate transporter 2      198   6e-56   Sesamum indicum [beniseed]
emb|CDO96816.1|  unnamed protein product                                198   8e-56   Coffea canephora [robusta coffee]
ref|XP_006449522.1|  hypothetical protein CICLE_v10014896mg             198   8e-56   Citrus clementina [clementine]
ref|XP_010920310.1|  PREDICTED: nucleobase-ascorbate transporter ...    198   9e-56   Elaeis guineensis
ref|XP_008789343.1|  PREDICTED: nucleobase-ascorbate transporter ...    197   1e-55   Phoenix dactylifera
ref|XP_006659347.1|  PREDICTED: nucleobase-ascorbate transporter ...    197   1e-55   
dbj|BAJ89924.1|  predicted protein                                      192   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010655537.1|  PREDICTED: nucleobase-ascorbate transporter ...    197   1e-55   
dbj|BAD03486.1|  putative permease 1                                    197   1e-55   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG95840.1|  unnamed protein product                                195   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002265912.2|  PREDICTED: nucleobase-ascorbate transporter ...    197   2e-55   Vitis vinifera
emb|CAN66345.1|  hypothetical protein VITISV_040228                     197   2e-55   Vitis vinifera
gb|EYU28101.1|  hypothetical protein MIMGU_mgv1a004500mg                197   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_004233030.1|  PREDICTED: nucleobase-ascorbate transporter 2      197   2e-55   Solanum lycopersicum
ref|XP_002522228.1|  purine permease, putative                          192   3e-55   
ref|NP_001044313.1|  Os01g0759900                                       195   3e-55   
ref|XP_007159460.1|  hypothetical protein PHAVU_002G239500g             196   3e-55   Phaseolus vulgaris [French bean]
ref|XP_009396520.1|  PREDICTED: nucleobase-ascorbate transporter ...    196   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003569860.1|  PREDICTED: nucleobase-ascorbate transporter ...    196   4e-55   Brachypodium distachyon [annual false brome]
ref|XP_009799751.1|  PREDICTED: nucleobase-ascorbate transporter 2      196   4e-55   Nicotiana sylvestris
gb|ACG43417.1|  permease                                                196   5e-55   Zea mays [maize]
ref|XP_008667761.1|  PREDICTED: uncharacterized protein LOC100279...    196   5e-55   
gb|EAZ08590.1|  hypothetical protein OsI_30859                          196   5e-55   Oryza sativa Indica Group [Indian rice]
gb|KJB57393.1|  hypothetical protein B456_009G161500                    194   7e-55   Gossypium raimondii
gb|KEH20676.1|  nucleobase-ascorbate transporter-like protein           193   8e-55   Medicago truncatula
gb|EEC71519.1|  hypothetical protein OsI_03815                          194   9e-55   Oryza sativa Indica Group [Indian rice]
gb|KHN48003.1|  Nucleobase-ascorbate transporter 2                      195   9e-55   Glycine soja [wild soybean]
ref|XP_009410926.1|  PREDICTED: nucleobase-ascorbate transporter ...    195   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB61205.1|  putative permease 1                                    195   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009604294.1|  PREDICTED: nucleobase-ascorbate transporter 2      195   1e-54   Nicotiana tomentosiformis
ref|XP_010246467.1|  PREDICTED: nucleobase-ascorbate transporter 2      195   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_007025347.1|  Xanthine/uracil permease family protein            195   1e-54   Theobroma cacao [chocolate]
dbj|BAJ85393.1|  predicted protein                                      195   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94155.1|  predicted protein                                      195   1e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010999757.1|  PREDICTED: nucleobase-ascorbate transporter 2      194   2e-54   Populus euphratica
ref|XP_010686222.1|  PREDICTED: nucleobase-ascorbate transporter 2      194   2e-54   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY52234.1|  BnaC04g54110D                                          194   2e-54   Brassica napus [oilseed rape]
ref|XP_002305737.1|  xanthine/uracil permease family protein            194   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011039417.1|  PREDICTED: nucleobase-ascorbate transporter ...    194   2e-54   Populus euphratica
ref|XP_009143796.1|  PREDICTED: nucleobase-ascorbate transporter 2      194   2e-54   Brassica rapa
gb|AFW85019.1|  hypothetical protein ZEAMMB73_943324                    191   2e-54   
ref|XP_006358126.1|  PREDICTED: nucleobase-ascorbate transporter ...    194   2e-54   Solanum tuberosum [potatoes]
ref|XP_010089683.1|  Nucleobase-ascorbate transporter 2                 194   2e-54   Morus notabilis
gb|KJB57395.1|  hypothetical protein B456_009G161500                    194   2e-54   Gossypium raimondii
gb|KDP21113.1|  hypothetical protein JCGZ_21584                         194   2e-54   Jatropha curcas
ref|XP_009394193.1|  PREDICTED: nucleobase-ascorbate transporter ...    194   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456385.1|  hypothetical protein SORBIDRAFT_03g035190          194   3e-54   Sorghum bicolor [broomcorn]
gb|KCW76101.1|  hypothetical protein EUGRSUZ_D00480                     191   4e-54   Eucalyptus grandis [rose gum]
gb|EMS56362.1|  Nucleobase-ascorbate transporter 2                      194   4e-54   Triticum urartu
ref|XP_009351319.1|  PREDICTED: nucleobase-ascorbate transporter 2      193   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_007136977.1|  hypothetical protein PHAVU_009G089800g             193   5e-54   Phaseolus vulgaris [French bean]
ref|XP_003629785.1|  Nucleobase ascorbate transporter                   193   6e-54   Medicago truncatula
ref|XP_009352749.1|  PREDICTED: nucleobase-ascorbate transporter ...    193   6e-54   
ref|XP_006644739.1|  PREDICTED: nucleobase-ascorbate transporter ...    193   7e-54   Oryza brachyantha
gb|AFK48579.1|  unknown                                                 186   8e-54   Lotus japonicus
dbj|BAJ95647.1|  predicted protein                                      192   9e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004970033.1|  PREDICTED: nucleobase-ascorbate transporter ...    192   1e-53   Setaria italica
ref|XP_008371490.1|  PREDICTED: nucleobase-ascorbate transporter 2      192   1e-53   
ref|XP_006294014.1|  hypothetical protein CARUB_v10023002mg             192   2e-53   Capsella rubella
ref|XP_004293963.1|  PREDICTED: nucleobase-ascorbate transporter 2      192   2e-53   Fragaria vesca subsp. vesca
ref|XP_010052181.1|  PREDICTED: nucleobase-ascorbate transporter 2      192   2e-53   Eucalyptus grandis [rose gum]
ref|NP_001152037.1|  solute carrier family 23 member 2                  191   3e-53   Zea mays [maize]
gb|KHG19625.1|  Nucleobase-ascorbate transporter 2 -like protein        191   3e-53   Gossypium arboreum [tree cotton]
ref|XP_006410561.1|  hypothetical protein EUTSA_v10016514mg             191   3e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010413769.1|  PREDICTED: nucleobase-ascorbate transporter ...    191   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010469386.1|  PREDICTED: nucleobase-ascorbate transporter ...    191   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004973341.1|  PREDICTED: nucleobase-ascorbate transporter ...    191   4e-53   Setaria italica
ref|XP_010540521.1|  PREDICTED: nucleobase-ascorbate transporter ...    191   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_010540522.1|  PREDICTED: nucleobase-ascorbate transporter ...    191   4e-53   Tarenaya hassleriana [spider flower]
gb|KHN07045.1|  Nucleobase-ascorbate transporter 2                      191   5e-53   Glycine soja [wild soybean]
ref|XP_003526259.1|  PREDICTED: nucleobase-ascorbate transporter ...    191   5e-53   Glycine max [soybeans]
ref|XP_010509786.1|  PREDICTED: nucleobase-ascorbate transporter 2      190   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_003522486.1|  PREDICTED: nucleobase-ascorbate transporter ...    190   7e-53   Glycine max [soybeans]
ref|XP_008349204.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    190   8e-53   
gb|KHN29605.1|  Nucleobase-ascorbate transporter 2                      190   8e-53   Glycine soja [wild soybean]
ref|XP_003577983.1|  PREDICTED: nucleobase-ascorbate transporter ...    189   2e-52   Brachypodium distachyon [annual false brome]
ref|XP_003574409.1|  PREDICTED: nucleobase-ascorbate transporter ...    189   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_009394827.1|  PREDICTED: nucleobase-ascorbate transporter ...    189   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_180966.1|  nucleobase-ascorbate transporter 2                    189   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485911.1|  PREDICTED: nucleobase-ascorbate transporter ...    188   3e-52   Cicer arietinum [garbanzo]
gb|AAK59632.1|  putative membrane transporter protein                   188   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879482.1|  xanthine/uracil permease family protein            188   4e-52   
gb|KFK36325.1|  hypothetical protein AALP_AA4G108100                    188   5e-52   Arabis alpina [alpine rockcress]
gb|ACD56652.1|  putative permease                                       187   8e-52   Gossypioides kirkii
gb|EMT06104.1|  Nucleobase-ascorbate transporter 2                      185   2e-51   
ref|XP_008678172.1|  PREDICTED: nucleobase-ascorbate transporter ...    186   3e-51   Zea mays [maize]
gb|EMS45947.1|  Nucleobase-ascorbate transporter 2                      184   5e-51   Triticum urartu
gb|ACD56666.1|  putative permease                                       184   7e-51   Gossypium arboreum [tree cotton]
gb|KEH36620.1|  nucleobase-ascorbate transporter-like protein           184   8e-51   Medicago truncatula
gb|AAT64019.1|  putative permease                                       184   2e-50   Gossypium hirsutum [American cotton]
gb|KHG23953.1|  Nucleobase-ascorbate transporter 2 -like protein        184   2e-50   Gossypium arboreum [tree cotton]
ref|XP_002445381.1|  hypothetical protein SORBIDRAFT_07g014930          184   2e-50   
gb|KJB69715.1|  hypothetical protein B456_011G038600                    182   4e-50   Gossypium raimondii
gb|KJB69714.1|  hypothetical protein B456_011G038600                    182   4e-50   Gossypium raimondii
gb|AAT64034.1|  putative permease                                       182   5e-50   Gossypium hirsutum [American cotton]
ref|XP_004981566.1|  PREDICTED: nucleobase-ascorbate transporter ...    173   2e-46   
ref|XP_004504292.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   1e-45   Cicer arietinum [garbanzo]
ref|XP_002441746.1|  hypothetical protein SORBIDRAFT_08g001650          166   1e-43   
ref|XP_006852960.1|  hypothetical protein AMTR_s00033p00243580          158   5e-41   Amborella trichopoda
ref|XP_010255123.1|  PREDICTED: nucleobase-ascorbate transporter 3      150   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_011083792.1|  PREDICTED: nucleobase-ascorbate transporter 3      150   4e-38   Sesamum indicum [beniseed]
gb|AAL76261.1|AF466824_1  putative permease 1                           143   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417550.1|  PREDICTED: nucleobase-ascorbate transporter ...    149   8e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABO30057.1|  xanthine/uracil/vitamin C permease                      140   1e-37   Triticum aestivum [Canadian hard winter wheat]
gb|ABO30069.1|  xanthine/uracil/vitamin C permease                      140   2e-37   Triticum aestivum [Canadian hard winter wheat]
gb|ABO30011.1|  xanthine/uracil/vitamin C permease                      140   2e-37   Triticum dicoccon [cultivated emmer wheat]
ref|XP_009391237.1|  PREDICTED: nucleobase-ascorbate transporter ...    148   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001141421.1|  uncharacterized protein LOC100273531               147   4e-37   Zea mays [maize]
gb|KDO84353.1|  hypothetical protein CISIN_1g009118mg                   147   4e-37   Citrus sinensis [apfelsine]
ref|XP_006434867.1|  hypothetical protein CICLE_v10000779mg             147   4e-37   Citrus clementina [clementine]
ref|XP_006473388.1|  PREDICTED: nucleobase-ascorbate transporter ...    147   4e-37   
ref|XP_010928566.1|  PREDICTED: nucleobase-ascorbate transporter ...    147   5e-37   Elaeis guineensis
gb|EYU25379.1|  hypothetical protein MIMGU_mgv1a004067mg                147   5e-37   Erythranthe guttata [common monkey flower]
ref|XP_002444345.1|  hypothetical protein SORBIDRAFT_07g020510          147   5e-37   
ref|XP_009418014.1|  PREDICTED: nucleobase-ascorbate transporter ...    147   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC84500.1|  hypothetical protein OsI_31190                          140   6e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_002961825.1|  hypothetical protein SELMODRAFT_76475              146   8e-37   Selaginella moellendorffii
ref|XP_009777178.1|  PREDICTED: nucleobase-ascorbate transporter 3      146   1e-36   Nicotiana sylvestris
gb|AFK46481.1|  unknown                                                 145   1e-36   Medicago truncatula
ref|XP_003589253.1|  Nucleobase-ascorbate transporter                   145   2e-36   Medicago truncatula
gb|AFW73350.1|  hypothetical protein ZEAMMB73_676690                    138   2e-36   
gb|AAK59508.2|  putative permease 1                                     143   2e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30739.1|  BnaA02g33610D                                          145   2e-36   Brassica napus [oilseed rape]
gb|ACR38061.1|  unknown                                                 140   2e-36   Zea mays [maize]
ref|XP_004238190.1|  PREDICTED: nucleobase-ascorbate transporter 3      145   3e-36   Solanum lycopersicum
emb|CDY45747.1|  BnaC02g42350D                                          145   3e-36   Brassica napus [oilseed rape]
ref|XP_009112041.1|  PREDICTED: nucleobase-ascorbate transporter 6      144   3e-36   Brassica rapa
ref|XP_004973451.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   3e-36   Setaria italica
emb|CDY56736.1|  BnaC09g50870D                                          144   3e-36   Brassica napus [oilseed rape]
ref|XP_002864824.1|  hypothetical protein ARALYDRAFT_496474             144   4e-36   
ref|XP_009130240.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   4e-36   Brassica rapa
ref|XP_011017252.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   4e-36   Populus euphratica
ref|XP_006354927.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   4e-36   Solanum tuberosum [potatoes]
ref|XP_009625821.1|  PREDICTED: nucleobase-ascorbate transporter 3      144   4e-36   Nicotiana tomentosiformis
ref|XP_004499100.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   4e-36   Cicer arietinum [garbanzo]
ref|XP_003574490.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   5e-36   Brachypodium distachyon [annual false brome]
emb|CDP07610.1|  unnamed protein product                                144   6e-36   Coffea canephora [robusta coffee]
gb|EMT25940.1|  Nucleobase-ascorbate transporter 6                      144   6e-36   
ref|XP_010089934.1|  Nucleobase-ascorbate transporter 3                 144   6e-36   
ref|XP_009391740.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   7e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391739.1|  PREDICTED: nucleobase-ascorbate transporter ...    144   7e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006355948.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   1e-35   
ref|XP_009415380.1|  PREDICTED: nucleobase-ascorbate transporter ...    143   1e-35   
ref|XP_006386511.1|  PIGMENT DEFECTIVE EMBRYO 135 family protein        143   1e-35   
ref|XP_010684514.1|  PREDICTED: nucleobase-ascorbate transporter 3      143   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006394340.1|  hypothetical protein EUTSA_v10003977mg             142   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010459419.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   2e-35   Camelina sativa [gold-of-pleasure]
ref|NP_201094.1|  Xanthine/uracil permease family protein               142   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280290.1|  hypothetical protein CARUB_v10026214mg             142   2e-35   
emb|CDX84363.1|  BnaC03g51370D                                          142   2e-35   
ref|XP_002282229.1|  PREDICTED: nucleobase-ascorbate transporter 3      142   2e-35   Vitis vinifera
emb|CAN78223.1|  hypothetical protein VITISV_006254                     142   2e-35   Vitis vinifera
ref|XP_003573107.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   2e-35   Brachypodium distachyon [annual false brome]
ref|XP_004238704.1|  PREDICTED: nucleobase-ascorbate transporter 7      142   2e-35   Solanum lycopersicum
ref|XP_010238137.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   2e-35   Brachypodium distachyon [annual false brome]
ref|XP_009595521.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   2e-35   Nicotiana tomentosiformis
ref|XP_009799732.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   3e-35   Nicotiana sylvestris
ref|XP_006355947.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   3e-35   Solanum tuberosum [potatoes]
ref|XP_010913510.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    142   3e-35   Elaeis guineensis
ref|XP_010519558.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_010678709.1|  PREDICTED: nucleobase-ascorbate transporter 6      142   3e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009399656.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004956720.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   3e-35   Setaria italica
ref|XP_006659402.1|  PREDICTED: nucleobase-ascorbate transporter ...    142   3e-35   Oryza brachyantha
ref|XP_003578065.1|  PREDICTED: nucleobase-ascorbate transporter ...    141   4e-35   Brachypodium distachyon [annual false brome]
ref|XP_002510280.1|  purine permease, putative                          141   4e-35   Ricinus communis
ref|XP_001777857.1|  predicted protein                                  141   4e-35   
ref|XP_008453115.1|  PREDICTED: nucleobase-ascorbate transporter 6      141   4e-35   Cucumis melo [Oriental melon]
ref|XP_009151410.1|  PREDICTED: nucleobase-ascorbate transporter 6      141   5e-35   Brassica rapa
ref|XP_009399654.1|  PREDICTED: nucleobase-ascorbate transporter ...    141   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008806500.1|  PREDICTED: nucleobase-ascorbate transporter ...    141   5e-35   
ref|XP_006339989.1|  PREDICTED: nucleobase-ascorbate transporter ...    141   6e-35   Solanum tuberosum [potatoes]
ref|XP_004252190.1|  PREDICTED: nucleobase-ascorbate transporter 6      141   6e-35   Solanum lycopersicum
ref|XP_007200240.1|  hypothetical protein PRUPE_ppa015287mg             140   7e-35   Prunus persica
ref|XP_006375005.1|  PIGMENT DEFECTIVE EMBRYO 135 family protein        140   7e-35   Populus trichocarpa [western balsam poplar]
ref|XP_004138122.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   8e-35   Cucumis sativus [cucumbers]
ref|XP_010444153.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004963020.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   8e-35   Setaria italica
gb|AFW67127.1|  hypothetical protein ZEAMMB73_289331                    135   9e-35   
ref|XP_009386652.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   9e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06073.1|  Nucleobase-ascorbate transporter 3 -like protein        140   1e-34   Gossypium arboreum [tree cotton]
gb|ADN33809.1|  nuclease ascorbate transporter                          134   1e-34   Cucumis melo subsp. melo
ref|XP_010941850.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    140   1e-34   
ref|NP_001063058.1|  Os09g0381100                                       140   1e-34   
ref|XP_010546016.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   1e-34   Tarenaya hassleriana [spider flower]
gb|AFW73351.1|  hypothetical protein ZEAMMB73_676690                    137   1e-34   
ref|XP_006836697.1|  hypothetical protein AMTR_s00088p00102240          140   1e-34   
ref|XP_004141239.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   1e-34   
ref|XP_004160603.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   1e-34   
ref|XP_006660592.1|  PREDICTED: nucleobase-ascorbate transporter ...    140   1e-34   
ref|XP_003559230.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   2e-34   
ref|XP_010474016.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   2e-34   
gb|EEC83594.1|  hypothetical protein OsI_29273                          139   2e-34   
gb|EMT04471.1|  Nucleobase-ascorbate transporter 6                      139   2e-34   
ref|NP_001061818.1|  Os08g0420600                                       139   2e-34   
ref|XP_002452570.1|  hypothetical protein SORBIDRAFT_04g028300          139   2e-34   
ref|XP_008452493.1|  PREDICTED: nucleobase-ascorbate transporter 3      139   2e-34   
gb|EMS61607.1|  Nucleobase-ascorbate transporter 6                      139   3e-34   
ref|XP_008792697.1|  PREDICTED: nucleobase-ascorbate transporter 3      139   3e-34   
ref|XP_003550352.1|  PREDICTED: nucleobase-ascorbate transporter ...    139   3e-34   
dbj|BAJ85445.1|  predicted protein                                      139   3e-34   
gb|ACG35525.1|  permease I                                              139   3e-34   
ref|XP_010550666.1|  PREDICTED: nucleobase-ascorbate transporter 6      139   3e-34   
ref|NP_001140868.1|  uncharacterized protein LOC100272944               139   3e-34   
gb|KHN12750.1|  Nucleobase-ascorbate transporter 3                      139   3e-34   
ref|XP_011025599.1|  PREDICTED: nucleobase-ascorbate transporter ...    139   3e-34   
ref|XP_004135225.1|  PREDICTED: nucleobase-ascorbate transporter ...    139   3e-34   
ref|XP_011021644.1|  PREDICTED: nucleobase-ascorbate transporter 7      139   4e-34   
gb|KHN45346.1|  Nucleobase-ascorbate transporter 3                      139   4e-34   
ref|XP_006857136.1|  hypothetical protein AMTR_s00065p00152120          138   4e-34   
emb|CAJ84113.1|  root uracil permease 1                                 138   5e-34   
ref|NP_001048084.1|  Os02g0741800                                       138   5e-34   
ref|XP_009415384.1|  PREDICTED: nucleobase-ascorbate transporter ...    138   5e-34   
gb|KDP21309.1|  hypothetical protein JCGZ_21780                         138   5e-34   
ref|NP_001051745.1|  Os03g0823800                                       138   5e-34   
ref|XP_011030643.1|  PREDICTED: nucleobase-ascorbate transporter ...    138   5e-34   
gb|EAZ29114.1|  hypothetical protein OsJ_13173                          139   5e-34   
ref|XP_010028015.1|  PREDICTED: nucleobase-ascorbate transporter 6      138   6e-34   
gb|EAY92392.1|  hypothetical protein OsI_14125                          138   6e-34   
ref|XP_009619816.1|  PREDICTED: nucleobase-ascorbate transporter ...    138   6e-34   
ref|XP_007143130.1|  hypothetical protein PHAVU_007G046400g             138   6e-34   
ref|XP_006647871.1|  PREDICTED: nucleobase-ascorbate transporter ...    138   6e-34   
ref|XP_003544440.1|  PREDICTED: nucleobase-ascorbate transporter ...    138   6e-34   
ref|XP_007017372.1|  Xanthine/uracil permease family protein isof...    138   6e-34   
ref|XP_008446242.1|  PREDICTED: nucleobase-ascorbate transporter 7      138   6e-34   
ref|XP_003523067.1|  PREDICTED: nucleobase-ascorbate transporter ...    138   6e-34   
ref|XP_002311584.2|  hypothetical protein POPTR_0008s14580g             138   6e-34   
gb|KDP31138.1|  hypothetical protein JCGZ_11514                         138   7e-34   
ref|XP_004297660.1|  PREDICTED: nucleobase-ascorbate transporter 6      138   7e-34   
ref|XP_007017371.1|  Xanthine/uracil permease family protein isof...    138   7e-34   
gb|KJB53228.1|  hypothetical protein B456_008G297500                    137   7e-34   
ref|XP_009757662.1|  PREDICTED: nucleobase-ascorbate transporter ...    138   7e-34   
gb|KJB77978.1|  hypothetical protein B456_012G170700                    138   7e-34   
ref|XP_003578422.1|  PREDICTED: nucleobase-ascorbate transporter 3      138   8e-34   
gb|KHG14639.1|  Nucleobase-ascorbate transporter 6 -like protein        137   8e-34   
ref|XP_008389596.1|  PREDICTED: nucleobase-ascorbate transporter ...    137   8e-34   
gb|ABK93255.1|  unknown                                                 135   8e-34   
ref|XP_004299577.1|  PREDICTED: nucleobase-ascorbate transporter 6      137   9e-34   
ref|XP_008374469.1|  PREDICTED: nucleobase-ascorbate transporter ...    137   9e-34   
ref|XP_001771941.1|  predicted protein                                  137   9e-34   
ref|XP_009360485.1|  PREDICTED: nucleobase-ascorbate transporter ...    137   9e-34   
gb|EMT29780.1|  Nucleobase-ascorbate transporter 3                      138   1e-33   
gb|KHG22799.1|  Nucleobase-ascorbate transporter 6 -like protein        137   1e-33   
ref|XP_003527028.1|  PREDICTED: nucleobase-ascorbate transporter ...    137   1e-33   
ref|XP_008643648.1|  PREDICTED: LOC100282103 isoform X1                 137   1e-33   
gb|KJB19548.1|  hypothetical protein B456_003G109900                    136   1e-33   
ref|XP_002315809.1|  xanthine/uracil permease family protein            137   1e-33   
ref|XP_008236299.1|  PREDICTED: nucleobase-ascorbate transporter 4      137   1e-33   
ref|XP_006650817.1|  PREDICTED: nucleobase-ascorbate transporter ...    137   1e-33   
ref|XP_002511446.1|  purine permease, putative                          137   1e-33   
gb|KHG18287.1|  Nucleobase-ascorbate transporter 7 -like protein        137   1e-33   
gb|KJB63781.1|  hypothetical protein B456_010G016200                    137   1e-33   
ref|XP_008806320.1|  PREDICTED: nucleobase-ascorbate transporter ...    137   1e-33   
gb|KJB63778.1|  hypothetical protein B456_010G016200                    137   1e-33   
ref|XP_011086504.1|  PREDICTED: nucleobase-ascorbate transporter 7      137   1e-33   
ref|XP_002531406.1|  purine permease, putative                          137   1e-33   
gb|KJB53223.1|  hypothetical protein B456_008G297500                    137   2e-33   
ref|XP_010272020.1|  PREDICTED: nucleobase-ascorbate transporter 6      137   2e-33   
gb|ACN28348.1|  unknown                                                 137   2e-33   
gb|ACN34480.1|  unknown                                                 137   2e-33   
ref|XP_009610581.1|  PREDICTED: nucleobase-ascorbate transporter ...    136   2e-33   
emb|CAN79848.1|  hypothetical protein VITISV_025959                     137   2e-33   
gb|AET03140.2|  nucleobase-ascorbate transporter-like protein           137   2e-33   
ref|XP_008378586.1|  PREDICTED: nucleobase-ascorbate transporter ...    131   2e-33   
ref|NP_001148488.1|  LOC100282103                                       137   2e-33   
ref|XP_010682619.1|  PREDICTED: nucleobase-ascorbate transporter ...    137   2e-33   
ref|XP_009782990.1|  PREDICTED: nucleobase-ascorbate transporter 6      136   2e-33   
ref|XP_007160814.1|  hypothetical protein PHAVU_001G018700g             137   2e-33   
ref|XP_008806323.1|  PREDICTED: nucleobase-ascorbate transporter ...    136   2e-33   
gb|KEH31855.1|  nucleobase-ascorbate transporter-like protein           135   2e-33   
ref|XP_003628664.1|  Nucleobase ascorbate transporter                   136   2e-33   
ref|XP_004953888.1|  PREDICTED: nucleobase-ascorbate transporter ...    136   2e-33   
ref|XP_002313187.2|  hypothetical protein POPTR_0009s09000g             136   2e-33   
ref|XP_002268811.1|  PREDICTED: nucleobase-ascorbate transporter 6      136   3e-33   
ref|XP_011002186.1|  PREDICTED: nucleobase-ascorbate transporter ...    136   3e-33   
ref|XP_011087158.1|  PREDICTED: nucleobase-ascorbate transporter 6      136   3e-33   
gb|KJB53217.1|  hypothetical protein B456_008G297500                    136   3e-33   
gb|KJB47303.1|  hypothetical protein B456_008G019900                    136   3e-33   
ref|XP_003555298.1|  PREDICTED: nucleobase-ascorbate transporter ...    136   3e-33   
gb|AIS71908.1|  nucleobase-ascorbate transporter 6-like isoform 1       136   3e-33   
ref|NP_001150400.1|  permease I                                         136   3e-33   
tpg|DAA52241.1|  TPA: permease I                                        136   3e-33   
ref|XP_007036127.1|  Xanthine/uracil permease family protein isof...    136   3e-33   
gb|KJB19546.1|  hypothetical protein B456_003G109900                    136   3e-33   
ref|XP_009610578.1|  PREDICTED: nucleobase-ascorbate transporter ...    136   3e-33   
ref|XP_010526007.1|  PREDICTED: nucleobase-ascorbate transporter 3      136   4e-33   
ref|XP_009364045.1|  PREDICTED: nucleobase-ascorbate transporter ...    136   4e-33   
ref|XP_004508844.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   4e-33   
ref|XP_004981228.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   4e-33   
ref|XP_002990456.1|  hypothetical protein SELMODRAFT_185282             135   4e-33   
gb|EEC69580.1|  hypothetical protein OsI_38906                          136   4e-33   
ref|XP_010254659.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   4e-33   
ref|NP_001067149.1|  Os12g0583900                                       136   4e-33   
ref|NP_001288584.1|  uncharacterized protein LOC103625746               135   4e-33   
ref|XP_004501951.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   4e-33   
gb|KEH35060.1|  nucleobase-ascorbate transporter-like protein           135   4e-33   
gb|EEE53504.1|  hypothetical protein OsJ_36674                          135   4e-33   
ref|NP_001149779.1|  permease I                                         135   4e-33   
ref|XP_006438462.1|  hypothetical protein CICLE_v10031192mg             135   5e-33   
ref|XP_004509863.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   5e-33   
gb|KEH31856.1|  nucleobase-ascorbate transporter-like protein           135   5e-33   
ref|XP_010929097.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   5e-33   
ref|XP_008378546.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   6e-33   
gb|KJB58395.1|  hypothetical protein B456_009G208500                    135   6e-33   
ref|XP_007138109.1|  hypothetical protein PHAVU_009G181000g             135   6e-33   
gb|KJB58396.1|  hypothetical protein B456_009G208500                    135   7e-33   
ref|XP_004167851.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   8e-33   
dbj|BAJ85528.1|  predicted protein                                      135   8e-33   
ref|XP_008661403.1|  PREDICTED: nucleobase-ascorbate transporter 3      135   9e-33   
tpg|DAA47277.1|  TPA: hypothetical protein ZEAMMB73_202298              135   9e-33   
ref|XP_003608951.1|  Nucleobase ascorbate transporter                   135   9e-33   
ref|XP_002322154.1|  xanthine/uracil permease family protein            134   9e-33   
ref|XP_008393061.1|  PREDICTED: nucleobase-ascorbate transporter 6      134   1e-32   
ref|XP_003519478.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   1e-32   
gb|EMS54314.1|  Nucleobase-ascorbate transporter 3                      135   1e-32   
ref|XP_011028608.1|  PREDICTED: nucleobase-ascorbate transporter 6      134   1e-32   
gb|KHG02370.1|  Nucleobase-ascorbate transporter 4 -like protein        134   1e-32   
ref|XP_009411043.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   1e-32   
ref|XP_004150259.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   1e-32   
gb|KDO69759.1|  hypothetical protein CISIN_1g009582mg                   133   1e-32   
ref|XP_009359161.1|  PREDICTED: nucleobase-ascorbate transporter ...    129   1e-32   
ref|XP_007225743.1|  hypothetical protein PRUPE_ppa003778mg             134   2e-32   
ref|XP_006439754.1|  hypothetical protein CICLE_v10019673mg             133   2e-32   
ref|XP_006574587.1|  PREDICTED: nucleobase-ascorbate transporter ...    135   2e-32   
gb|EMT02255.1|  Nucleobase-ascorbate transporter 6                      134   2e-32   
gb|KDO69758.1|  hypothetical protein CISIN_1g009582mg                   133   2e-32   
ref|XP_008220713.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   2e-32   
ref|XP_009103320.1|  PREDICTED: nucleobase-ascorbate transporter 7      134   2e-32   
emb|CDY24508.1|  BnaA01g22120D                                          134   2e-32   
ref|XP_006300441.1|  hypothetical protein CARUB_v10020111mg             134   2e-32   
ref|XP_002886639.1|  xanthine/uracil permease family protein            134   2e-32   
ref|XP_003613313.1|  Nucleobase ascorbate transporter                   134   2e-32   
ref|XP_007044538.1|  Nucleobase-ascorbate transporter 7                 134   2e-32   
ref|XP_009803945.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   2e-32   
ref|XP_003563486.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   2e-32   
ref|XP_002463615.1|  hypothetical protein SORBIDRAFT_01g002960          134   2e-32   
gb|EPS61443.1|  hypothetical protein M569_13354                         133   2e-32   
ref|XP_003517836.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   2e-32   
gb|KHN45288.1|  Nucleobase-ascorbate transporter 6                      133   2e-32   
ref|XP_001771939.1|  predicted protein                                  134   2e-32   
ref|XP_009359013.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   2e-32   
ref|XP_010100509.1|  Nucleobase-ascorbate transporter 6                 134   2e-32   
ref|XP_010470160.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   2e-32   
ref|XP_004489879.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   2e-32   
gb|KDO69757.1|  hypothetical protein CISIN_1g009582mg                   133   2e-32   
ref|XP_007209884.1|  hypothetical protein PRUPE_ppa003999mg             133   2e-32   
ref|XP_008454409.1|  PREDICTED: nucleobase-ascorbate transporter 4      133   2e-32   
ref|XP_008810107.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   3e-32   
ref|XP_009608483.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   3e-32   
ref|XP_006392193.1|  hypothetical protein EUTSA_v10023405mg             133   3e-32   
ref|XP_002961291.1|  hypothetical protein SELMODRAFT_73581              133   3e-32   
gb|KEH44013.1|  nucleobase-ascorbate transporter-like protein           133   3e-32   
ref|XP_006573063.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   3e-32   
ref|XP_002983263.1|  hypothetical protein SELMODRAFT_155740             133   3e-32   
ref|XP_009608481.1|  PREDICTED: nucleobase-ascorbate transporter ...    134   3e-32   
ref|XP_004241491.1|  PREDICTED: nucleobase-ascorbate transporter 6      133   3e-32   
ref|XP_006664150.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   3e-32   
ref|XP_008220714.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   3e-32   
gb|KDO69752.1|  hypothetical protein CISIN_1g009582mg                   133   3e-32   
ref|XP_006345027.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   3e-32   
ref|XP_007042667.1|  Xanthine/uracil permease family protein isof...    133   3e-32   
emb|CDX71592.1|  BnaC09g26330D                                          133   3e-32   
ref|XP_008339995.1|  PREDICTED: nucleobase-ascorbate transporter ...    133   4e-32   
ref|XP_006439755.1|  hypothetical protein CICLE_v10019673mg             133   4e-32   
gb|KDO69748.1|  hypothetical protein CISIN_1g009582mg                   133   4e-32   
ref|XP_004236131.1|  PREDICTED: nucleobase-ascorbate transporter 6      133   4e-32   
ref|XP_010510979.1|  PREDICTED: nucleobase-ascorbate transporter 7      133   4e-32   
gb|KHG30570.1|  Nucleobase-ascorbate transporter 4 -like protein        133   4e-32   
gb|EYU29705.1|  hypothetical protein MIMGU_mgv1a004288mg                132   4e-32   
ref|XP_006476733.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   5e-32   
ref|XP_009118902.1|  PREDICTED: nucleobase-ascorbate transporter 5      132   5e-32   
emb|CDY37762.1|  BnaA10g05590D                                          132   6e-32   
ref|XP_002974919.1|  hypothetical protein SELMODRAFT_150195             132   6e-32   
ref|XP_007153664.1|  hypothetical protein PHAVU_003G054500g             132   6e-32   
ref|XP_002988935.1|  hypothetical protein SELMODRAFT_159848             132   6e-32   
ref|XP_010043812.1|  PREDICTED: nucleobase-ascorbate transporter 7      132   7e-32   
ref|XP_010532269.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   7e-32   
ref|XP_007157491.1|  hypothetical protein PHAVU_002G074100g             132   7e-32   
ref|XP_010532270.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   7e-32   
ref|XP_010939008.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   7e-32   
ref|XP_009385304.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   7e-32   
ref|XP_006417454.1|  hypothetical protein EUTSA_v10007311mg             132   8e-32   
ref|XP_010470161.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   8e-32   
ref|XP_010418834.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   9e-32   
ref|XP_003532028.1|  PREDICTED: nucleobase-ascorbate transporter ...    132   9e-32   
gb|KHN10623.1|  Nucleobase-ascorbate transporter 6                      132   9e-32   
gb|KHN44541.1|  Nucleobase-ascorbate transporter 6                      132   9e-32   
ref|NP_176211.2|  nucleobase-ascorbate transporter 7                    132   1e-31   
dbj|BAF01000.1|  hypothetical protein                                   132   1e-31   
ref|XP_001781218.1|  predicted protein                                  132   1e-31   
gb|AAD14479.1|  Strong similarity to gi|3337350 F13P17.3 putative...    132   1e-31   
ref|XP_006305877.1|  hypothetical protein CARUB_v10011003mg             132   1e-31   
gb|KHG10671.1|  Nucleobase-ascorbate transporter 3 -like protein        132   1e-31   
ref|XP_008377388.1|  PREDICTED: nucleobase-ascorbate transporter ...    131   1e-31   
ref|XP_011071803.1|  PREDICTED: nucleobase-ascorbate transporter ...    131   1e-31   
gb|KFK40823.1|  hypothetical protein AALP_AA2G046200                    131   1e-31   
gb|KFK26633.1|  hypothetical protein AALP_AA8G273900                    131   1e-31   
gb|KJB32223.1|  hypothetical protein B456_005G230600                    131   2e-31   
ref|XP_010429673.1|  PREDICTED: nucleobase-ascorbate transporter ...    131   2e-31   
ref|XP_001771940.1|  predicted protein                                  131   2e-31   
ref|XP_006280300.1|  hypothetical protein CARUB_v10026223mg             131   2e-31   
gb|KHN48615.1|  Nucleobase-ascorbate transporter 6                      131   2e-31   
ref|XP_003549636.1|  PREDICTED: nucleobase-ascorbate transporter ...    131   2e-31   
ref|XP_011044342.1|  PREDICTED: nucleobase-ascorbate transporter ...    130   2e-31   
emb|CDY33617.1|  BnaC01g28480D                                          130   2e-31   
ref|XP_008245218.1|  PREDICTED: nucleobase-ascorbate transporter ...    130   2e-31   
ref|XP_006579556.1|  PREDICTED: nucleobase-ascorbate transporter ...    130   2e-31   



>ref|XP_006469619.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X3 
[Citrus sinensis]
Length=482

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCVL GLV SVGLS LQFTNMNCMRNL+ITGLSLFLGISIPQFFNEYW+   HGL
Sbjct  346  IFAALYCVLFGLVASVGLSFLQFTNMNCMRNLVITGLSLFLGISIPQFFNEYWNPQHHGL  405

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN
Sbjct  406  VHTNAGWFNAFLNTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  465

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  466  EEFYTLPFNLNRFFPPT  482



>gb|KDO54300.1| hypothetical protein CISIN_1g009755mg [Citrus sinensis]
Length=526

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCVL GLV SVGLS LQFTNMNCMRNL+ITGLSLFLGISIPQFFNEYW+   HGL
Sbjct  390  IFAALYCVLFGLVASVGLSFLQFTNMNCMRNLVITGLSLFLGISIPQFFNEYWNPQHHGL  449

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN
Sbjct  450  VHTNAGWFNAFLNTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  509

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  510  EEFYTLPFNLNRFFPPT  526



>ref|XP_006447639.1| hypothetical protein CICLE_v10014919mg [Citrus clementina]
 ref|XP_006469617.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X1 
[Citrus sinensis]
 gb|ESR60879.1| hypothetical protein CICLE_v10014919mg [Citrus clementina]
 gb|KDO54299.1| hypothetical protein CISIN_1g009755mg [Citrus sinensis]
Length=520

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCVL GLV SVGLS LQFTNMNCMRNL+ITGLSLFLGISIPQFFNEYW+   HGL
Sbjct  384  IFAALYCVLFGLVASVGLSFLQFTNMNCMRNLVITGLSLFLGISIPQFFNEYWNPQHHGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_009365106.1| PREDICTED: nucleobase-ascorbate transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCV+ GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+P+FFNEYW+   H
Sbjct  382  FPIYAALYCVVFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPRFFNEYWNPSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVHTNAGWFNAFLNTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_008379668.1| PREDICTED: nucleobase-ascorbate transporter 1 [Malus domestica]
Length=520

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+P+FFNEYW+   H
Sbjct  382  FPIYAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPRFFNEYWNPSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVHTNAGWFNAFLNTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_008230014.1| PREDICTED: nucleobase-ascorbate transporter 1 [Prunus mume]
Length=520

 Score =   240 bits (613),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCV+ GLVGSVGLS LQFTNMN MRNL+ITGLSLFLGIS+P+FFNEYW+   H
Sbjct  382  FPIYAALYCVVFGLVGSVGLSFLQFTNMNSMRNLIITGLSLFLGISVPRFFNEYWNPSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVHTNAGWFNAFLNTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_006357961.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Solanum tuberosum]
Length=522

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCVL GLVGSVGLS LQFTN+NCMRNL+ITGLSLFLGISIPQFFNEYW   RH
Sbjct  384  FPIYAALYCVLFGLVGSVGLSFLQFTNLNCMRNLIITGLSLFLGISIPQFFNEYWYPARH  443

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV TNAGWFNAF+NTIF+SPP VGLIVAVFLDNTL+VEK+KKDRGMPWWVKFRTFRGDN
Sbjct  444  GLVQTNAGWFNAFVNTIFTSPPMVGLIVAVFLDNTLDVEKAKKDRGMPWWVKFRTFRGDN  503

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  504  RNEEFYTLPFNLNRFFPPT  522



>ref|XP_006469618.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X2 
[Citrus sinensis]
Length=518

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 126/137 (92%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCVL GLV  +     QFTNMNCMRNL+ITGLSLFLGISIPQFFNEYW+   HGL
Sbjct  384  IFAALYCVLFGLVVGLSFL--QFTNMNCMRNLVITGLSLFLGISIPQFFNEYWNPQHHGL  441

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN
Sbjct  442  VHTNAGWFNAFLNTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  501

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  502  EEFYTLPFNLNRFFPPT  518



>gb|KDP30803.1| hypothetical protein JCGZ_13746 [Jatropha curcas]
Length=522

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+ ALYC+L GLV +VGLS LQFTNMN MRNL+ITGLSLFLGIS+PQFFNEYW+  RH
Sbjct  384  FPIFGALYCILFGLVAAVGLSFLQFTNMNSMRNLIITGLSLFLGISVPQFFNEYWNPSRH  443

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSP TVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  444  GLVHTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  503

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  504  RNEEFYTLPFNLNRFFPPT  522



>ref|XP_004243518.1| PREDICTED: nucleobase-ascorbate transporter 1 [Solanum lycopersicum]
Length=522

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCVL GLVGSVGLS LQFTN+NCMRNL+ITGLSLFLGISIPQFFNEYW   RH
Sbjct  384  FPIYAALYCVLFGLVGSVGLSFLQFTNLNCMRNLIITGLSLFLGISIPQFFNEYWYPARH  443

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV TNAGWFNAF+NTIF+SPP VGLI+AVFLDNTL+VEK+KKDRGMPWWVKFRTFRGDN
Sbjct  444  GLVQTNAGWFNAFVNTIFTSPPMVGLIIAVFLDNTLDVEKAKKDRGMPWWVKFRTFRGDN  503

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  504  RNEEFYTLPFNLNRFFPPT  522



>ref|XP_002525330.1| purine permease, putative [Ricinus communis]
 gb|EEF37063.1| purine permease, putative [Ricinus communis]
Length=498

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+PQFFNEYW+  RH
Sbjct  360  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPQFFNEYWNPPRH  419

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSP TVGLIVAVFLDNT+EVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  420  GLVHTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTIEVEKSKKDRGMPWWVKFRTFRGDN  479

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLN+FFPPT
Sbjct  480  RNEEFYTLPFNLNKFFPPT  498



>ref|XP_009592403.1| PREDICTED: nucleobase-ascorbate transporter 1 [Nicotiana tomentosiformis]
Length=520

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCVL GLVGSVGLS LQFTN+NCMRNL+ITGLSLFLGISIPQFFNEYW   RH
Sbjct  382  FPIYAALYCVLFGLVGSVGLSFLQFTNLNCMRNLIITGLSLFLGISIPQFFNEYWYPARH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV+TNAGWFNA +NTIF+SPP VGLIVAVFLDNTLEVEK+KKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVNTNAGWFNAIVNTIFTSPPMVGLIVAVFLDNTLEVEKAKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_007049166.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93323.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCV  GLV SVGLS LQFTNMNCMRNL+ITGLSLFLG+SIPQFFNEYW+    
Sbjct  382  FPIFAALYCVQFGLVASVGLSFLQFTNMNCMRNLIITGLSLFLGLSIPQFFNEYWNPTHR  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSP TVGLI+AVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVHTNAGWFNAFLNTIFSSPATVGLIIAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>gb|KJB42851.1| hypothetical protein B456_007G170500 [Gossypium raimondii]
Length=491

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMNCMRNL+ITGLSLFLGISIPQFFNEYW+    
Sbjct  353  FPIFAALYCVLFGLVASVGLSFLQFTNMNCMRNLIITGLSLFLGISIPQFFNEYWNLKHR  412

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIF SP TVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  413  GLVHTNAGWFNAFLNTIFLSPATVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  472

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  473  RNEEFYTLPFNLNRFFPPT  491



>ref|XP_009771645.1| PREDICTED: nucleobase-ascorbate transporter 1 [Nicotiana sylvestris]
Length=520

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCVL GLVGSVGLS LQFTN+NCMRNL+ITGLSLFLGISIPQFFNEYW   RH
Sbjct  382  FPIYAALYCVLFGLVGSVGLSFLQFTNLNCMRNLIITGLSLFLGISIPQFFNEYWYPARH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV+T+AGWFNA +NTIF+SPP VGLIVAVFLDNTLEVEK+KKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVNTHAGWFNAIVNTIFTSPPMVGLIVAVFLDNTLEVEKAKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>gb|KJB42850.1| hypothetical protein B456_007G170500 [Gossypium raimondii]
Length=520

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMNCMRNL+ITGLSLFLGISIPQFFNEYW+    
Sbjct  382  FPIFAALYCVLFGLVASVGLSFLQFTNMNCMRNLIITGLSLFLGISIPQFFNEYWNLKHR  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIF SP TVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVHTNAGWFNAFLNTIFLSPATVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>gb|KHG19290.1| Nucleobase-ascorbate transporter 1 -like protein [Gossypium arboreum]
 gb|KHG20439.1| Nucleobase-ascorbate transporter 1 -like protein [Gossypium arboreum]
 gb|KHG28141.1| Nucleobase-ascorbate transporter 1 -like protein [Gossypium arboreum]
Length=240

 Score =   227 bits (578),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLVGSVGLS LQFTNMNCMRNL+ITGLSLFLGISIPQFFN+YW+    
Sbjct  102  FPIFAALYCVLFGLVGSVGLSFLQFTNMNCMRNLIITGLSLFLGISIPQFFNQYWNPSHR  161

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GL HTNA WFNAF+NT+FSSP  VGL VAV LDNT+EVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  162  GLAHTNAAWFNAFVNTVFSSPAMVGLTVAVILDNTIEVEKSKKDRGMPWWVKFRTFRGDN  221

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  222  RNEEFYTLPFNLNRFFPPT  240



>ref|XP_010110631.1| Nucleobase-ascorbate transporter 1 [Morus notabilis]
 gb|EXC27253.1| Nucleobase-ascorbate transporter 1 [Morus notabilis]
Length=540

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGISIPQFFNEYW+   H
Sbjct  402  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISIPQFFNEYWTPSHH  461

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV TNAGWFNAF+NTIFSSP TVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  462  GLVRTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  521

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  522  RNEEFYTLPFNLNRFFPPT  540



>ref|XP_002274603.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Vitis 
vinifera]
 emb|CBI28858.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   235 bits (599),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+PQFFNEYW + RH
Sbjct  382  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPQFFNEYWGRNRH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV+TNAGWFNAF+NTIFSSP T+GLIVAVFLDNTL+VEK+KKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVNTNAGWFNAFLNTIFSSPATIGLIVAVFLDNTLDVEKAKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>emb|CDP11315.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCVL GLVGSVGLS LQFTNMN MRNL ITGLSLFLGISIPQFF EYW   RH
Sbjct  383  FPIYAALYCVLFGLVGSVGLSFLQFTNMNSMRNLFITGLSLFLGISIPQFFGEYWGTNRH  442

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV TNAGWFNAF+NTIF+SPPTV LI+AVFLDNTL+VEKSKKDRGMPWWVKFRTFRGDN
Sbjct  443  GLVQTNAGWFNAFLNTIFASPPTVALIIAVFLDNTLDVEKSKKDRGMPWWVKFRTFRGDN  502

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  503  RNEEFYTLPFNLNRFFPPT  521



>gb|KCW46946.1| hypothetical protein EUGRSUZ_K00759 [Eucalyptus grandis]
Length=398

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+PQFF EYW+  R 
Sbjct  260  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPQFFYEYWTPNRK  319

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSP  VGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTFRGDN
Sbjct  320  GLVHTNAGWFNAFLNTIFSSPAMVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFRGDN  379

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  380  RNEEFYTLPFNLNRFFPPT  398



>gb|KHN38486.1| Nucleobase-ascorbate transporter 1 [Glycine soja]
Length=548

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTNMN MRNL+I GL+LFLGIS+PQFFN+YW+  RH
Sbjct  410  FPIFAALYCILFGLVASIGISFLQFTNMNSMRNLIIIGLTLFLGISVPQFFNQYWTLSRH  469

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAV LDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  470  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVLLDNTLEVERSKKDRGMPWWVKFRTFKGDN  529

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  530  RNEEFYTLPFNLNRFFPPT  548



>ref|XP_007141637.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
 gb|ESW13631.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
Length=483

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTN+N MRNL+I GL+LFLGIS+PQFFN+YW+  RH
Sbjct  345  FPIFAALYCILFGLVASIGISFLQFTNLNSMRNLIIIGLTLFLGISVPQFFNQYWTPSRH  404

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAV LDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  405  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVLLDNTLEVERSKKDRGMPWWVKFRTFKGDN  464

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  465  RNEEFYTLPFNLNRFFPPT  483



>ref|XP_003519453.2| PREDICTED: nucleobase-ascorbate transporter 1-like [Glycine max]
Length=557

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTNMN MRNL+I GL+LFLGIS+PQFFN+YW+  RH
Sbjct  419  FPIFAALYCILFGLVASIGISFLQFTNMNSMRNLIIIGLTLFLGISVPQFFNQYWTLSRH  478

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAV LDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  479  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVLLDNTLEVERSKKDRGMPWWVKFRTFKGDN  538

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  539  RNEEFYTLPFNLNRFFPPT  557



>ref|XP_011467773.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467774.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAALYC+L GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+P FF+EYW+   HGL
Sbjct  346  IYAALYCILFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPHFFSEYWNPAHHGL  405

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIFSSP TVGLIVAVFLDNT+EVEK+KKDRGMPWWVKFRTFRGD+RN
Sbjct  406  VHTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTIEVEKAKKDRGMPWWVKFRTFRGDSRN  465

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  466  EEFYTLPFNLNRFFPPT  482



>ref|XP_010657232.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Vitis 
vinifera]
Length=530

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+PQFFNEYW + RH
Sbjct  392  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPQFFNEYWGRNRH  451

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV+TNAGWFNAF+NTIFSSP T+GLIVAVFLDNTL+VEK+KKDRGMPWWVKFRTFRGDN
Sbjct  452  GLVNTNAGWFNAFLNTIFSSPATIGLIVAVFLDNTLDVEKAKKDRGMPWWVKFRTFRGDN  511

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  512  RNEEFYTLPFNLNRFFPPT  530



>ref|XP_011086376.1| PREDICTED: nucleobase-ascorbate transporter 1 [Sesamum indicum]
Length=520

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLVGSVGLS LQFTNMN MRNL ITGLSLFLGISIPQFF+EYW   R 
Sbjct  382  FPIFAALYCVLFGLVGSVGLSFLQFTNMNSMRNLFITGLSLFLGISIPQFFDEYWVLPRR  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIF SPPTVGLI+AVFLDNT+EVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVHTNAGWFNAFLNTIFMSPPTVGLIIAVFLDNTIEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_007141636.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
 gb|ESW13630.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
Length=521

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTN+N MRNL+I GL+LFLGIS+PQFFN+YW+  RH
Sbjct  383  FPIFAALYCILFGLVASIGISFLQFTNLNSMRNLIIIGLTLFLGISVPQFFNQYWTPSRH  442

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAV LDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  443  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVLLDNTLEVERSKKDRGMPWWVKFRTFKGDN  502

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  503  RNEEFYTLPFNLNRFFPPT  521



>ref|XP_007146103.1| hypothetical protein PHAVU_006G012700g [Phaseolus vulgaris]
 gb|ESW18097.1| hypothetical protein PHAVU_006G012700g [Phaseolus vulgaris]
Length=520

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ GLV +VG+S LQFTNMN MRNL+ITGL+LFLGIS+PQFFN+YW+   H
Sbjct  382  FPIFAAIYCVVFGLVAAVGISFLQFTNMNSMRNLIITGLTLFLGISVPQFFNQYWTSSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_006828104.1| hypothetical protein AMTR_s00151p00089770 [Amborella trichopoda]
 gb|ERM95520.1| hypothetical protein AMTR_s00151p00089770 [Amborella trichopoda]
Length=522

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV SVGLS LQFTNMN MRNL ITGLSLFLGIS+PQ+FNE+W+  RH
Sbjct  384  FPIFAALYCILFGLVASVGLSFLQFTNMNSMRNLFITGLSLFLGISVPQYFNEFWASARH  443

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT+AGWFNAF+NTIFSSPPTVGLIVAV LDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  444  GPAHTHAGWFNAFLNTIFSSPPTVGLIVAVTLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  503

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  504  RNEEFYTLPFNLNRFFPPT  522



>gb|KHM99089.1| Nucleobase-ascorbate transporter 1 [Glycine soja]
Length=483

 Score =   231 bits (590),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTNMN +RNL+I GL+LFLGIS+PQFFN+YW+  R 
Sbjct  345  FPIFAALYCILFGLVASIGISFLQFTNMNSIRNLIIIGLTLFLGISVPQFFNQYWTPSRR  404

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  405  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFKGDN  464

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  465  RNEEFYTLPFNLNRFFPPT  483



>ref|XP_004304090.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=520

 Score =   232 bits (592),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAALYC+L GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+P FF+EYW+   HGL
Sbjct  384  IYAALYCILFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPHFFSEYWNPAHHGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIFSSP TVGLIVAVFLDNT+EVEK+KKDRGMPWWVKFRTFRGD+RN
Sbjct  444  VHTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTIEVEKAKKDRGMPWWVKFRTFRGDSRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_003555666.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Glycine max]
Length=520

 Score =   232 bits (592),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV +VG+S LQFTNMN MRNL+ITGL+LFLGIS+PQFF++YW+   H
Sbjct  382  FPIFAALYCVLFGLVAAVGISFLQFTNMNSMRNLIITGLTLFLGISVPQFFSQYWTSSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_010035524.1| PREDICTED: nucleobase-ascorbate transporter 1 [Eucalyptus grandis]
Length=520

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+PQFF EYW+  R 
Sbjct  382  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPQFFYEYWTPNRK  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIFSSP  VGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVHTNAGWFNAFLNTIFSSPAMVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_006595824.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X3 
[Glycine max]
Length=510

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTNMN +RNL+I GL+LFLGIS+PQFFN+YW+  R 
Sbjct  372  FPIFAALYCILFGLVASIGISFLQFTNMNSIRNLIIIGLTLFLGISVPQFFNQYWTPSRR  431

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  432  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFKGDN  491

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  492  RNEEFYTLPFNLNRFFPPT  510



>ref|XP_006595825.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X4 
[Glycine max]
Length=503

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTNMN +RNL+I GL+LFLGIS+PQFFN+YW+  R 
Sbjct  365  FPIFAALYCILFGLVASIGISFLQFTNMNSIRNLIIIGLTLFLGISVPQFFNQYWTPSRR  424

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  425  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFKGDN  484

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  485  RNEEFYTLPFNLNRFFPPT  503



>gb|KHN08001.1| Nucleobase-ascorbate transporter 1 [Glycine soja]
Length=398

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV +VG+S LQFTNMN MRNL+ITGL+LFLGIS+PQF N+YW+   H
Sbjct  260  FPIFAALYCVLFGLVAAVGISFLQFTNMNSMRNLIITGLTLFLGISVPQFSNQYWTSSHH  319

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAV LDNTLEVE+SKKDRGMPWWVKFRTFRGDN
Sbjct  320  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVLLDNTLEVERSKKDRGMPWWVKFRTFRGDN  379

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  380  RNEEFYTLPFNLNRFFPPT  398



>gb|AES71659.2| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=520

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLVG+VGLS LQFTNMN MRNL+ITGL+LFLGIS+PQFFNE+W+   H
Sbjct  382  FPIFAALYCVLFGLVGAVGLSFLQFTNMNSMRNLIITGLTLFLGISVPQFFNEFWTSSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAV LDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVILDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_003601408.1| Nucleobase ascorbate transporter [Medicago truncatula]
Length=550

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLVG+VGLS LQFTNMN MRNL+ITGL+LFLGIS+PQFFNE+W+   H
Sbjct  412  FPIFAALYCVLFGLVGAVGLSFLQFTNMNSMRNLIITGLTLFLGISVPQFFNEFWTSSHH  471

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAV LDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  472  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVILDNTLEVEKSKKDRGMPWWVKFRTFRGDN  531

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  532  RNEEFYTLPFNLNRFFPPT  550



>ref|XP_003545573.2| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X1 
[Glycine max]
Length=562

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTNMN +RNL+I GL+LFLGIS+PQFFN+YW+  R 
Sbjct  424  FPIFAALYCILFGLVASIGISFLQFTNMNSIRNLIIIGLTLFLGISVPQFFNQYWTPSRR  483

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  484  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFKGDN  543

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  544  RNEEFYTLPFNLNRFFPPT  562



>ref|XP_004502044.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Cicer arietinum]
Length=520

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLVG+VG+S LQFTNMN MRNL+I GL+LFLGIS+PQFFN+YW+   H
Sbjct  382  FPIFAALYCVLFGLVGAVGISFLQFTNMNSMRNLIIIGLTLFLGISVPQFFNQYWTSSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAV LDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVILDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_006595823.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X2 
[Glycine max]
Length=589

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYC+L GLV S+G+S LQFTNMN +RNL+I GL+LFLGIS+PQFFN+YW+  R 
Sbjct  451  FPIFAALYCILFGLVASIGISFLQFTNMNSIRNLIIIGLTLFLGISVPQFFNQYWTPSRR  510

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NT+FSSPPTVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTF+GDN
Sbjct  511  GLVHTNAGWFNAFLNTLFSSPPTVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFKGDN  570

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  571  RNEEFYTLPFNLNRFFPPT  589



>ref|XP_008456412.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Cucumis 
melo]
Length=520

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLG+SIPQFFNEYW+  R GL
Sbjct  384  IFAAIYCVLFGLVASVGLSFLQFTNMNSMRNLMITGLSLFLGLSIPQFFNEYWNPARRGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNA WFNAF+NTIFSSP TV L+VAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAEWFNAFLNTIFSSPVTVALVVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_006297434.1| hypothetical protein CARUB_v10013457mg [Capsella rubella]
 gb|EOA30332.1| hypothetical protein CARUB_v10013457mg [Capsella rubella]
Length=520

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF  YW +  HGL
Sbjct  384  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFVNYWDERHHGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIF SP TVGLI+AVFLDNT+EVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTIFMSPATVGLIIAVFLDNTMEVERSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>gb|KHN41326.1| Nucleobase-ascorbate transporter 1 [Glycine soja]
Length=520

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV +VG+S LQFTNMN M NL+ITGL+LFLGIS+PQFF++YW+   H
Sbjct  382  FPIFAALYCVLFGLVAAVGISFLQFTNMNSMGNLIITGLTLFLGISVPQFFSQYWTSSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAVFLDNTLEVE+SKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVFLDNTLEVERSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_003542318.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Glycine max]
Length=520

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV +VG+S LQFTNMN MRNL+ITGL+LFLGIS+PQF N+YW+   H
Sbjct  382  FPIFAALYCVLFGLVAAVGISFLQFTNMNSMRNLIITGLTLFLGISVPQFSNQYWTSSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWFNAF+NTIFSSP TVGLIVAV LDNTLEVE+SKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTNAGWFNAFLNTIFSSPATVGLIVAVLLDNTLEVERSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>gb|EYU43133.1| hypothetical protein MIMGU_mgv1a004837mg [Erythranthe guttata]
Length=508

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAALYCVL GLVGS+GLS LQFTNMN MRNL I GLSLFLGISIP FF+EYW+  R 
Sbjct  370  FPIYAALYCVLFGLVGSIGLSFLQFTNMNSMRNLFIIGLSLFLGISIPHFFDEYWTPHRR  429

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHTNAGWFNAF+NTIF SPPTVGL+VAV LDNT+EVEKSKKDRGMPWW KFRTFRGDN
Sbjct  430  GLVHTNAGWFNAFLNTIFMSPPTVGLMVAVLLDNTIEVEKSKKDRGMPWWAKFRTFRGDN  489

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  490  RNEEFYTLPFNLNRFFPPT  508



>ref|XP_010533013.1| PREDICTED: nucleobase-ascorbate transporter 1 [Tarenaya hassleriana]
Length=520

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+L GLV +VG+S LQFTNMN MRNL++TGLSLFLGISI QFF++YW    HGL
Sbjct  384  IFAALYCILFGLVAAVGISFLQFTNMNSMRNLMVTGLSLFLGISIAQFFDQYWDPRHHGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIF SP TVGLIVAVFLDNTL+VEKSKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTIFMSPATVGLIVAVFLDNTLDVEKSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_004149274.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Cucumis sativus]
 ref|XP_004171532.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Cucumis sativus]
 gb|KGN46982.1| hypothetical protein Csa_6G157080 [Cucumis sativus]
Length=520

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLG+SIPQFFNEYW+  R GL
Sbjct  384  IFAAIYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGLSIPQFFNEYWNPARRGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTN+ WFNAF+NTIFSSP TV L+VAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNSEWFNAFLNTIFSSPVTVALVVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_011047203.1| PREDICTED: nucleobase-ascorbate transporter 1 [Populus euphratica]
Length=521

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGISIPQFFNEYW+   +
Sbjct  383  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISIPQFFNEYWNPTHN  442

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHT+AGWFNAF+N IFSSP TVGLIVAV LDNTLEVE+SKKDRGMPWW KFRTFRGDN
Sbjct  443  GLVHTHAGWFNAFLNAIFSSPATVGLIVAVLLDNTLEVERSKKDRGMPWWAKFRTFRGDN  502

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  503  RNEEFYTLPFNLNRFFPPT  521



>gb|KJB08649.1| hypothetical protein B456_001G095500 [Gossypium raimondii]
Length=520

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLVGSVGLS LQFTNMNCMRNL+ITGLSLFLGISIPQFFN+YW+    
Sbjct  382  FPIFAALYCVLFGLVGSVGLSFLQFTNMNCMRNLIITGLSLFLGISIPQFFNQYWNPSHR  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GL HTNA WFNAF+NT+FSSP  VGL VAV LDNT+EVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GLAHTNAAWFNAFVNTVFSSPAMVGLTVAVILDNTIEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_002883707.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59966.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+C+L GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF +YW    +GL
Sbjct  384  IYAALHCILFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFVQYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIF SP TVGLI+AVF+DNT+EVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTIFMSPATVGLIIAVFMDNTMEVERSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_010424560.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Camelina 
sativa]
Length=404

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF  YW    +GL
Sbjct  268  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFVNYWDARHYGL  327

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIF SP TVGLI+AVF+DNT+EV++SKKDRGMPWWVKFRTFRGDNRN
Sbjct  328  VHTNAGWFNAFLNTIFMSPATVGLIIAVFMDNTMEVDRSKKDRGMPWWVKFRTFRGDNRN  387

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  388  EEFYTLPFNLNRFFPPT  404



>ref|XP_010490176.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Camelina 
sativa]
Length=502

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF  YW    +GL
Sbjct  366  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFVNYWDARHYGL  425

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIF SP TVGLI+AVF+DNT+EVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  426  VHTNAGWFNAFLNTIFMSPATVGLIIAVFMDNTMEVERSKKDRGMPWWVKFRTFRGDNRN  485

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  486  EEFYTLPFNLNRFFPPT  502



>ref|NP_178636.1| nucleobase-ascorbate transporter 1 [Arabidopsis thaliana]
 sp|Q9SHZ3.1|NAT1_ARATH RecName: Full=Nucleobase-ascorbate transporter 1; Short=AtNAT1 
[Arabidopsis thaliana]
 gb|AAD26910.1| putative membrane transporter [Arabidopsis thaliana]
 gb|AAY56427.1| At2g05760 [Arabidopsis thaliana]
 gb|AEC05969.1| nucleobase-ascorbate transporter 1 [Arabidopsis thaliana]
Length=520

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+C+L GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF +YW    +GL
Sbjct  384  IYAALHCILFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFAQYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NT+F SP TVGLI+AVF+DNT+EVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTLFMSPATVGLIIAVFMDNTMEVERSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>emb|CDY18053.1| BnaC07g04170D [Brassica napus]
Length=520

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF +YW    +GL
Sbjct  384  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFVQYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NT+F SP TVGLI+AVF+DNT+EVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTVFMSPATVGLIIAVFMDNTVEVERSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_002320481.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|EEE98796.1| xanthine/uracil permease family protein [Populus trichocarpa]
Length=521

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGISIPQFFNEYW+   +
Sbjct  383  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISIPQFFNEYWNPTHN  442

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHT+AGWFNAF+N IFSSP TVGLIVAV LDNT+EVE+SKKDRGM WWVKFRTFRGDN
Sbjct  443  GLVHTHAGWFNAFLNAIFSSPATVGLIVAVLLDNTIEVERSKKDRGMQWWVKFRTFRGDN  502

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  503  RNEEFYTLPFNLNRFFPPT  521



>ref|XP_006396141.1| hypothetical protein EUTSA_v10002485mg [Eutrema salsugineum]
 gb|ESQ36920.1| hypothetical protein EUTSA_v10002485mg [Eutrema salsugineum]
Length=520

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF +YW    +GL
Sbjct  384  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFVQYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NT+F SP TVGLI+AVF+DNT+EVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTVFMSPATVGLIIAVFMDNTVEVERSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_010467086.1| PREDICTED: nucleobase-ascorbate transporter 1 [Camelina sativa]
Length=520

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL+ITGLSLFLGISIPQFF  YW    +GL
Sbjct  384  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLMITGLSLFLGISIPQFFVNYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFNAF+NTIF SP TVGLI+AVF+DNT+EVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNAFLNTIFMSPATVGLIIAVFMDNTMEVERSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>ref|XP_010252545.1| PREDICTED: nucleobase-ascorbate transporter 1 [Nelumbo nucifera]
Length=520

 Score =   224 bits (572),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL ITGLSLFLGIS+PQ+FN++W    H
Sbjct  382  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLFITGLSLFLGISVPQYFNDFWFSSHH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHT+AGWFNAF+NTIFSS PTVGLIVAV LDNTL+VEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTHAGWFNAFLNTIFSSAPTVGLIVAVILDNTLDVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>gb|KFK39879.1| hypothetical protein AALP_AA3G300500 [Arabis alpina]
Length=520

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL+ITGL+LFLGISIPQFF +YW    +GL
Sbjct  384  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLMITGLALFLGISIPQFFVQYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHTNAGWFN+F+NT+F SP TVGLI+AVF+DNTLEVE+SKKDRGMPWWVKFRTFRGDNRN
Sbjct  444  VHTNAGWFNSFLNTVFMSPATVGLIIAVFMDNTLEVERSKKDRGMPWWVKFRTFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNRFFPPT
Sbjct  504  EEFYTLPFNLNRFFPPT  520



>gb|EYU34044.1| hypothetical protein MIMGU_mgv1a004592mg [Erythranthe guttata]
Length=519

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 128/139 (92%), Gaps = 1/139 (1%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+A LYCVL GLVGSVGLS LQFTNMN MRNL ITG+SLFLGISIPQFF+EYW+ GR 
Sbjct  382  FPIFAGLYCVLFGLVGSVGLSFLQFTNMNSMRNLFITGISLFLGISIPQFFSEYWN-GRR  440

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLVHT+AGWFNAF+NTIF SPPT+ LIVAV LDNTL+VEKSKKDRGMPWWVKFRTF+GDN
Sbjct  441  GLVHTHAGWFNAFLNTIFMSPPTIALIVAVILDNTLDVEKSKKDRGMPWWVKFRTFKGDN  500

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  501  RNEEFYTLPFNLNRFFPPT  519



>ref|XP_010928524.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Elaeis guineensis]
Length=363

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVG+S LQFTNMN MRNL+ITGLSLFLGIS+PQ+F+E  S   H
Sbjct  225  FPIFAALYCVLFGLVASVGISFLQFTNMNSMRNLIITGLSLFLGISVPQYFSETLSSSGH  284

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G V+T AGWFN F+NTIF SPPTVGLIV+VFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  285  GPVYTRAGWFNGFLNTIFFSPPTVGLIVSVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  344

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLN+FFPPT
Sbjct  345  RNEEFYTLPFNLNKFFPPT  363



>ref|XP_008799349.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Phoenix dactylifera]
Length=520

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVG+S LQFTNMN MRNL+ITGLSLFLGIS+PQ+FN+      H
Sbjct  382  FPIFAALYCVLFGLVASVGISFLQFTNMNSMRNLIITGLSLFLGISVPQYFNDTLVSSGH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHT AGWFN F+NTIF SPPTVGLIV+VFLDNTL+VEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTRAGWFNGFLNTIFLSPPTVGLIVSVFLDNTLDVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>emb|CDY50943.1| BnaC03g74430D [Brassica napus]
Length=520

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL ITGLSLFLGISIPQFF  YW    +GL
Sbjct  384  IYAALHCVLFGLVAAVGLSLLQFTNMNSMRNLTITGLSLFLGISIPQFFVHYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHT+AGWFNAF+NT+F SPPTVGLI+AVF+DNT++VE SKKDRGMPWWVKFR FRGDNRN
Sbjct  444  VHTDAGWFNAFLNTVFMSPPTVGLIIAVFMDNTVDVEMSKKDRGMPWWVKFRNFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFY LPFNLNRFFPPT
Sbjct  504  EEFYNLPFNLNRFFPPT  520



>emb|CDX93090.1| BnaA03g38120D [Brassica napus]
Length=521

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL ITGLSLFLGISIPQFF  YW    +GL
Sbjct  385  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLTITGLSLFLGISIPQFFVHYWDARHYGL  444

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHT+AGWFNAF+NT+F SP TVGLI+AVF+DNT+EVE SKKDRGMPWWVKFR FRGDNRN
Sbjct  445  VHTDAGWFNAFLNTVFMSPATVGLIIAVFMDNTVEVEMSKKDRGMPWWVKFRNFRGDNRN  504

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFY LPFNLNRFFPPT
Sbjct  505  EEFYNLPFNLNRFFPPT  521



>ref|XP_009136180.1| PREDICTED: nucleobase-ascorbate transporter 1 [Brassica rapa]
Length=520

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            IYAAL+CVL GLV +VGLS LQFTNMN MRNL ITGLSLFLGISIPQFF  YW    +GL
Sbjct  384  IYAALHCVLFGLVAAVGLSFLQFTNMNSMRNLTITGLSLFLGISIPQFFVHYWDARHYGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHT+AGWFNAF+NT+F SP TVGLI+AVF+DNT+EVE SKKDRGMPWWVKFR FRGDNRN
Sbjct  444  VHTDAGWFNAFLNTVFMSPATVGLIIAVFMDNTVEVEMSKKDRGMPWWVKFRNFRGDNRN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFY LPFNLNRFFPPT
Sbjct  504  EEFYNLPFNLNRFFPPT  520



>gb|ABR17751.1| unknown [Picea sitchensis]
Length=524

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV +VG+S +QFTNMN MRNL I G+SLFLG+SIPQ+FNE+++  R 
Sbjct  386  FPIFAALYCVLFGLVAAVGISFIQFTNMNSMRNLFILGVSLFLGLSIPQYFNEFYATSRV  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHTNAGWF+ F+NTIFSSPPTV LI+AVFLDNTLEVE SKKDRGMPWWVKFRTFRGD+
Sbjct  446  GPVHTNAGWFDDFLNTIFSSPPTVALIIAVFLDNTLEVEHSKKDRGMPWWVKFRTFRGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLN+FFPPT
Sbjct  506  RNEEFYTLPFNLNKFFPPT  524



>ref|XP_008803524.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Phoenix dactylifera]
Length=520

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVG+S LQFTNMN MRNL+ITGLSLFLGIS+PQ+FN+      H
Sbjct  382  FPIFAALYCVLFGLVASVGISFLQFTNMNSMRNLIITGLSLFLGISVPQYFNDTLLSSGH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHT AGWFN F+NTIF SPPTVGLIV+VFLDNTLEVEK KKDRGMPWWVKFRTFRGDN
Sbjct  442  GPVHTRAGWFNEFLNTIFLSPPTVGLIVSVFLDNTLEVEKYKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLN+FFPPT
Sbjct  502  RNEEFYTLPFNLNKFFPPT  520



>ref|XP_009395859.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVG+S LQFTNMN MRNL+ITGLSLFLGIS+PQ+FN+      H
Sbjct  382  FPIFAALYCVLFGLVASVGISFLQFTNMNSMRNLIITGLSLFLGISVPQYFNDTLVSSGH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
              V+T AGWFN F+NTIF SPPTVGLIV+VFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  APVNTRAGWFNGFLNTIFLSPPTVGLIVSVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_009415455.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVG+S LQFTNMN MRNL+ITGLSLFLGIS+PQ+FN+      H
Sbjct  382  FPIFAALYCVLFGLVASVGISFLQFTNMNSMRNLIITGLSLFLGISVPQYFNDTRVSSGH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
              V+T+AGWFN F+NTIF SPPTVGLIV++FLDNTLEVEKSKKDRGMPWWVKFRTFRGDN
Sbjct  442  APVNTHAGWFNGFLNTIFLSPPTVGLIVSIFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  502  RNEEFYTLPFNLNRFFPPT  520



>ref|XP_010943259.1| PREDICTED: nucleobase-ascorbate transporter 1 [Elaeis guineensis]
Length=520

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVG+S LQFTNMN MRNL+ITGLSLFLGIS+PQ+FN+      H
Sbjct  382  FPIFAALYCVLFGLVASVGISFLQFTNMNSMRNLIITGLSLFLGISVPQYFNDTLLSSGH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G VHT AGWFN F+NTIF SPPTVGLIV+VFLDNTL+V+KSKKDRGMPWWVKFRTF+GDN
Sbjct  442  GPVHTRAGWFNEFLNTIFLSPPTVGLIVSVFLDNTLDVDKSKKDRGMPWWVKFRTFKGDN  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLN+FFPPT
Sbjct  502  RNEEFYTLPFNLNKFFPPT  520



>ref|XP_010691485.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=465

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL I G+SLFLGISIPQFF++Y     H
Sbjct  329  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLFIIGISLFLGISIPQFFDDYLPH--H  386

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV TNAGWFNAF+ TIF S PTV LI+AVFLDNTL+VE+SKKDRGMPWWVKFR+FRGDN
Sbjct  387  GLVRTNAGWFNAFVTTIFISSPTVSLIIAVFLDNTLDVERSKKDRGMPWWVKFRSFRGDN  446

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  447  RNEEFYTLPFNLNRFFPPT  465



>ref|XP_010691484.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=518

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 122/139 (88%), Gaps = 2/139 (1%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL I G+SLFLGISIPQFF++Y     H
Sbjct  382  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLFIIGISLFLGISIPQFFDDYLPH--H  439

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV TNAGWFNAF+ TIF S PTV LI+AVFLDNTL+VE+SKKDRGMPWWVKFR+FRGDN
Sbjct  440  GLVRTNAGWFNAFVTTIFISSPTVSLIIAVFLDNTLDVERSKKDRGMPWWVKFRSFRGDN  499

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  500  RNEEFYTLPFNLNRFFPPT  518



>emb|CAN70193.1| hypothetical protein VITISV_004001 [Vitis vinifera]
Length=507

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV SVGLS LQFTNMN MRNL+ITGLSLFLGIS+PQFFNEYW + RH
Sbjct  382  FPIFAALYCVLFGLVASVGLSFLQFTNMNSMRNLIITGLSLFLGISVPQFFNEYWGRNRH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            GLV+TNAGWFNAF+NTIFSSP T+GLIVAVFLDNTL+VEK+KKDRGMPWWVKFRTFRGDN
Sbjct  442  GLVNTNAGWFNAFLNTIFSSPATIGLIVAVFLDNTLDVEKAKKDRGMPWWVKFRTFRGDN  501

Query  408  RNEEFY  391
            RNEEFY
Sbjct  502  RNEEFY  507



>gb|KDO77883.1| hypothetical protein CISIN_1g0098371mg, partial [Citrus sinensis]
Length=323

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+S+P++F EY ++  H
Sbjct  185  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSVPEYFREYTAKALH  244

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWWVKFRTF+GD 
Sbjct  245  GPAHTRAGWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWVKFRTFKGDT  304

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  305  RNEEFYTLPFNLNRFFPPS  323



>ref|XP_006830254.1| hypothetical protein AMTR_s00130p00100230 [Amborella trichopoda]
 gb|ERM97670.1| hypothetical protein AMTR_s00130p00100230 [Amborella trichopoda]
Length=524

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCVL GLV +VGLS LQFTNMN +RNL ITG+S FLG+S+P++FNEY    +H
Sbjct  386  FTIFAALYCVLFGLVAAVGLSFLQFTNMNSIRNLFITGVSFFLGLSVPEYFNEYTRTSQH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSP TV LIVAVFLDNTL+ + + KDRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTKAGWFNDYINTIFSSPATVALIVAVFLDNTLDYKDAAKDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  506  RNEEFYTLPFNLNRFFPPT  524



>ref|XP_010274460.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Nelumbo nucifera]
Length=524

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+S+P++F EY     H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSVPEYFREYTLSSHH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN FINTIFSS PTV LIVAVFLDNTL+ + + KDRGMPWW KFRTFRGD+
Sbjct  446  GPAHTNAGWFNDFINTIFSSSPTVALIVAVFLDNTLDYKDTAKDRGMPWWAKFRTFRGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP 
Sbjct  506  RNEEFYTLPFNLNRFFPPA  524



>gb|EEC83487.1| hypothetical protein OsI_29016 [Oryza sativa Indica Group]
Length=777

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCV+ G VG+VGLS +QFTNMN MR+L I G+SLFLGISIP++F  Y     H
Sbjct  639  FTMFAAIYCVMFGYVGAVGLSFMQFTNMNSMRSLFIVGVSLFLGISIPEYFFRYTMSALH  698

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INT+FSSPPTVGLIVAV LDNTLEV  + +DRGMPWW +FRTFRGD+
Sbjct  699  GPAHTRAGWFNDYINTVFSSPPTVGLIVAVILDNTLEVRDAARDRGMPWWARFRTFRGDS  758

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  759  RNEEFYTLPFNLNRFFPPS  777



>ref|NP_001061653.1| Os08g0369000 [Oryza sativa Japonica Group]
 dbj|BAF23567.1| Os08g0369000, partial [Oryza sativa Japonica Group]
Length=343

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCV+ G VG+VGLS +QFTNMN MR+L I G+SLFLGISIP++F  Y     H
Sbjct  205  FTMFAAIYCVMFGYVGAVGLSFMQFTNMNSMRSLFIIGVSLFLGISIPEYFFRYTMSALH  264

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INT+FSSPPTVGLIVAV LDNTLEV  + +DRGMPWW +FRTFRGD+
Sbjct  265  GPAHTRAGWFNDYINTVFSSPPTVGLIVAVILDNTLEVRDAARDRGMPWWARFRTFRGDS  324

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  325  RNEEFYTLPFNLNRFFPPS  343



>ref|XP_008443418.1| PREDICTED: nucleobase-ascorbate transporter 2 [Cucumis melo]
Length=524

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++L+LG+S+P +F EY ++  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALYLGLSVPDYFREYTAKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF SPPTV LIVAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFFSPPTVALIVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_004150216.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Cucumis sativus]
 ref|XP_004161201.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Cucumis sativus]
 gb|KGN65623.1| hypothetical protein Csa_1G470390 [Cucumis sativus]
Length=524

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++L+LG+S+P +F EY ++  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALYLGLSVPDYFREYTAKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF SPPTV LIVAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFFSPPTVALIVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_010924597.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Elaeis guineensis]
Length=524

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL ITG+S+FLG+SIPQ+F  Y +  +H
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSLLQFTNMNSMRNLFITGVSIFLGLSIPQYFFRYTASDQH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTV LIVAVFLDNTL+ + + KDRGMPWW +FRTF+GD+
Sbjct  446  GPAHTRAGWFNDYINTIFSSPPTVALIVAVFLDNTLDFKDADKDRGMPWWARFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|ACN26147.1| unknown [Zea mays]
Length=157

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y      
Sbjct  19   FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYTMAAHR  78

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGL+VAVFLDNTLEV+++  DRGMPWW +FRTF+GD+
Sbjct  79   GPAHTKAGWFNDYINTIFSSPPTVGLMVAVFLDNTLEVKQAGMDRGMPWWQRFRTFKGDS  138

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY LPFNLNRFFPP 
Sbjct  139  RNEEFYRLPFNLNRFFPPA  157



>ref|XP_008225311.1| PREDICTED: nucleobase-ascorbate transporter 2 [Prunus mume]
Length=524

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+S+P++F EY  +  H
Sbjct  386  FTIFAAAYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSVPEYFREYTLKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS PTV LIVAVFLDNTLE + S +DRGMPWWVKFR F+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPTVALIVAVFLDNTLEYKDSARDRGMPWWVKFRAFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_007211779.1| hypothetical protein PRUPE_ppa004190mg [Prunus persica]
 gb|EMJ12978.1| hypothetical protein PRUPE_ppa004190mg [Prunus persica]
Length=524

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+S+P++F EY  +  H
Sbjct  386  FTIFAAAYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSVPEYFREYTLKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS PTV LIVAVFLDNTLE   S +DRGMPWWVKFR F+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPTVALIVAVFLDNTLEYRDSARDRGMPWWVKFRAFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_008793044.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Phoenix dactylifera]
Length=524

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL ITG+S+FLG+SIP++F  Y +  +H
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSLLQFTNMNSMRNLFITGVSIFLGLSIPEYFFRYTASAQH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTV LIVAVFLDNTL+ + + KDRGMPWWV+FR+F+GD+
Sbjct  446  GPAHTRAGWFNDYINTIFSSPPTVALIVAVFLDNTLDFKDTDKDRGMPWWVRFRSFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_006467632.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Citrus sinensis]
Length=524

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+S+P++F EY ++  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSVPEYFREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWWVKFRTF+GD 
Sbjct  446  GPAHTRAGWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWVKFRTFKGDT  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_010920318.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X2 
[Elaeis guineensis]
Length=465

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV ++GLS LQFTNMN MRNL ITG+S+FLG+SIPQ+F  Y +  +H
Sbjct  327  FTIFAAVYCVLFGLVAAIGLSFLQFTNMNSMRNLFITGVSVFLGLSIPQYFFRYTTSAQH  386

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN +INTIFSSPPTV LIVAVFLDNTL+ + + KDRGMPWW++FRTF+GD+
Sbjct  387  GPAHTRAVWFNDYINTIFSSPPTVALIVAVFLDNTLDFKDTAKDRGMPWWIRFRTFKGDS  446

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  447  RNEEFYTLPFNLNRFFPPS  465



>ref|XP_010245958.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Nelumbo nucifera]
 ref|XP_010245959.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Nelumbo nucifera]
Length=520

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA++CVL GL+ S+GLS LQFTNMN MRNL+ITGLSLFLG+SIP +FN+ W+   HGL
Sbjct  384  IFAAIHCVLFGLMTSLGLSFLQFTNMNKMRNLVITGLSLFLGLSIPYYFNQTWTTSEHGL  443

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V+T A WFNAF+NTIFSS PTV L+VAV LDNT++VE SKKDRGMPWW KFR F+GD RN
Sbjct  444  VNTRASWFNAFLNTIFSSAPTVALLVAVLLDNTVDVETSKKDRGMPWWEKFRNFKGDARN  503

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFYTLPFNLNR FPPT
Sbjct  504  EEFYTLPFNLNRLFPPT  520



>ref|XP_004956567.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Setaria italica]
Length=525

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G+V +VGLS +QFTNMN MRNL I G+SLFLG+SIP++F+ Y +  R 
Sbjct  387  FTIFAAIYCVMFGIVAAVGLSFMQFTNMNSMRNLFIIGVSLFLGLSIPEYFSRYSTSSRQ  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTV L VAV LDNTL+V  + +DRGMPWW +FRTFRGD+
Sbjct  447  GPAHTKAGWFNDYINTIFSSPPTVALFVAVLLDNTLDVRDAARDRGMPWWARFRTFRGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_006660533.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Oryza brachyantha]
Length=525

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G+V +VGLS LQFTNMN MRNL I G+SLFLG+SIP++F+ Y +  ++
Sbjct  387  FPIFAAIYCVMFGIVAAVGLSFLQFTNMNSMRNLFIVGVSLFLGLSIPEYFSRYTASAQY  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +IN++FSSPPTV LIVAV LDNTL+V+++ +DRGMPWW +FRTFRGD+
Sbjct  447  GPAHTKAGWFNDYINSVFSSPPTVALIVAVLLDNTLDVKEAARDRGMPWWARFRTFRGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>emb|CDM84318.1| unnamed protein product [Triticum aestivum]
Length=1067

 Score =   204 bits (518),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768   FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
             F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  929   FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  988

Query  588   GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
             G  HT AGWFN +INTIFSSPPTVGL+VAVFLDNTLEV+ + +DRGMPWWV FR+F+GD+
Sbjct  989   GPAHTKAGWFNDYINTIFSSPPTVGLMVAVFLDNTLEVKDAGRDRGMPWWVPFRSFKGDS  1048

Query  408   RNEEFYTLPFNLNRFFPPT  352
             RNEEFY+LPFNLNRFFPP+
Sbjct  1049  RNEEFYSLPFNLNRFFPPS  1067



>ref|XP_011101410.1| PREDICTED: nucleobase-ascorbate transporter 2 [Sesamum indicum]
Length=524

 Score =   198 bits (504),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AALYCV+ GLV SVGLS LQFTNMN MRNL ITG+SLFLG+SIP++F EY +   H
Sbjct  386  FTIFAALYCVMFGLVASVGLSFLQFTNMNSMRNLFITGVSLFLGLSIPEYFREYTAAALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV L+VAVFLDNTL+ + S +DRGMPWW KFRTF+GD+
Sbjct  446  GPAHTKAGWFNDFLNTIFLSSPTVALMVAVFLDNTLDYKDSARDRGMPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>emb|CDO96816.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ GLV SVGLS LQFTNMN MR+L ITG+SLFLG+SIP++F EY +   H
Sbjct  386  FTIFAAVYCVMFGLVASVGLSFLQFTNMNSMRSLFITGVSLFLGLSIPEYFREYTTAALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIV+VFLDNTL+ + S KDRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTKAGWFNDFLNTIFLSSPTVALIVSVFLDNTLDYKDSAKDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_006449522.1| hypothetical protein CICLE_v10014896mg [Citrus clementina]
 gb|ESR62762.1| hypothetical protein CICLE_v10014896mg [Citrus clementina]
Length=524

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+S+P++F EY ++  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSVPEYFREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIV+VFLDNTL+ + S KDRGMPWWVKFRTF+GD 
Sbjct  446  GPAHTRAGWFNDFLNTIFFSSPTVALIVSVFLDNTLDYKDSAKDRGMPWWVKFRTFKGDT  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_010920310.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X1 
[Elaeis guineensis]
Length=524

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV ++GLS LQFTNMN MRNL ITG+S+FLG+SIPQ+F  Y +  +H
Sbjct  386  FTIFAAVYCVLFGLVAAIGLSFLQFTNMNSMRNLFITGVSVFLGLSIPQYFFRYTTSAQH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN +INTIFSSPPTV LIVAVFLDNTL+ + + KDRGMPWW++FRTF+GD+
Sbjct  446  GPAHTRAVWFNDYINTIFSSPPTVALIVAVFLDNTLDFKDTAKDRGMPWWIRFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_008789343.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Phoenix dactylifera]
Length=524

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+ CVL GLV ++GLS LQFTNMN MRNL ITG+S+FLG+SIPQ+F  Y +  +H
Sbjct  386  FTIFAAVQCVLFGLVAAIGLSFLQFTNMNSMRNLFITGVSIFLGLSIPQYFFRYTASAQH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTV LIVAVFLDNTL+ + + +DRGMPWWV+FRTF GD+
Sbjct  446  GPAHTRAGWFNDYINTIFSSPPTVALIVAVFLDNTLDFKDTARDRGMPWWVRFRTFEGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_006659347.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Oryza brachyantha]
Length=524

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCV+ G VG+VGLS +QFTNMN MRNL I G+SLFLG+SIP++F  Y     H
Sbjct  386  FTMFAAIYCVMFGYVGAVGLSFMQFTNMNSMRNLFIIGVSLFLGVSIPEYFFRYTMSALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLI+AV LDNTLEV  + +DRGMPWW +FRTFRGD+
Sbjct  446  GPAHTRAGWFNDYINTIFSSPPTVGLIIAVVLDNTLEVRNTARDRGMPWWARFRTFRGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>dbj|BAJ89924.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=296

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G++ +VGLS LQFTNMN MRNL I G SLFLG+SIP++F++Y +  ++
Sbjct  158  FTIFAAIYCVMFGIIAAVGLSFLQFTNMNSMRNLFIVGFSLFLGLSIPEYFSQYMTGVQN  217

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIF+SPPTV LI+AV LDNTL+V  + KDRGM WW +FRTFRGD+
Sbjct  218  GPAHTKAGWFNDYINTIFASPPTVALIIAVVLDNTLDVRDAAKDRGMQWWERFRTFRGDS  277

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  278  RNEEFYTLPFNLNRFFPPS  296



>ref|XP_010655537.1| PREDICTED: nucleobase-ascorbate transporter 2 isoform X2 [Vitis 
vinifera]
Length=514

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++ FLG+SIP++F EY S   H
Sbjct  376  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSIPEYFREYTSAALH  435

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVA+FLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  436  GPAHTRAGWFNDFLNTIFFSSPTVALIVAIFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  495

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  496  RNEEFYTLPFNLNRFFPPS  514



>dbj|BAD03486.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAD03537.1| putative permease 1 [Oryza sativa Japonica Group]
 gb|EEE68583.1| hypothetical protein OsJ_27086 [Oryza sativa Japonica Group]
Length=524

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCV+ G VG+VGLS +QFTNMN MR+L I G+SLFLGISIP++F  Y     H
Sbjct  386  FTMFAAIYCVMFGYVGAVGLSFMQFTNMNSMRSLFIIGVSLFLGISIPEYFFRYTMSALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INT+FSSPPTVGLIVAV LDNTLEV  + +DRGMPWW +FRTFRGD+
Sbjct  446  GPAHTRAGWFNDYINTVFSSPPTVGLIVAVILDNTLEVRDAARDRGMPWWARFRTFRGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>dbj|BAG95840.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55411.1| hypothetical protein OsJ_03524 [Oryza sativa Japonica Group]
Length=419

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  281  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  340

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLIVAVFLDNTLEV+ + KDRGMPWWV FR+F+GD 
Sbjct  341  GPAHTKAGWFNDYINTIFSSPPTVGLIVAVFLDNTLEVKNAAKDRGMPWWVPFRSFKGDA  400

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  401  RSEEFYSLPFNLNRFFPPS  419



>ref|XP_002265912.2| PREDICTED: nucleobase-ascorbate transporter 2 isoform X1 [Vitis 
vinifera]
 emb|CBI30703.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++ FLG+SIP++F EY S   H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSIPEYFREYTSAALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVA+FLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTRAGWFNDFLNTIFFSSPTVALIVAIFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>emb|CAN66345.1| hypothetical protein VITISV_040228 [Vitis vinifera]
Length=524

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++ FLG+SIP++F EY S   H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSIPEYFREYTSAALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVA+FLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTRAGWFNDFLNTIFFSSPTVALIVAIFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|EYU28101.1| hypothetical protein MIMGU_mgv1a004500mg [Erythranthe guttata]
Length=524

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ GLV SVGLS LQFTNMN MRNL ITG+SLFLG+SIP++F EY +   H
Sbjct  386  FTIFAAVYCVMFGLVASVGLSFLQFTNMNSMRNLFITGVSLFLGLSIPEYFREYTAAALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTVGL+VAVFLDNTLE + S  DRGMPWW KFR F+GD+
Sbjct  446  GPSHTKAGWFNDFLNTIFLSSPTVGLLVAVFLDNTLEYKDSAVDRGMPWWAKFRAFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_004233030.1| PREDICTED: nucleobase-ascorbate transporter 2 [Solanum lycopersicum]
Length=525

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G+SLFLG+SIP++F EY +   H
Sbjct  387  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIAGVSLFLGLSIPEYFREYTTAAFH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIFSS PTV ++VAVFLDNTL+ + S KDRGMPWWVKFRTF+GD+
Sbjct  447  GPSHTKAGWFNDFLNTIFSSSPTVAMMVAVFLDNTLDYKDSAKDRGMPWWVKFRTFKGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_002522228.1| purine permease, putative [Ricinus communis]
 gb|EEF40086.1| purine permease, putative [Ricinus communis]
Length=357

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++ FLG+S+P++F EY ++  H
Sbjct  219  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVAFFLGLSVPEYFREYTAKAFH  278

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  279  GPAHTRAGWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  338

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  339  RNEEFYTLPFNLNRFFPPS  357



>ref|NP_001044313.1| Os01g0759900 [Oryza sativa Japonica Group]
 dbj|BAF06227.1| Os01g0759900, partial [Oryza sativa Japonica Group]
Length=448

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  310  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  369

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLIVAVFLDNTLEV+ + KDRGMPWWV FR+F+GD 
Sbjct  370  GPAHTKAGWFNDYINTIFSSPPTVGLIVAVFLDNTLEVKNAAKDRGMPWWVPFRSFKGDA  429

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  430  RSEEFYSLPFNLNRFFPPS  448



>ref|XP_007159460.1| hypothetical protein PHAVU_002G239500g [Phaseolus vulgaris]
 gb|ESW31454.1| hypothetical protein PHAVU_002G239500g [Phaseolus vulgaris]
Length=524

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCVL G+V SVGLS LQFTNMN MRNL I G+SLFLG+SIP++F EY  +  H
Sbjct  386  FPMFAAVYCVLFGIVASVGLSFLQFTNMNSMRNLFICGVSLFLGLSIPEYFREYTIRAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S PTV LIVAVFLDNTLE + S KDRGMPWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFFSSPTVALIVAVFLDNTLEYKDSAKDRGMPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_009396520.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+PQ+F  Y    +H
Sbjct  388  FTIFAAVYCVLFGLVAAVGLSLLQFTNMNSMRNLFIVGVSIFLGLSVPQYFFRYTLSAQH  447

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN +INTIFSSPPTV LIVAVFLDNTL+ E +  DRGMPWW +FRTF+GD+
Sbjct  448  GPAHTNAGWFNDYINTIFSSPPTVALIVAVFLDNTLDFEDAAADRGMPWWTRFRTFKGDS  507

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFF P+
Sbjct  508  RNEEFYTLPFNLNRFFAPS  526



>ref|XP_003569860.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
Length=524

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +IN IFSSPPTVGLIVAVFLDNTLEV+ + KDRGMPWWV+FR+F+GD 
Sbjct  446  GPAHTKAGWFNDYINAIFSSPPTVGLIVAVFLDNTLEVKDAGKDRGMPWWVQFRSFKGDT  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY+LPFNLNRFFPP+
Sbjct  506  RNEEFYSLPFNLNRFFPPS  524



>ref|XP_009799751.1| PREDICTED: nucleobase-ascorbate transporter 2 [Nicotiana sylvestris]
Length=525

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G+SLFLG+SIP++F EY +   H
Sbjct  387  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIAGVSLFLGLSIPEYFREYTTAAFH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV L+V+VFLDNTLE + S KDRGMPWWVKFRTF+GD+
Sbjct  447  GPAHTKAGWFNDFLNTIFLSSPTVALMVSVFLDNTLEYKDSAKDRGMPWWVKFRTFKGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>gb|ACG43417.1| permease [Zea mays]
Length=525

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G+V +VGLS +QFTNMN MRNL I G+SLFLG+SIP++F+ Y +  + 
Sbjct  387  FTIFAAIYCVMFGIVAAVGLSFMQFTNMNSMRNLFIIGVSLFLGLSIPEYFSRYSTSSQQ  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INT FSSPP V LIVAV LDNTL+V  + +DRGMPWW +FRTFRGD+
Sbjct  447  GPAHTKAGWFNDYINTSFSSPPAVALIVAVLLDNTLDVRDAARDRGMPWWARFRTFRGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  507  RNEEFYTLPFNLNRFFPPT  525



>ref|XP_008667761.1| PREDICTED: uncharacterized protein LOC100279209 isoform X1 [Zea 
mays]
 ref|XP_008667762.1| PREDICTED: uncharacterized protein LOC100279209 isoform X1 [Zea 
mays]
 gb|ACN33500.1| unknown [Zea mays]
 tpg|DAA39901.1| TPA: permease isoform 1 [Zea mays]
 tpg|DAA39902.1| TPA: permease isoform 2 [Zea mays]
Length=525

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G+V +VGLS +QFTNMN MRNL I G+SLFLG+SIP++F+ Y +  + 
Sbjct  387  FTIFAAIYCVMFGIVAAVGLSFMQFTNMNSMRNLFIIGVSLFLGLSIPEYFSRYSTSSQQ  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INT FSSPP V LIVAV LDNTL+V  + +DRGMPWW +FRTFRGD+
Sbjct  447  GPAHTKAGWFNDYINTSFSSPPAVALIVAVLLDNTLDVRDAARDRGMPWWARFRTFRGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPPT
Sbjct  507  RNEEFYTLPFNLNRFFPPT  525



>gb|EAZ08590.1| hypothetical protein OsI_30859 [Oryza sativa Indica Group]
 gb|EAZ44233.1| hypothetical protein OsJ_28847 [Oryza sativa Japonica Group]
Length=525

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G+V +VGLS LQFTNMN MRNL I G+SLFLG+SIP++F+ Y +  + 
Sbjct  387  FPIFAAIYCVMFGIVAAVGLSFLQFTNMNSMRNLFIVGVSLFLGLSIPEYFSRYTTSAQQ  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +IN++FSSPPTV LI+AV LDNTL+V ++ +DRGMPWW +FRTFRGD+
Sbjct  447  GPAHTKAGWFNDYINSVFSSPPTVALIMAVLLDNTLDVREAARDRGMPWWARFRTFRGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>gb|KJB57393.1| hypothetical protein B456_009G161500 [Gossypium raimondii]
 gb|KJB57394.1| hypothetical protein B456_009G161500 [Gossypium raimondii]
Length=475

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG+S+P++F EY ++  H
Sbjct  337  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVALFLGLSVPEYFREYTAKALH  396

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT  GWFN F+NTIF S PTV L+VAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  397  GPAHTRGGWFNDFLNTIFFSSPTVALLVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  456

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  457  RNEEFYTLPFNLNRFFPPS  475



>gb|KEH20676.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=408

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+SIP++F EY  +  H
Sbjct  270  FPIFAAIYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSIPEYFREYTIRALH  329

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LI+AVFLDNTL+ + S KDRGMPWW KFRTF+ D+
Sbjct  330  GPAHTKAGWFNDFLNTIFYSSPTVALIIAVFLDNTLDYKDSAKDRGMPWWAKFRTFKADS  389

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY+LPFNLNRFFPP+
Sbjct  390  RNEEFYSLPFNLNRFFPPS  408



>gb|EEC71519.1| hypothetical protein OsI_03815 [Oryza sativa Indica Group]
Length=497

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  359  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  418

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLIVAVFLDNTLEV+ + KDRGMPWWV FR+F+GD 
Sbjct  419  GPAHTKAGWFNDYINTIFSSPPTVGLIVAVFLDNTLEVKNAAKDRGMPWWVPFRSFKGDA  478

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  479  RSEEFYSLPFNLNRFFPPS  497



>gb|KHN48003.1| Nucleobase-ascorbate transporter 2 [Glycine soja]
Length=524

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCVL G+V SVGLS LQFTNMN MRNL I G+SLFLG+SIP++F EY  +  H
Sbjct  386  FPMFAAVYCVLFGIVASVGLSFLQFTNMNSMRNLFICGVSLFLGLSIPEYFREYTIRAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_009410926.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=525

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V +VGLS LQFTNMN MRNL ITG+S+FLG+SIPQ+F  Y +  RH
Sbjct  387  FTIFAAVYCVLFGIVAAVGLSLLQFTNMNSMRNLFITGVSIFLGLSIPQYFFRYTASARH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN +INTIFSSPPTV LIVAVFLDNTL+ + +  DRGMPWW +FR F+GD 
Sbjct  447  GPAHTKAEWFNDYINTIFSSPPTVALIVAVFLDNTLDFKDTAGDRGMPWWARFRKFKGDG  506

Query  408  RNEEFYTLPFNLNRFFPP  355
            RNEEFYTLPFNLNRFFPP
Sbjct  507  RNEEFYTLPFNLNRFFPP  524



>dbj|BAB61205.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAB92350.1| putative permease 1 [Oryza sativa Japonica Group]
Length=524

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLIVAVFLDNTLEV+ + KDRGMPWWV FR+F+GD 
Sbjct  446  GPAHTKAGWFNDYINTIFSSPPTVGLIVAVFLDNTLEVKNAAKDRGMPWWVPFRSFKGDA  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  506  RSEEFYSLPFNLNRFFPPS  524



>ref|XP_009604294.1| PREDICTED: nucleobase-ascorbate transporter 2 [Nicotiana tomentosiformis]
Length=525

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G+SLFLG+SIP++F EY +   H
Sbjct  387  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIAGVSLFLGLSIPEYFREYTTAAFH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV L+V+VFLDNTL+ + S KDRGMPWWVKFRTF+GD+
Sbjct  447  GPAHTKAGWFNDFLNTIFLSSPTVALMVSVFLDNTLDYKDSAKDRGMPWWVKFRTFKGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_010246467.1| PREDICTED: nucleobase-ascorbate transporter 2 [Nelumbo nucifera]
Length=524

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS LQFTNMN MRNL ITG++ FLG+SIP++F EY +   H
Sbjct  386  FTIFAAVYCVLFGVVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSIPEYFREYTTSSLH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN FINT+FSS PTV LIVAVFLDNTL+ + + KDRGMPWW +FRTF+GD+
Sbjct  446  GPAHTKAAWFNDFINTVFSSSPTVALIVAVFLDNTLDYKDTAKDRGMPWWARFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP 
Sbjct  506  RNEEFYTLPFNLNRFFPPA  524



>ref|XP_007025347.1| Xanthine/uracil permease family protein [Theobroma cacao]
 gb|EOY27969.1| Xanthine/uracil permease family protein [Theobroma cacao]
Length=524

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+S+P++F EY ++  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSVPEYFREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT   WFN F+NTIF S PTV LI+AVFLDNTL+ + S +DRGMPWWVKFRTF+GDN
Sbjct  446  GPAHTRGEWFNDFLNTIFFSSPTVALIIAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDN  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>dbj|BAJ85393.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGL+VAVFLDNTLEV+ + +DRGMPWWV FR+F+GD+
Sbjct  446  GPAHTKAGWFNDYINTIFSSPPTVGLMVAVFLDNTLEVKDAGRDRGMPWWVPFRSFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY+LPFNLNRFFPP+
Sbjct  506  RNEEFYSLPFNLNRFFPPS  524



>dbj|BAJ94155.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGL+VAVFLDNTLEV+ + +DRGMPWWV FR+F+GD+
Sbjct  446  GPAHTKAGWFNDYINTIFSSPPTVGLMVAVFLDNTLEVKDAGRDRGMPWWVPFRSFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY+LPFNLNRFFPP+
Sbjct  506  RNEEFYSLPFNLNRFFPPS  524



>ref|XP_010999757.1| PREDICTED: nucleobase-ascorbate transporter 2 [Populus euphratica]
Length=525

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+ A+YCVL GLV SVGLS LQFTNMN MRNL ITG++ FLG+S+P++F EY S+  H
Sbjct  387  FPIFGAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSVPEYFREYTSKAYH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  447  GPAHTRAGWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_010686222.1| PREDICTED: nucleobase-ascorbate transporter 2 [Beta vulgaris 
subsp. vulgaris]
Length=524

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV  GLVGSVGLS LQFTNMN MRNL I G+S+FLG+SIP +F EY +   H
Sbjct  386  FTIFAAMYCVFFGLVGSVGLSFLQFTNMNSMRNLFIIGVSMFLGLSIPNYFREYSASALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIFSS P V L+VAV LDNTL+ + S KDRGMPWWVKFRTF+GD+
Sbjct  446  GPSHTRAGWFNDFLNTIFSSSPAVALMVAVLLDNTLDYKDSAKDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>emb|CDY52234.1| BnaC04g54110D [Brassica napus]
Length=524

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL ITG+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFITGVSLFLGLSIPEYFRDFSMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS P V L++AVFLDNTL+ ++S KDRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPMVALMIAVFLDNTLDYKESAKDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_002305737.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|EEE86248.1| xanthine/uracil permease family protein [Populus trichocarpa]
Length=525

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+ A+YCVL GLV SVGLS LQFTNMN MRNL ITG++ FLG+S+P++F EY S+  H
Sbjct  387  FPIFGAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSVPEYFREYTSKAYH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  447  GPAHTRAGWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_011039417.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Populus euphratica]
Length=525

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++ FLG+S+P++F EY ++  H
Sbjct  387  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSVPEYFREYTTKAYH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVAVFLDNTL+ ++S +DRGMPWWVKFRTF+GD+
Sbjct  447  GPAHTRAGWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKESARDRGMPWWVKFRTFKGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNL+RFFPP+
Sbjct  507  RNEEFYTLPFNLDRFFPPS  525



>ref|XP_009143796.1| PREDICTED: nucleobase-ascorbate transporter 2 [Brassica rapa]
 emb|CDY67697.1| BnaAnng25020D [Brassica napus]
Length=524

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL ITG+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFITGVSLFLGLSIPEYFRDFSMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS P V L++AVFLDNTL+ ++S KDRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPMVALMIAVFLDNTLDYKESAKDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|AFW85019.1| hypothetical protein ZEAMMB73_943324 [Zea mays]
Length=397

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y      
Sbjct  259  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYTMAAHR  318

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGL+VAVFLDNTLEV+++  DRGMPWW +FRTF+GD+
Sbjct  319  GPAHTKAGWFNDYINTIFSSPPTVGLMVAVFLDNTLEVKQAGMDRGMPWWQRFRTFKGDS  378

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY LPFNLNRFFPP 
Sbjct  379  RNEEFYRLPFNLNRFFPPA  397



>ref|XP_006358126.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Solanum tuberosum]
Length=525

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G+SLFLG+SIP++F EY +   H
Sbjct  387  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIAGVSLFLGLSIPEYFREYTTAAFH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV ++VAVFLDNTL+ + S KDRGMPWWVKFRTF+GD+
Sbjct  447  GPSHTKAGWFNDFLNTIFLSSPTVAMMVAVFLDNTLDYKDSAKDRGMPWWVKFRTFKGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_010089683.1| Nucleobase-ascorbate transporter 2 [Morus notabilis]
 gb|EXB38206.1| Nucleobase-ascorbate transporter 2 [Morus notabilis]
Length=524

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ GLV SVGLS LQFTNMN MRNL ITG++LFLG+SIP++F EY S+  H
Sbjct  386  FTIFAAVYCVMFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSIPEYFREYTSKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S  TV LI+AVFLDNTL+ + S +DRGMPWWVKFR F+GD+
Sbjct  446  GPSHTGAGWFNDFLNTIFFSSSTVALIIAVFLDNTLDYKDSARDRGMPWWVKFRAFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|KJB57395.1| hypothetical protein B456_009G161500 [Gossypium raimondii]
Length=524

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG+S+P++F EY ++  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVALFLGLSVPEYFREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT  GWFN F+NTIF S PTV L+VAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTRGGWFNDFLNTIFFSSPTVALLVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|KDP21113.1| hypothetical protein JCGZ_21584 [Jatropha curcas]
Length=524

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++ FLG+S+P++F EY S+  H
Sbjct  386  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVAFFLGLSVPEYFREYTSKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVAVFLDNTLE + S +DRGMPWW KFR+F+GD+
Sbjct  446  GPAHTRAGWFNDFLNTIFFSSPTVALIVAVFLDNTLEYKNSARDRGMPWWAKFRSFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_009394193.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=525

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            FVI+AA+YCVL G+V +VGLS LQFTNMN MRNL ITG+S+FLG+S+PQ+F +Y S  + 
Sbjct  387  FVIFAAVYCVLFGIVAAVGLSLLQFTNMNSMRNLFITGVSIFLGLSVPQYFFKYTSSAQR  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNA WFN +INTIFSSPPTV LIVAVFLDNTL+V  +  DRGM WW +FR F+GD+
Sbjct  447  GPAHTNAEWFNDYINTIFSSPPTVALIVAVFLDNTLDVSGTAGDRGMAWWARFRKFQGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_002456385.1| hypothetical protein SORBIDRAFT_03g035190 [Sorghum bicolor]
 gb|EES01505.1| hypothetical protein SORBIDRAFT_03g035190 [Sorghum bicolor]
Length=524

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y      
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYTMAAHR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLIVAVFLDNTLE++ + KDRGMPWW++FR F+GD+
Sbjct  446  GPAHTKAGWFNDYINTIFSSPPTVGLIVAVFLDNTLEMKDAGKDRGMPWWLRFRAFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY+LPFNLNRFFPP 
Sbjct  506  RNEEFYSLPFNLNRFFPPA  524



>gb|KCW76101.1| hypothetical protein EUGRSUZ_D00480 [Eucalyptus grandis]
Length=423

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G+SLFLG+S+P++F EY  +  H
Sbjct  285  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVSLFLGLSVPEYFREYTLKALH  344

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW KFRTF+GD+
Sbjct  345  GPSHTRAIWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWAKFRTFKGDS  404

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  405  RNEEFYTLPFNLNRFFPPS  423



>gb|EMS56362.1| Nucleobase-ascorbate transporter 2 [Triticum urartu]
Length=552

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G++ +VGLS LQFTNMN MRNL I G+SLFLG+SIP++F+ Y +  ++
Sbjct  414  FTIFAAIYCVMFGIIAAVGLSFLQFTNMNSMRNLFIVGVSLFLGLSIPEYFSRYLTGAQN  473

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIF+SPPTV LI+AV LDNTL+V  + KDRGM WW +FRTFRGD+
Sbjct  474  GPAHTKAGWFNDYINTIFASPPTVALIIAVVLDNTLDVRDAAKDRGMQWWERFRTFRGDS  533

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  534  RNEEFYTLPFNLNRFFPPS  552



>ref|XP_009351319.1| PREDICTED: nucleobase-ascorbate transporter 2 [Pyrus x bretschneideri]
Length=524

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG+S+P++F  Y  +  H
Sbjct  386  FTIFAAAYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVALFLGLSVPEYFRGYTLKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS PTV L VAVFLDNTLE + S +DRGMPWWVKFR F+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPTVALFVAVFLDNTLEYKDSARDRGMPWWVKFRQFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_007136977.1| hypothetical protein PHAVU_009G089800g [Phaseolus vulgaris]
 gb|ESW08971.1| hypothetical protein PHAVU_009G089800g [Phaseolus vulgaris]
Length=525

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG S+P++F EY S+  H
Sbjct  387  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGFSVPEYFREYTSKALH  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWF+ F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW KFRTF GD+
Sbjct  447  GPTHTRAGWFDDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWAKFRTFNGDS  506

Query  408  RNEEFYTLPFNLNRFFPP  355
            RNEEFYTLPFNLNRFFPP
Sbjct  507  RNEEFYTLPFNLNRFFPP  524



>ref|XP_003629785.1| Nucleobase ascorbate transporter [Medicago truncatula]
 gb|AET04261.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=524

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+SIP++F EY  +  H
Sbjct  386  FPIFAAIYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSIPEYFREYTIRALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LI+AVFLDNTL+ + S KDRGMPWW KFRTF+ D+
Sbjct  446  GPAHTKAGWFNDFLNTIFYSSPTVALIIAVFLDNTLDYKDSAKDRGMPWWAKFRTFKADS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY+LPFNLNRFFPP+
Sbjct  506  RNEEFYSLPFNLNRFFPPS  524



>ref|XP_009352749.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Pyrus x bretschneideri]
Length=524

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA YCVL GLV SVGLS LQFTNMN  RNL I G++ FLG+S+P++F  Y  +  H
Sbjct  386  FTIFAAAYCVLFGLVASVGLSFLQFTNMNSTRNLFIVGVAFFLGLSVPEYFRGYTLKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS PTV LIVAVFLDNTLE + S +DRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPTVALIVAVFLDNTLEYKDSARDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_006644739.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Oryza brachyantha]
Length=524

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLIVAVFLDNTLEV+ + KDRGMPWW  FR+F+GD 
Sbjct  446  GPAHTKAGWFNDYINTIFSSPPTVGLIVAVFLDNTLEVKNAGKDRGMPWWCTFRSFKGDA  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  506  RSEEFYSLPFNLNRFFPPS  524



>gb|AFK48579.1| unknown [Lotus japonicus]
Length=271

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA YCVL GLV SVGLS LQFTNMN +RNL ITG+SLFLG SIP++F EY S+  H
Sbjct  133  FPVFAAAYCVLFGLVASVGLSFLQFTNMNSLRNLFITGVSLFLGFSIPEYFREYTSKALH  192

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT+AGWFN F+NTIF S  TV  I AVFLDNTL+ + S KDRGMPWW KFRTF GD+
Sbjct  193  GPTHTSAGWFNDFLNTIFFSSSTVAFIAAVFLDNTLDYKDSAKDRGMPWWAKFRTFNGDS  252

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNL+RFFPP+
Sbjct  253  RNEEFYTLPFNLHRFFPPS  271



>dbj|BAJ95647.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   192 bits (489),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G++ +VGLS LQFTNMN MRNL I G SLFLG+SIP++F++Y +  ++
Sbjct  387  FTIFAAIYCVMFGIIAAVGLSFLQFTNMNSMRNLFIVGFSLFLGLSIPEYFSQYMTGVQN  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIF+SPPTV LI+AV LDNTL+V  + KDRGM WW +FRTFRGD+
Sbjct  447  GPAHTKAGWFNDYINTIFASPPTVALIIAVVLDNTLDVRDAAKDRGMQWWERFRTFRGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  507  RNEEFYTLPFNLNRFFPPS  525



>ref|XP_004970033.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Setaria italica]
Length=524

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    + 
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYTMAAQR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGLIVAVFLDNTLE + +  DRG+PWWV+FR+F+GD+
Sbjct  446  GPAHTKAGWFNDYINTIFSSPPTVGLIVAVFLDNTLETKDAGNDRGLPWWVRFRSFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY+LPFNLNRFFPP 
Sbjct  506  RNEEFYSLPFNLNRFFPPA  524



>ref|XP_008371490.1| PREDICTED: nucleobase-ascorbate transporter 2 [Malus domestica]
Length=524

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG+S+P++F  Y  +  H
Sbjct  386  FTIFAAAYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVALFLGLSVPEYFRGYTLKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIFSS PTV L VAVFLDNTLE + S +DRGMPWWVKFR F+GD+
Sbjct  446  GPAHTKAGWFNDFLNTIFSSSPTVALFVAVFLDNTLEYKDSARDRGMPWWVKFRQFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_006294014.1| hypothetical protein CARUB_v10023002mg [Capsella rubella]
 gb|EOA26912.1| hypothetical protein CARUB_v10023002mg [Capsella rubella]
Length=524

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL I G+SLFLG+SIP++F ++  Q  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFIVGVSLFLGLSIPEYFRDFTMQALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS P V L+VAVFLDNTL+ + + +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPMVALMVAVFLDNTLDYKDTARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_004293963.1| PREDICTED: nucleobase-ascorbate transporter 2 [Fragaria vesca 
subsp. vesca]
Length=526

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA YCVL G V SVGLS LQFTNMN MRNL I G+SLFLG+S+P++F EY     H
Sbjct  388  FPIFAAAYCVLFGFVASVGLSFLQFTNMNSMRNLFIVGVSLFLGLSVPEYFREYSIMAHH  447

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
               HT AGWFN ++NTIFSS PTV L+VAVFLDNTLE ++S +DRGMPWW KFR F+GD+
Sbjct  448  APAHTKAGWFNDYLNTIFSSSPTVALLVAVFLDNTLEYKESARDRGMPWWAKFRAFKGDS  507

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  508  RNEEFYTLPFNLNRFFPPS  526



>ref|XP_010052181.1| PREDICTED: nucleobase-ascorbate transporter 2 [Eucalyptus grandis]
 gb|KCW76100.1| hypothetical protein EUGRSUZ_D00480 [Eucalyptus grandis]
Length=524

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G+SLFLG+S+P++F EY  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVSLFLGLSVPEYFREYTLKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW KFRTF+GD+
Sbjct  446  GPSHTRAIWFNDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|NP_001152037.1| solute carrier family 23 member 2 [Zea mays]
 gb|ACG45503.1| solute carrier family 23 member 2 [Zea mays]
 gb|AFW85023.1| solute carrier family 23 member 2 [Zea mays]
Length=524

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y      
Sbjct  386  FTIFAAVYCVLFGLVAAVGLSFLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYTMAAHR  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTVGL+VAVFLDNTLEV+++  DRGMPWW +FRTF+GD+
Sbjct  446  GPAHTKAGWFNDYINTIFSSPPTVGLMVAVFLDNTLEVKQAGMDRGMPWWQRFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY LPFNLNRFFPP 
Sbjct  506  RNEEFYRLPFNLNRFFPPA  524



>gb|KHG19625.1| Nucleobase-ascorbate transporter 2 -like protein [Gossypium arboreum]
Length=524

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG+S+P +F EY ++  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVALFLGLSVPDYFREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT   WFN F+NTIF S PTV L+VAVFLDNTL+ + S +DRGMPWWVKFRTF+GD+
Sbjct  446  GPAHTRGSWFNDFLNTIFFSSPTVALLVAVFLDNTLDYKDSARDRGMPWWVKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_006410561.1| hypothetical protein EUTSA_v10016514mg [Eutrema salsugineum]
 gb|ESQ52014.1| hypothetical protein EUTSA_v10016514mg [Eutrema salsugineum]
Length=524

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL ITG+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFITGVSLFLGLSIPEYFRDFSVKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S P V L++AVFLDNTL+ + S KDRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFLSSPMVALMIAVFLDNTLDYKDSAKDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_010413769.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Camelina 
sativa]
Length=524

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL I G+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFIVGVSLFLGLSIPEYFRDFTMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS P V L+VAVFLDNTL+ +++ +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPMVALMVAVFLDNTLDYKETARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_010469386.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X1 
[Camelina sativa]
 ref|XP_010469387.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X2 
[Camelina sativa]
Length=524

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL I G+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFIVGVSLFLGLSIPEYFRDFTMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS P V L+VAVFLDNTL+ +++ +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPMVALMVAVFLDNTLDYKETARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_004973341.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X1 
[Setaria italica]
 ref|XP_004973342.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X2 
[Setaria italica]
Length=526

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCVL G VG+VGLS +QFTNMN MRNL I G+SLFLGISIP++F ++    +H
Sbjct  388  FTLFAAIYCVLFGYVGAVGLSFMQFTNMNSMRNLFIIGISLFLGISIPEYFFQFTISAQH  447

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
               HT AGWFN  INTIFSSPPTVG I++V LDNTLEV    KDRGMPWW +FRTFRGD+
Sbjct  448  SPAHTRAGWFNDLINTIFSSPPTVGFIISVILDNTLEVRNRAKDRGMPWWARFRTFRGDS  507

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY LPFNLNRFFPP+
Sbjct  508  RNEEFYNLPFNLNRFFPPS  526



>ref|XP_010540521.1| PREDICTED: nucleobase-ascorbate transporter 2 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA++CV+ GLVGSVGLS LQFTNMN MRNL I G+SLFLG+SIP +F E+ ++  H
Sbjct  417  FTIFAAVHCVMFGLVGSVGLSFLQFTNMNSMRNLFIVGVSLFLGLSIPDYFREFTAKSFH  476

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S PTV LI AVFLDNTLE + S +DRG+PWW KFRTF+GD+
Sbjct  477  GPAHTNAGWFNDFLNTIFFSSPTVALITAVFLDNTLEYKHSARDRGLPWWAKFRTFKGDS  536

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  537  RNEEFYTLPFNLNRFFPPS  555



>ref|XP_010540522.1| PREDICTED: nucleobase-ascorbate transporter 2 isoform X2 [Tarenaya 
hassleriana]
Length=524

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA++CV+ GLVGSVGLS LQFTNMN MRNL I G+SLFLG+SIP +F E+ ++  H
Sbjct  386  FTIFAAVHCVMFGLVGSVGLSFLQFTNMNSMRNLFIVGVSLFLGLSIPDYFREFTAKSFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S PTV LI AVFLDNTLE + S +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFFSSPTVALITAVFLDNTLEYKHSARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|KHN07045.1| Nucleobase-ascorbate transporter 2 [Glycine soja]
Length=544

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG S+P++F EY S+  H
Sbjct  406  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFILGVALFLGFSVPEYFREYTSKALH  465

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWF+ F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW KFRTF GD+
Sbjct  466  GPTHTRAGWFDDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWAKFRTFNGDS  525

Query  408  RNEEFYTLPFNLNRFFPP  355
            RNEEFYTLPFNLNRFFPP
Sbjct  526  RNEEFYTLPFNLNRFFPP  543



>ref|XP_003526259.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Glycine max]
Length=524

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG S+P++F EY S+  H
Sbjct  386  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFILGVALFLGFSVPEYFREYTSKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWF+ F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW KFRTF GD+
Sbjct  446  GPTHTRAGWFDDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWAKFRTFNGDS  505

Query  408  RNEEFYTLPFNLNRFFPP  355
            RNEEFYTLPFNLNRFFPP
Sbjct  506  RNEEFYTLPFNLNRFFPP  523



>ref|XP_010509786.1| PREDICTED: nucleobase-ascorbate transporter 2 [Camelina sativa]
Length=524

 Score =   190 bits (483),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL I G+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFIVGVSLFLGLSIPEYFRDFTMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS P V L+VAVFLDNTL+ + + +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPMVALMVAVFLDNTLDYKDTARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_003522486.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Glycine max]
Length=524

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG S+P++F EY S+  H
Sbjct  386  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFIVGVALFLGFSVPEYFREYTSKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWF+ F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW +FRTF GD+
Sbjct  446  GPTHTRAGWFDDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWARFRTFNGDS  505

Query  408  RNEEFYTLPFNLNRFFPP  355
            RNEEFYTLPFNLNRFFPP
Sbjct  506  RNEEFYTLPFNLNRFFPP  523



>ref|XP_008349204.1| PREDICTED: LOW QUALITY PROTEIN: nucleobase-ascorbate transporter 
2-like [Malus domestica]
Length=524

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA YCVL GLV SVGLS LQFTNMN  RNL I G++ FLG+S+P++F  Y  +  H
Sbjct  386  FTLFAAAYCVLFGLVASVGLSFLQFTNMNSTRNLFIVGVAFFLGLSVPEYFRGYTLKAFH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIFSS PTV LIVAVFLDNTLE + S +DRGMPWWVKFR F+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFSSSPTVALIVAVFLDNTLEYKDSARDRGMPWWVKFRQFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|KHN29605.1| Nucleobase-ascorbate transporter 2 [Glycine soja]
Length=511

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL I G++LFLG S+P++F EY S+  H
Sbjct  373  FPIFAAVYCVLFGLVASVGLSFLQFTNMNSMRNLFILGVALFLGFSVPEYFREYTSKALH  432

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWF+ F+NTIF S PTV LIVAVFLDNTL+ + S KDRGMPWW +FRTF GD+
Sbjct  433  GPTHTRAGWFDDFLNTIFFSSPTVALIVAVFLDNTLDYKDSAKDRGMPWWARFRTFNGDS  492

Query  408  RNEEFYTLPFNLNRFFPP  355
            RNEEFYTLPFNLNRFFPP
Sbjct  493  RNEEFYTLPFNLNRFFPP  510



>ref|XP_003577983.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
 ref|XP_010238058.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
 ref|XP_010238059.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
Length=525

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G+V +VGLS LQFTNMN MRNL I G+SLFLG+SIP++F+ Y + G+ 
Sbjct  387  FGIFAAIYCVMFGIVAAVGLSFLQFTNMNSMRNLFIVGVSLFLGLSIPEYFSRYLASGQQ  446

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN +INTIFSSPPTV LI AV LDNTL+V  + KDRGM WW +FRTF GD+
Sbjct  447  GPAHTKAEWFNDYINTIFSSPPTVALIFAVLLDNTLDVRDAAKDRGMQWWARFRTFGGDS  506

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RN+EFYTLPFNLNRFFPP+
Sbjct  507  RNKEFYTLPFNLNRFFPPS  525



>ref|XP_003574409.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
Length=524

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCV+ G VG+VGLS +QFTNMN MR+L I G+SLFLG+SIP++F  Y    + 
Sbjct  386  FTIFAAIYCVMFGYVGAVGLSFMQFTNMNSMRSLFIIGISLFLGMSIPEYFFRYTMSSQQ  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN +INTIFSSPPTV LI+AV LDNTLEV  + +DRGM WW +FRTFRGD+
Sbjct  446  GPAHTRAGWFNDYINTIFSSPPTVALIIAVALDNTLEVRDAARDRGMQWWERFRTFRGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_009394827.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V +VGLS LQFTNMN MRNL I G+S+FLG+S+P++F  Y    +H
Sbjct  386  FTIFAAVYCVLFGVVAAVGLSLLQFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYTMSAQH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN ++NTIFSSPPTV LIVAVFLDNTL+ + + KDRGMPWW +FRTF GD+
Sbjct  446  GPAHTKASWFNDYMNTIFSSPPTVALIVAVFLDNTLDFKDTGKDRGMPWWARFRTFNGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFYTLPFNL+RFFPP+
Sbjct  506  RSEEFYTLPFNLDRFFPPS  524



>ref|NP_180966.1| nucleobase-ascorbate transporter 2 [Arabidopsis thaliana]
 sp|Q94C70.2|NAT2_ARATH RecName: Full=Nucleobase-ascorbate transporter 2; Short=AtNAT2 
[Arabidopsis thaliana]
 gb|AAC27395.1| putative membrane transporter [Arabidopsis thaliana]
 gb|AAN13099.1| putative membrane transporter [Arabidopsis thaliana]
 gb|AEC08934.1| nucleobase-ascorbate transporter 2 [Arabidopsis thaliana]
Length=524

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL I G+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFIVGVSLFLGLSIPEYFRDFSMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S P V L+VAVFLDNTL+ +++ +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFLSSPMVALMVAVFLDNTLDYKETARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_004485911.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Cicer arietinum]
Length=524

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG SIP++F EY ++  H
Sbjct  386  FPIFAAMYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGFSIPEYFREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT+A WFN F+NTIF S  TV  IVAVFLDNTL+ + S KDRGMPWWVKFRTF GD 
Sbjct  446  GPTHTSARWFNDFLNTIFFSSSTVAFIVAVFLDNTLDYKDSSKDRGMPWWVKFRTFNGDT  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|AAK59632.1| putative membrane transporter protein [Arabidopsis thaliana]
Length=524

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL I G+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFIVGVSLFLGLSIPEYFRDFSMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S P V L+VAVFLDNTL+ +++ +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFLSSPMVALMVAVFLDNTLDYKETARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>ref|XP_002879482.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55741.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=524

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV S+GLS LQFTNMN +RNL I G+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASIGLSFLQFTNMNSLRNLFIVGVSLFLGLSIPEYFRDFSMKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S P V L+VAVFLDNTL+ +++ +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFLSSPMVALMVAVFLDNTLDYKETARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|KFK36325.1| hypothetical protein AALP_AA4G108100 [Arabis alpina]
Length=524

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN +RNL ITG+SLFLG+SIP++F ++  +  H
Sbjct  386  FTIFAAVYCVLFGLVASVGLSFLQFTNMNSLRNLFITGVSLFLGLSIPEYFRDFAVKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HTNAGWFN F+NTIF S P V L+++VFLDNTL+ + + +DRG+PWW KFRTF+GD+
Sbjct  446  GPAHTNAGWFNDFLNTIFLSSPMVALMISVFLDNTLDYKDTARDRGLPWWAKFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNLNRFFPP+
Sbjct  506  RNEEFYTLPFNLNRFFPPS  524



>gb|ACD56652.1| putative permease [Gossypioides kirkii]
Length=524

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS LQFTNMN MRNL I G+++FLG+S+P++F EY ++  H
Sbjct  386  FTIFAAVYCVLFGIVASVGLSFLQFTNMNSMRNLFIVGVAMFLGLSVPEYFREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LIVA+ LDNTL+ + S +DRGMPWW  FRTF+GD+
Sbjct  446  GPAHTRAGWFNDFLNTIFFSSPTVALIVAILLDNTLDYKDSARDRGMPWWANFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  506  RSEEFYSLPFNLNRFFPPS  524



>gb|EMT06104.1| Nucleobase-ascorbate transporter 2 [Aegilops tauschii]
Length=478

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -2

Query  699  QFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGLVHTNAGWFNAFINTIFSSPPT  520
            QFTNMN MRNL I G+S+FLG+S+P++F  Y    + G  HT AGWFN +INTIFSSPPT
Sbjct  363  QFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQRGPAHTKAGWFNDYINTIFSSPPT  422

Query  519  VGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRNEEFYTLPFNLNRFFPPT  352
            VGL+VAVFLDNTLEV+ + +DRGMPWWV FR+F+GD+RNEEFY+LPFNLNRFFPP+
Sbjct  423  VGLMVAVFLDNTLEVKDAGRDRGMPWWVPFRSFKGDSRNEEFYSLPFNLNRFFPPS  478



>ref|XP_008678172.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Zea mays]
 gb|AFW60917.1| hypothetical protein ZEAMMB73_515028 [Zea mays]
Length=522

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 111/139 (80%), Gaps = 4/139 (3%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCVL G VG+VGLS +QFTNMN MRNL I G SLFLGISIP++F  Y     H
Sbjct  388  FTVFAAIYCVLFGYVGAVGLSFMQFTNMNSMRNLFIIGTSLFLGISIPEYFFHY----DH  443

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN  INTIFSSPPTVG I++V LDNTL+V    KDRGMPWW +FRTFRGD+
Sbjct  444  GPSHTRAGWFNDLINTIFSSPPTVGFIISVVLDNTLDVRNRAKDRGMPWWARFRTFRGDS  503

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY LPFNLNRFFPP+
Sbjct  504  RNEEFYNLPFNLNRFFPPS  522



>gb|EMS45947.1| Nucleobase-ascorbate transporter 2 [Triticum urartu]
Length=484

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -2

Query  699  QFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGLVHTNAGWFNAFINTIFSSPPT  520
            QFTNMN MRNL I G+S+FLG+S+P++F  Y    + G  HT AGWFN +INTIFSSPPT
Sbjct  369  QFTNMNSMRNLFIVGVSIFLGLSVPEYFFRYSMAAQRGPAHTKAGWFNDYINTIFSSPPT  428

Query  519  VGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRNEEFYTLPFNLNRFFPPT  352
            VGL+VAVFLDNTLEV+ + +DRGMPWWV FR+F+GD+RNEEFY+LPFNLNRFFPP+
Sbjct  429  VGLMVAVFLDNTLEVKDAGRDRGMPWWVPFRSFKGDSRNEEFYSLPFNLNRFFPPS  484



>gb|ACD56666.1| putative permease [Gossypium arboreum]
Length=493

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS +QFTNMN MRNL I G++LFLG+S+P+++ EY ++  H
Sbjct  355  FTIFAAVYCVLFGIVASVGLSFMQFTNMNSMRNLFIIGVALFLGLSVPEYYREYTAKALH  414

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAV LDNTL+ + S +DRGMPWW  FRTF+GD+
Sbjct  415  GPAHTRAVWFNDFLNTIFFSSPTVALIVAVLLDNTLDYKDSARDRGMPWWANFRTFKGDS  474

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  475  RSEEFYSLPFNLNRFFPPS  493



>gb|KEH36620.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=524

 Score =   184 bits (468),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MR+L ITG+SLFLG+SIP++F E+ S+  H
Sbjct  386  FPIFAAMYCVLFGLVASVGLSFLQFTNMNSMRSLFITGVSLFLGLSIPEYFREFTSKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S  TV  IVAVFLDNTL+ + S KDRGMPWW KFRTF GD 
Sbjct  446  GPAHTKARWFNDFLNTIFFSSSTVAFIVAVFLDNTLDYKNSSKDRGMPWWTKFRTFNGDT  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFYTLPFNL+RFFPP+
Sbjct  506  RNEEFYTLPFNLHRFFPPS  524



>gb|AAT64019.1| putative permease [Gossypium hirsutum]
Length=524

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS +QFTNMN MRNL I G++LFLG+S+P+++ EY ++  H
Sbjct  386  FTIFAAVYCVLFGIVASVGLSFMQFTNMNSMRNLFIIGVALFLGLSVPEYYREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAV LDNTL+ + S +DRGMPWW  FRTF+GD+
Sbjct  446  GPAHTRAVWFNDFLNTIFFSSPTVALIVAVLLDNTLDYKDSARDRGMPWWANFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  506  RSEEFYSLPFNLNRFFPPS  524



>gb|KHG23953.1| Nucleobase-ascorbate transporter 2 -like protein [Gossypium arboreum]
Length=524

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS +QFTNMN MRNL I G++LFLG+S+P+++ EY ++  H
Sbjct  386  FTIFAAVYCVLFGIVASVGLSFMQFTNMNSMRNLFIIGVALFLGLSVPEYYREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAV LDNTL+ + S +DRGMPWW  FRTF+GD+
Sbjct  446  GPAHTRAVWFNDFLNTIFFSSPTVALIVAVLLDNTLDYKDSARDRGMPWWANFRTFKGDS  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  506  RSEEFYSLPFNLNRFFPPS  524



>ref|XP_002445381.1| hypothetical protein SORBIDRAFT_07g014930 [Sorghum bicolor]
 gb|EES14876.1| hypothetical protein SORBIDRAFT_07g014930 [Sorghum bicolor]
Length=526

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCVL G VG+VGLS +QF NMN MR+L I G+SLFLGISIP++F  +    +H
Sbjct  388  FTLFAAIYCVLFGYVGAVGLSFMQFINMNSMRSLFIIGMSLFLGISIPEYFFRFTMGNQH  447

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN  INTIFSSPPT G I++V LDNTL+V    KDRGMPWW +FRTFRGD+
Sbjct  448  GPSHTRAGWFNDLINTIFSSPPTTGFIISVVLDNTLDVRNRAKDRGMPWWARFRTFRGDS  507

Query  408  RNEEFYTLPFNLNRFFPPT  352
            RNEEFY LPFNLNRFFPP+
Sbjct  508  RNEEFYNLPFNLNRFFPPS  526



>gb|KJB69715.1| hypothetical protein B456_011G038600 [Gossypium raimondii]
Length=520

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS +QFTNMN MRNL I G+++FLG+S+P+++ EY ++  H
Sbjct  382  FTIFAAVYCVLFGIVASVGLSFMQFTNMNSMRNLFIIGVAMFLGLSVPEYYREYTAKALH  441

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAV LDNTL+ + S +DRGMPWW  FRTF+GD 
Sbjct  442  GPAHTRAVWFNDFLNTIFFSSPTVALIVAVLLDNTLDYKDSARDRGMPWWANFRTFKGDG  501

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  502  RSEEFYSLPFNLNRFFPPS  520



>gb|KJB69714.1| hypothetical protein B456_011G038600 [Gossypium raimondii]
Length=524

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS +QFTNMN MRNL I G+++FLG+S+P+++ EY ++  H
Sbjct  386  FTIFAAVYCVLFGIVASVGLSFMQFTNMNSMRNLFIIGVAMFLGLSVPEYYREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAV LDNTL+ + S +DRGMPWW  FRTF+GD 
Sbjct  446  GPAHTRAVWFNDFLNTIFFSSPTVALIVAVLLDNTLDYKDSARDRGMPWWANFRTFKGDG  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  506  RSEEFYSLPFNLNRFFPPS  524



>gb|AAT64034.1| putative permease [Gossypium hirsutum]
Length=524

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL G+V SVGLS +QFTNMN MRNL I G+++FLG+S+P+++ EY ++  H
Sbjct  386  FTIFAAVYCVLFGIVASVGLSFMQFTNMNSMRNLFIIGVAMFLGLSVPEYYREYTAKALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT A WFN F+NTIF S PTV LIVAV LDNTL+ + S +DRGMPWW  FRTF+GD 
Sbjct  446  GPAHTRAVWFNDFLNTIFFSSPTVALIVAVLLDNTLDYKDSARDRGMPWWANFRTFKGDG  505

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R+EEFY+LPFNLNRFFPP+
Sbjct  506  RSEEFYSLPFNLNRFFPPS  524



>ref|XP_004981566.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Setaria italica]
Length=551

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCVL G VG VGLS +QFTNMN MRNL I G SLFLG SIP++F+++     H
Sbjct  413  FALFAAIYCVLFGYVGGVGLSFMQFTNMNSMRNLFIIGTSLFLGFSIPEYFSQFTMSSHH  472

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN  INTIFSS PTVG I++V LDNTL+VEK  +D GM WW +FR+F GD+
Sbjct  473  GPAHTRAGWFNDLINTIFSSRPTVGFIISVVLDNTLDVEKKAEDSGMSWWARFRSFGGDS  532

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R  EFY LPFNL+RFFPP+
Sbjct  533  RTLEFYNLPFNLDRFFPPS  551



>ref|XP_004504292.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Cicer arietinum]
Length=522

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 2/139 (1%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I+AA+YCVL GLV SVGLS LQFTNMN MRNL ITG++LFLG+SIP++F EY  +  H
Sbjct  386  FPIFAAIYCVLFGLVASVGLSFLQFTNMNSMRNLFITGVALFLGLSIPEYFREYTIRALH  445

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G  HT AGWFN F+NTIF S PTV LI+AVFLDNTL+ + S KDRGMPWW K        
Sbjct  446  GPAHTKAGWFNDFLNTIFYSSPTVALIIAVFLDNTLDYKDSAKDRGMPWWAKXXXXX--X  503

Query  408  RNEEFYTLPFNLNRFFPPT  352
             NEEFY+LPFNLNRFFPP+
Sbjct  504  XNEEFYSLPFNLNRFFPPS  522



>ref|XP_002441746.1| hypothetical protein SORBIDRAFT_08g001650 [Sorghum bicolor]
 gb|EES15584.1| hypothetical protein SORBIDRAFT_08g001650 [Sorghum bicolor]
Length=527

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F ++AA+YCVL G VG+VGLS +QFTNMN  RNL + G+SL+LGISIP +F+++ +  + 
Sbjct  389  FTLFAAMYCVLFGYVGAVGLSFMQFTNMNSTRNLFVLGVSLYLGISIPNYFHQFTTSYQR  448

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
               HT AGWFN  INT+FSSP TVG IV++ LDNTL V    +DRGMPWW +FRTFRGD+
Sbjct  449  EPAHTRAGWFNDLINTVFSSPATVGFIVSMVLDNTLRVRNGDRDRGMPWWARFRTFRGDS  508

Query  408  RNEEFYTLPFNLNRFFPPT  352
            R  EFY LPF+LNRFFP +
Sbjct  509  RTVEFYNLPFSLNRFFPAS  527



>ref|XP_006852960.1| hypothetical protein AMTR_s00033p00243580 [Amborella trichopoda]
 gb|ERN14427.1| hypothetical protein AMTR_s00033p00243580 [Amborella trichopoda]
Length=536

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F IYAA+YCVL G V + G+S +QFTN N MRN+ I GLSLFLGIS+PQ+FNE+ +   H
Sbjct  396  FPIYAAMYCVLFGFVAASGVSFIQFTNNNSMRNMYILGLSLFLGISVPQYFNEFSASAGH  455

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G V TNA WFN  +NTIFSS PTV L+VA  +DNTL++  S +DRG+PWW+ F+  +GD 
Sbjct  456  GPVKTNASWFNDILNTIFSSGPTVALMVATLVDNTLDMVNSCRDRGVPWWLPFQCKKGDM  515

Query  408  RNEEFYTLPFNLNRFFP  358
            RNEEFY LP N+    P
Sbjct  516  RNEEFYRLPLNVKEMIP  532



>ref|XP_010255123.1| PREDICTED: nucleobase-ascorbate transporter 3 [Nelumbo nucifera]
Length=545

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -2

Query  768  FVIYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRH  589
            F I++A+YCVL GL+ +VG+S +QFTN N MRNL I GLSLFLGISIP++F EY S   H
Sbjct  405  FPIFSAIYCVLFGLIAAVGISFIQFTNNNSMRNLYILGLSLFLGISIPRYFIEYSSSAGH  464

Query  588  GLVHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDN  409
            G V T+ GWFN   N+IF+S PTV ++V   LDNTL+  ++  DRG+PWWV F+  +GD 
Sbjct  465  GPVKTSGGWFNDIWNSIFTSAPTVAMLVGTLLDNTLDAMRTADDRGLPWWVPFQMRKGDM  524

Query  408  RNEEFYTLPFNLNRFFP  358
            RNEEFY LP  ++ F P
Sbjct  525  RNEEFYNLPLRIHEFVP  541



>ref|XP_011083792.1| PREDICTED: nucleobase-ascorbate transporter 3 [Sesamum indicum]
Length=549

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+L G+V ++G+S +QFTN N MRN+ + G+SLFLGISIPQ+F        HG 
Sbjct  411  IFAAIYCILYGIVAAIGISFVQFTNNNSMRNIYVLGVSLFLGISIPQYFIMNTDVAGHGP  470

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V TN GWFN  +NTIFSSPPTV LIV   LDNTLE   +  DRG+PW V F+  +GD+RN
Sbjct  471  VRTNGGWFNDILNTIFSSPPTVALIVGTILDNTLEARHTVDDRGLPWLVPFQRRKGDSRN  530

Query  402  EEFYTLPFNLNRFFP  358
            EEFY+ P  +N + P
Sbjct  531  EEFYSFPLRINEYIP  545



>gb|AAL76261.1|AF466824_1 putative permease 1 [Arabidopsis thaliana]
Length=216

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  78   IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  137

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  138  VHTGARWFNDMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  197

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  198  RSEEFYSLPFNLNKYFP  214



>ref|XP_009417550.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=534

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+    VG+ GLS LQF N+N  R   I GLS+F+G+S+PQ+FNEY S   +G 
Sbjct  396  IFAALYCLFFAYVGAAGLSFLQFCNLNSFRTKFILGLSVFMGLSVPQYFNEYTSVAGYGP  455

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEV--EKSKKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN IFSS P V  +VA FLDNTL    E ++KDRG  WW KFR F+ D 
Sbjct  456  VHTKARWFNDIINVIFSSKPFVAGLVAFFLDNTLHRHNEATRKDRGYHWWKKFRNFKADM  515

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  516  RSEEFYSLPFNLNKFFP  532



>gb|ABO30057.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30070.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30078.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30084.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
Length=151

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCV    VGS GL  LQF N+N  R   I G S+F+G S+PQ+FNEY S    G 
Sbjct  13   IFAALYCVFFAYVGSAGLVFLQFCNLNSFRTKFILGFSVFMGFSVPQYFNEYTSVAGFGP  72

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N +FSS   VG IVA  LDNTL       +KDRG  WW KFR++R D 
Sbjct  73   VHTRARWFNDMVNVLFSSKAFVGGIVAYVLDNTLHRHDGAVRKDRGYHWWDKFRSYRTDT  132

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  133  RSEEFYSLPFNLNKFFP  149



>gb|ABO30069.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
Length=151

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 91/137 (66%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCV    V S GL  LQF N+N  R   I G S+F+G S+PQ+FNEY S    G 
Sbjct  13   IFAALYCVFFAYVXSAGLGFLQFCNLNSFRTKFILGFSVFMGFSVPQYFNEYTSVAGFGP  72

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N +FSS   VG IVA  LDNTL       +KDRG  WW KFR++R D 
Sbjct  73   VHTRARWFNDMVNVLFSSKAFVGGIVAYVLDNTLHRHDGAVRKDRGYHWWDKFRSYRTDT  132

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  133  RSEEFYSLPFNLNKFFP  149



>gb|ABO30011.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30012.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30013.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30014.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30015.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30016.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30017.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30018.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30019.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30020.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30021.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30022.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30023.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30024.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30025.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30026.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30027.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30028.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30029.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30030.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30031.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccoides]
 gb|ABO30032.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30033.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30034.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30035.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30036.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30037.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30038.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30039.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30040.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30041.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30042.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30043.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30044.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30045.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30046.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30047.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30048.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30049.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30050.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30051.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30052.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30053.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30054.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30055.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30056.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30058.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30059.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30060.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30061.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30062.1| xanthine/uracil/vitamin C permease, partial [Triticum dicoccon]
 gb|ABO30063.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30064.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30065.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30066.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30067.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30068.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30071.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30072.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30073.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30074.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30075.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30076.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30077.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30079.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30080.1| xanthine/uracil/vitamin C permease, partial [Triticum turgidum 
subsp. durum]
 gb|ABO30081.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30082.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30083.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30085.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
 gb|ABO30086.1| xanthine/uracil/vitamin C permease, partial [Triticum aestivum]
Length=151

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 92/137 (67%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCV    VGS GL  LQF N+N  R   I G S+F+G S+PQ+FNEY S    G 
Sbjct  13   IFAALYCVFFAYVGSAGLGFLQFCNLNSFRTKFILGFSVFMGFSVPQYFNEYTSVAGFGP  72

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N +FSS   VG IVA  LDNTL       +KDRG  WW KFR++R D 
Sbjct  73   VHTRARWFNDMVNVLFSSKAFVGGIVAYVLDNTLHRHDGAVRKDRGYHWWDKFRSYRTDT  132

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  133  RSEEFYSLPFNLNKFFP  149



>ref|XP_009391237.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391238.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=535

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+    VG+ GLS LQF N+N  R   I GLS+F+G+S+PQ+FNEY S   +G 
Sbjct  397  IFAALYCLFFAYVGAAGLSFLQFCNLNSFRTKFILGLSVFMGLSVPQYFNEYTSVAGYGP  456

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEV--EKSKKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN IFSS P V  +VA FLDNTL    + +K+DRG  WW +FR+F+ D 
Sbjct  457  VHTKARWFNDIINVIFSSKPFVAGLVAFFLDNTLHRHHDATKRDRGYHWWKRFRSFKADT  516

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY LPFNLN+FFP
Sbjct  517  RSEEFYALPFNLNKFFP  533



>ref|NP_001141421.1| uncharacterized protein LOC100273531 [Zea mays]
 gb|ACF86349.1| unknown [Zea mays]
 gb|ACG30077.1| permease [Zea mays]
 tpg|DAA49132.1| TPA: permease [Zea mays]
Length=533

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+L   +G+ GLS LQF N+N  R   I G SLF+G+S+PQ+FNEY S   +G 
Sbjct  395  IFAALYCILFAYIGACGLSFLQFCNLNSFRTKFIMGFSLFMGLSVPQYFNEYTSVAGYGP  454

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V ++VA  LDNT++V  S  ++DRG  WW KFR+F+ D+
Sbjct  455  VHTGARWFNDMINVPFSSKPFVAVLVAFLLDNTIQVRDSGVRRDRGYHWWDKFRSFKTDS  514

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  515  RSEEFYSLPFNLNKFFP  531



>gb|KDO84353.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
 gb|KDO84354.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
 gb|KDO84355.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
Length=543

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V +VG++ +QF N N MRN+ I GLSLFLGISIPQ+F    ++  HG 
Sbjct  405  IFAAIYCVLLGIVAAVGITFIQFANNNSMRNIYILGLSLFLGISIPQYFASKTTEDGHGP  464

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T  GWFN   NTIFSSPPTV +IV   LDNTL+   +  DRG+PWW  F+  +GD+RN
Sbjct  465  VRTGGGWFNDIWNTIFSSPPTVAMIVGTVLDNTLDARDTVADRGLPWWKPFQHRKGDSRN  524

Query  402  EEFYTLPFNLNRFFP  358
            +EFY+ P  +N + P
Sbjct  525  DEFYSFPLRINEYIP  539



>ref|XP_006434867.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 ref|XP_006434868.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 ref|XP_006434869.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 gb|ESR48107.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 gb|ESR48108.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 gb|ESR48109.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
Length=543

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V +VG++ +QF N N MRN+ I GLSLFLGISIPQ+F    ++  HG 
Sbjct  405  IFAAIYCVLLGIVAAVGITFIQFANNNSMRNIYILGLSLFLGISIPQYFASKTTEDGHGP  464

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T  GWFN   NTIFSSPPTV +IV   LDNTL+   +  DRG+PWW  F+  +GD+RN
Sbjct  465  VRTGGGWFNDIWNTIFSSPPTVAMIVGTVLDNTLDARDTVADRGLPWWKPFQHRKGDSRN  524

Query  402  EEFYTLPFNLNRFFP  358
            +EFY+ P  +N + P
Sbjct  525  DEFYSFPLRINEYIP  539



>ref|XP_006473388.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006473389.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X2 
[Citrus sinensis]
 ref|XP_006473390.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X3 
[Citrus sinensis]
 ref|XP_006473391.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X4 
[Citrus sinensis]
Length=543

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V +VG++ +QF N N MRN+ I GLSLFLGISIPQ+F    ++  HG 
Sbjct  405  IFAAIYCVLLGIVAAVGITFIQFANNNSMRNIYILGLSLFLGISIPQYFASKTTEDGHGP  464

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T  GWFN   NTIFSSPPTV +IV   LDNTL+   +  DRG+PWW  F+  +GD+RN
Sbjct  465  VRTGGGWFNDIWNTIFSSPPTVAMIVGTVLDNTLDARDTVADRGLPWWKPFQHRKGDSRN  524

Query  402  EEFYTLPFNLNRFFP  358
            +EFY+ P  +N + P
Sbjct  525  DEFYSFPLRINEYIP  539



>ref|XP_010928566.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=531

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+F+G+S+PQ+FNEY S   +G 
Sbjct  393  IIAALYCLFFAYVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGP  452

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN IFSS P V   VA FLDNTL    S  KKDRG  WW KFR+F+ DN
Sbjct  453  VHTQARWFNDIINVIFSSKPFVAGFVAFFLDNTLHRHDSAVKKDRGYHWWDKFRSFKTDN  512

Query  408  RNEEFYTLPFNLNRFFP  358
            R++EFY+LPFNLN+FFP
Sbjct  513  RSDEFYSLPFNLNKFFP  529



>gb|EYU25379.1| hypothetical protein MIMGU_mgv1a004067mg [Erythranthe guttata]
Length=546

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+L G+V ++G+S +QFTN N MRN+ I G+SLFLGISIPQ+F        HG 
Sbjct  408  IFAAIYCILYGIVAAIGISFIQFTNNNSMRNIYILGISLFLGISIPQYFITNTDGAGHGP  467

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V TN GWFN  +NTIFSSPPTV L V   LDNTLE   + ++RG+PW + F   +GD+RN
Sbjct  468  VRTNGGWFNDILNTIFSSPPTVALTVGTILDNTLEARHTVEERGLPWLIPFHHRKGDSRN  527

Query  402  EEFYTLPFNLNRFFP  358
            EEFY+ P  +N + P
Sbjct  528  EEFYSYPLRINEYIP  542



>ref|XP_002444345.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor]
 gb|EES13840.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor]
Length=533

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+    +G+ GLS LQF N+N  R   I G SLF+G+S+PQ+FNEY S   +G 
Sbjct  395  IFAALYCIFFAYIGACGLSFLQFCNLNSFRTKFIMGFSLFMGLSVPQYFNEYTSVAGYGP  454

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V ++VA  LDNT++V  S  ++DRG  WW KFR+F+ D+
Sbjct  455  VHTGARWFNDMINVPFSSKPFVAVLVAFLLDNTIQVRDSGVRRDRGYHWWDKFRSFKTDS  514

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  515  RSEEFYSLPFNLNKFFP  531



>ref|XP_009418014.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+    VG+ G+S LQF N+N  R   I G S+F+G+S+PQ+FNEY S   +G 
Sbjct  393  IFAALYCLFFAYVGAAGVSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGP  452

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN IFSS P V   VA FLDNTL    S  +KDRG  WW KFR+F+GD+
Sbjct  453  VHTGARWFNDIINVIFSSKPFVAGFVAFFLDNTLHRNDSTVRKDRGYHWWQKFRSFKGDS  512

Query  408  RNEEFYTLPFNLNRFFP  358
            R++EFY LPFNLN+FFP
Sbjct  513  RSDEFYRLPFNLNKFFP  529



>gb|EEC84500.1| hypothetical protein OsI_31190 [Oryza sativa Indica Group]
Length=216

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+A +YC+    VG+ GLS LQF N+N  R   I G + F+GIS+PQ+FNEY +   +G 
Sbjct  78   IFAGMYCIFFAYVGACGLSFLQFCNLNSFRTKFILGFAFFMGISVPQYFNEYTAVAGYGP  137

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V  +VA FLDNT+E   +  +KDRG  WW KFR+F+ D 
Sbjct  138  VHTGARWFNDMINVPFSSKPFVAGLVAYFLDNTIETHNNTVRKDRGYHWWDKFRSFKKDA  197

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  198  RSEEFYSLPFNLNKFFP  214



>ref|XP_002961825.1| hypothetical protein SELMODRAFT_76475 [Selaginella moellendorffii]
 ref|XP_002980826.1| hypothetical protein SELMODRAFT_113360 [Selaginella moellendorffii]
 gb|EFJ18011.1| hypothetical protein SELMODRAFT_113360 [Selaginella moellendorffii]
 gb|EFJ37085.1| hypothetical protein SELMODRAFT_76475 [Selaginella moellendorffii]
Length=526

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            + A +YCVL G++ + G+S LQFTN+N  RNL+I G S+F+  S+P++  E+     HG 
Sbjct  390  MVAGIYCVLFGVLAASGVSYLQFTNLNLPRNLIILGFSVFMAFSVPEYIREFTISAGHGP  449

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            VHT + WFN  +N   SS P + LIV V LDNTL+++ +KKDRG  WW  FRTF  D RN
Sbjct  450  VHTKSHWFNDILNVTLSSGPVIALIVGVVLDNTLKLKVTKKDRGANWWKNFRTFGADKRN  509

Query  402  EEFYTLPFNLNRFFPPT  352
            EEFY LPFNLN+FFPP 
Sbjct  510  EEFYKLPFNLNKFFPPV  526



>ref|XP_009777178.1| PREDICTED: nucleobase-ascorbate transporter 3 [Nicotiana sylvestris]
Length=555

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+L G+V ++G+S +QF N N MRN+ + G+SLFLGISIPQ+F        HG 
Sbjct  417  IFAAIYCILYGIVAAIGVSFIQFANKNSMRNIYVLGISLFLGISIPQYFVMNTDIAGHGP  476

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T AGWFN  +NTIFSSPPTV  IV  F+DNTLE   S  DRG+PW V F+  +GD+RN
Sbjct  477  VRTPAGWFNDILNTIFSSPPTVATIVGTFVDNTLEARHSVDDRGVPWLVPFQRRKGDSRN  536

Query  402  EEFYTLPFNLNRFFP  358
            +EFY+ P  +N + P
Sbjct  537  DEFYSYPLRINEYIP  551



>gb|AFK46481.1| unknown [Medicago truncatula]
Length=549

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V + G+S +QF N N +RN+ + GL+LFLGISIPQ+F    +   HG 
Sbjct  411  IFAAIYCVLFGIVAATGISFIQFANNNSIRNIYVFGLTLFLGISIPQYFVMNTAPDGHGP  470

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V TN GWFN  +NTIFSSPPTV +IV   LDNTLE +++  DRG+PWWV F+  +GD RN
Sbjct  471  VRTNGGWFNDILNTIFSSPPTVAIIVGTVLDNTLEAKQTAVDRGLPWWVPFQKRKGDVRN  530

Query  402  EEFYTLPFNLNRFFP  358
            +EFY  P  L  + P
Sbjct  531  DEFYRFPLRLTEYIP  545



>ref|XP_003589253.1| Nucleobase-ascorbate transporter [Medicago truncatula]
 gb|AES59504.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=549

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V + G+S +QF N N +RN+ + GL+LFLGISIPQ+F    +   HG 
Sbjct  411  IFAAIYCVLFGIVAATGISFIQFANNNSIRNIYVFGLTLFLGISIPQYFVMNTAPDGHGP  470

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V TN GWFN  +NTIFSSPPTV +IV   LDNTLE +++  DRG+PWWV F+  +GD RN
Sbjct  471  VRTNGGWFNDILNTIFSSPPTVAIIVGTVLDNTLEAKQTAVDRGLPWWVPFQKRKGDVRN  530

Query  402  EEFYTLPFNLNRFFP  358
            +EFY  P  L  + P
Sbjct  531  DEFYRFPLRLTEYIP  545



>gb|AFW73350.1| hypothetical protein ZEAMMB73_676690 [Zea mays]
Length=165

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+     GS G+  LQF N+N  R   I G S+F+G+S+PQ+FNEY S   +G 
Sbjct  27   IFAAMYCIFFAYAGSAGIGFLQFCNLNTFRTKFILGFSVFMGLSVPQYFNEYTSIAGYGP  86

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT++ WFN  +N IFSS   V   VA  LDNT++  ++  ++DRG  WW KFR++R D 
Sbjct  87   VHTHSRWFNDIVNVIFSSKAFVAGFVAYLLDNTIDRHEASVRRDRGYHWWDKFRSYRTDT  146

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  147  RSEEFYSLPFNLNKFFP  163



>gb|AAK59508.2| putative permease 1 [Arabidopsis thaliana]
Length=360

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  222  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  281

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  282  VHTGARWFNDMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  341

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  342  RSEEFYSLPFNLNKYFP  358



>emb|CDY30739.1| BnaA02g33610D [Brassica napus]
Length=504

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  366  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  425

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+FRGD 
Sbjct  426  VHTGARWFNDMVNVPFSSEPFVAGAVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFRGDT  485

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  486  RSEEFYSLPFNLNKYFP  502



>gb|ACR38061.1| unknown [Zea mays]
Length=242

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            ++A +YC+    VG VGLS LQF N+N  R   I G + F+G+S+PQ+FNEY +   +G 
Sbjct  104  VFAGMYCLFFAYVGGVGLSLLQFCNLNSFRTKFIMGFAFFMGLSVPQYFNEYTAVASYGP  163

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  F+S P V  +VA  LDNTL+V++S  +KDRG  WW KFR+F+ D 
Sbjct  164  VHTGARWFNDMINVPFTSKPFVAGLVAYILDNTLQVKESAVRKDRGNHWWEKFRSFKKDA  223

Query  408  RNEEFYTLPFNLNRFFP  358
            R++EFY+LPFNLN+FFP
Sbjct  224  RSQEFYSLPFNLNKFFP  240



>ref|XP_004238190.1| PREDICTED: nucleobase-ascorbate transporter 3 [Solanum lycopersicum]
Length=549

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+L G+V ++G+S +QF N N MRN+ + G+SLFLGISIPQ+F        HG 
Sbjct  411  IFAAIYCILYGIVAAIGISFIQFANKNSMRNIYVLGVSLFLGISIPQYFVMNTDIAGHGP  470

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T AGWFN  +NTIFSSPPTV  IV   +DNTLE   S  DRG+PW V F+  +GD+RN
Sbjct  471  VRTPAGWFNDILNTIFSSPPTVATIVGTVVDNTLEARHSYDDRGIPWLVPFQRRKGDSRN  530

Query  402  EEFYTLPFNLNRFFP  358
            EEFY+ P  +N + P
Sbjct  531  EEFYSYPLRINEYIP  545



>emb|CDY45747.1| BnaC02g42350D [Brassica napus]
Length=515

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  377  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  436

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+FRGD 
Sbjct  437  VHTGARWFNDMVNVPFSSEPFVAGAVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFRGDT  496

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  497  RSEEFYSLPFNLNKYFP  513



>ref|XP_009112041.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 ref|XP_009112042.1| PREDICTED: nucleobase-ascorbate transporter 6 [Brassica rapa]
 emb|CDY16755.1| BnaA09g06270D [Brassica napus]
Length=532

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V  +VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGVVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|XP_004973451.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Setaria italica]
Length=533

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 99/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+    +G+ GLS LQF N+N  R   I G SLF+G+S+PQ+FNEY S   +G 
Sbjct  395  IFAALYCIFFAYIGACGLSFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGYGP  454

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V ++VA FLDNT++   +  ++DRG  WW KFR+F+ D+
Sbjct  455  VHTGARWFNDMINVPFSSKPFVAVLVAFFLDNTIQRRDTAVRRDRGYHWWDKFRSFKTDS  514

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  515  RSEEFYSLPFNLNKFFP  531



>emb|CDY56736.1| BnaC09g50870D [Brassica napus]
Length=532

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V  +VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGVVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|XP_002864824.1| hypothetical protein ARALYDRAFT_496474 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41083.1| hypothetical protein ARALYDRAFT_496474 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I GLS+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGLSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|XP_009130240.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brassica 
rapa]
Length=532

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+FRGD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGAVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFRGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|XP_011017252.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Populus euphratica]
Length=550

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V ++G+S +QFTN N MRN  + GL+LFLGISIPQ+F    +   HG 
Sbjct  412  IFAAIYCVLFGIVAAIGISFIQFTNNNSMRNHYVLGLALFLGISIPQYFVSSTTGDGHGP  471

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V TN GWFN  +NT+FSSPPTV +IV   LD+TLE  ++  DRG+PWW  F++ +GD R 
Sbjct  472  VRTNGGWFNDILNTLFSSPPTVAMIVGTVLDSTLEARQTINDRGIPWWKPFQSRKGDVRT  531

Query  402  EEFYTLPFNLNRFFP  358
            +EFY+LP  +N + P
Sbjct  532  DEFYSLPLRINEWMP  546



>ref|XP_006354927.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Solanum tuberosum]
Length=549

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+L G+V ++G+S +QF N N MRN+ + G+SLFLGISIPQ+F        HG 
Sbjct  411  IFAAIYCILYGIVAAIGISFIQFANKNSMRNIYVLGISLFLGISIPQYFVMNTDITGHGP  470

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T AGWFN  +NTIFSSPPTV  IV   +DNTLE   S  DRG+PW V F+  +GD+RN
Sbjct  471  VRTPAGWFNDILNTIFSSPPTVATIVGTVVDNTLEARHSYDDRGVPWLVPFQRRKGDSRN  530

Query  402  EEFYTLPFNLNRFFP  358
            EEFY+ P  +N + P
Sbjct  531  EEFYSYPLRINEYIP  545



>ref|XP_009625821.1| PREDICTED: nucleobase-ascorbate transporter 3 [Nicotiana tomentosiformis]
Length=549

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+L G+V ++G+S +QF N N MRN+ + G+SLFLGISIPQ+F        HG 
Sbjct  411  IFAAIYCILYGIVAAIGISFIQFANKNSMRNIYVLGISLFLGISIPQYFVMNTDIAGHGP  470

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T AGWFN  +NTIFSSPPTV  IV  F+DNTLE   S  DRG+PW V F+  +GD+RN
Sbjct  471  VRTPAGWFNDILNTIFSSPPTVATIVGTFVDNTLEARHSVDDRGVPWLVPFQRRKGDSRN  530

Query  402  EEFYTLPFNLNRFFP  358
            +EFY+ P  ++ + P
Sbjct  531  DEFYSYPLRIHEYIP  545



>ref|XP_004499100.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Cicer arietinum]
Length=548

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V +VG+S +QFTN N +RN+ + GL+LFLGISIPQ+F    S   HG 
Sbjct  410  IFAAIYCVLFGIVAAVGISFIQFTNNNSIRNIYVFGLTLFLGISIPQYFIMNTSPDGHGP  469

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V TN GWFN  +NTIFSSPPTV +IV   LDNTLE +++  DRGM WW  F+  +GD RN
Sbjct  470  VRTNGGWFNDILNTIFSSPPTVAIIVGTVLDNTLEAKQTAVDRGMQWWAPFQNKKGDVRN  529

Query  402  EEFYTLPFNLNRFFP  358
            +EFY  P  L  + P
Sbjct  530  DEFYRFPLRLTEYIP  544



>ref|XP_003574490.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=533

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 94/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+    +G+ GLS LQF N+N  R   I G S F+G+S+PQ+FNEY S   HG 
Sbjct  395  IFAALYCIFFAYIGACGLSFLQFCNLNSFRTKFIVGFSFFMGLSVPQYFNEYTSVAGHGP  454

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V  IV  FLDNT+    S  ++DRG  WW KFR+F+ D 
Sbjct  455  VHTGARWFNDMINVPFSSKPFVAGIVGYFLDNTMHRRDSAVRRDRGYHWWDKFRSFKTDT  514

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  515  RSEEFYSLPFNLNKFFP  531



>emb|CDP07610.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL  +V + G+S +QF N N MRN+ I GLSLFLGISIPQ+F        HG 
Sbjct  409  IFAAIYCVLYAIVAATGISFIQFANPNSMRNIYILGLSLFLGISIPQYFVMNTDMAGHGP  468

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
              T AGWFN  +NT FSSPPTV +IV   LDNTLE  +++ +RG+PW V F+  +GD+RN
Sbjct  469  AKTGAGWFNNILNTTFSSPPTVAIIVGTLLDNTLEAGRARDERGLPWLVPFQRRKGDSRN  528

Query  402  EEFYTLPFNLNRFFP  358
            EEFY  P  +N + P
Sbjct  529  EEFYNYPLIINDYIP  543



>gb|EMT25940.1| Nucleobase-ascorbate transporter 6 [Aegilops tauschii]
Length=538

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+A +YCV    VG+ GLS LQF N+N  R   I G S F+GIS+PQ+FNEY S   HG 
Sbjct  400  IFAGMYCVFFAYVGACGLSFLQFCNLNSFRTKFILGFSFFIGISVPQYFNEYASVSGHGP  459

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FS+ P V  +VA FLDNT+ + +S  +KDRG  WW KFR+F+ D 
Sbjct  460  VHTGARWFNDMINVPFSNKPFVAGLVAYFLDNTMHLHQSAVRKDRGYHWWDKFRSFKKDA  519

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  520  RSEEFYSLPFNLNKFFP  536



>ref|XP_010089934.1| Nucleobase-ascorbate transporter 3 [Morus notabilis]
 gb|EXB38630.1| Nucleobase-ascorbate transporter 3 [Morus notabilis]
Length=489

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V + G+S +QF N N MRNL I GLSLFLGISIPQ+F    +    G 
Sbjct  351  IFAAIYCVLFGIVAASGISFIQFANSNSMRNLYILGLSLFLGISIPQYFVMNTTADGRGP  410

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T+AGWF+  +NTIFSSPPTV +IV   LDNTLE + +  DRG+PWW  F+  +GD RN
Sbjct  411  VRTDAGWFDDILNTIFSSPPTVAMIVGTLLDNTLESKYAIDDRGVPWWRPFQHRKGDPRN  470

Query  402  EEFYTLPFNLNRFFP  358
            +EFY LP  ++ + P
Sbjct  471  DEFYGLPLRIHEYIP  485



>ref|XP_009391740.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=531

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+L   VG+ GLS LQF N+N  R   I G S F+G+S+PQ+FNEY S   +G 
Sbjct  393  IFAALYCLLFAYVGAGGLSFLQFCNLNSFRTKFILGFSFFMGLSVPQYFNEYTSVAGYGP  452

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN IFSS P V   VA FLDN+L    S  +KDRG+ WW KFR+++GD 
Sbjct  453  VHTGARWFNDIINVIFSSKPFVAGFVAFFLDNSLHRHDSAVRKDRGLHWWHKFRSYKGDP  512

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY LP NLN+FFP
Sbjct  513  RSEEFYRLPLNLNKFFP  529



>ref|XP_009391739.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=557

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+L   VG+ GLS LQF N+N  R   I G S F+G+S+PQ+FNEY S   +G 
Sbjct  419  IFAALYCLLFAYVGAGGLSFLQFCNLNSFRTKFILGFSFFMGLSVPQYFNEYTSVAGYGP  478

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN IFSS P V   VA FLDN+L    S  +KDRG+ WW KFR+++GD 
Sbjct  479  VHTGARWFNDIINVIFSSKPFVAGFVAFFLDNSLHRHDSAVRKDRGLHWWHKFRSYKGDP  538

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY LP NLN+FFP
Sbjct  539  RSEEFYRLPLNLNKFFP  555



>ref|XP_006355948.1| PREDICTED: nucleobase-ascorbate transporter 7-like isoform X2 
[Solanum tuberosum]
Length=483

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VGS GLS LQF N+N  R   I G S+F+G+SIPQ+FNEY +   +G 
Sbjct  345  IVAALYCLFFAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGLSIPQYFNEYTAINGYGP  404

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V  ++A+FLD +L  + +  +KDRGMPWW KF++F+ D 
Sbjct  405  VHTRARWFNDMINVPFSSEPFVAGLLALFLDVSLHRKDAATRKDRGMPWWDKFKSFKTDT  464

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  465  RSEEFYSLPFNLNKFFP  481



>ref|XP_009415380.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415381.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415382.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415383.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=531

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 94/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYC+    VG+ GLS LQF N+N  R   I G S+F+G+S+PQ+FNEY S   +G 
Sbjct  393  IFAALYCLFFAYVGAAGLSFLQFCNLNSFRTKFILGFSVFMGLSVPQYFNEYTSVAGYGP  452

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN IFSS P V   VA  LDNTL    S  +KDRG  WW KFR+F GD 
Sbjct  453  VHTGARWFNDIINVIFSSKPFVAGFVAFLLDNTLHRHDSAVRKDRGFHWWHKFRSFMGDT  512

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LP NLN+FFP
Sbjct  513  RSEEFYSLPCNLNKFFP  529



>ref|XP_006386511.1| PIGMENT DEFECTIVE EMBRYO 135 family protein [Populus trichocarpa]
 ref|XP_006386512.1| hypothetical protein POPTR_0002s13080g [Populus trichocarpa]
 gb|ERP64308.1| PIGMENT DEFECTIVE EMBRYO 135 family protein [Populus trichocarpa]
 gb|ERP64309.1| hypothetical protein POPTR_0002s13080g [Populus trichocarpa]
Length=550

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V ++G+S +QF+N N MRN  I G++LFLGISIPQ+F    +   HG 
Sbjct  412  IFAAIYCVLFGIVAAIGISFIQFSNNNSMRNHYILGMALFLGISIPQYFVSNTTGDGHGP  471

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V TN GWFN  +NT+FSSPPTV +IV   LD+TLE  ++  DRG+PWW  F++ +GD R 
Sbjct  472  VRTNGGWFNDILNTLFSSPPTVAMIVGTLLDSTLEARQTINDRGIPWWKPFQSRKGDVRT  531

Query  402  EEFYTLPFNLNRFFP  358
            +EFY+LP  +N + P
Sbjct  532  DEFYSLPLRINEWMP  546



>ref|XP_010684514.1| PREDICTED: nucleobase-ascorbate transporter 3 [Beta vulgaris 
subsp. vulgaris]
Length=555

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YC+L G+V + G+S +QFTN N MRN+ + GLSLFLGISIP +F  Y     HG 
Sbjct  416  IFAAIYCILYGIVAANGISFIQFTNNNSMRNMYVLGLSLFLGISIPYYFMSYTMAANHGP  475

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V+T  GWFN  +NTIFSSP  V +IV   LD TLE   +  +RG+PWW+ F+   G+ RN
Sbjct  476  VNTGGGWFNDILNTIFSSPAMVAMIVGTLLDTTLEARDAAVERGVPWWIPFQRRNGEVRN  535

Query  402  EEFYTLPFNLNRFFP  358
            EEFY+LP  +N F P
Sbjct  536  EEFYSLPLRINEFMP  550



>ref|XP_006394340.1| hypothetical protein EUTSA_v10003977mg [Eutrema salsugineum]
 gb|ESQ31626.1| hypothetical protein EUTSA_v10003977mg [Eutrema salsugineum]
Length=532

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|XP_010459419.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Camelina 
sativa]
 ref|XP_010459427.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Camelina 
sativa]
 ref|XP_010484002.1| PREDICTED: nucleobase-ascorbate transporter 6 [Camelina sativa]
Length=532

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|NP_201094.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 ref|NP_851251.2| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 ref|NP_001032127.2| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 sp|Q27GI3.2|NAT6_ARATH RecName: Full=Nucleobase-ascorbate transporter 6; Short=AtNAT6 
[Arabidopsis thaliana]
 gb|AAM47573.1|AF466198_1 putative permease 1 [Arabidopsis thaliana]
 dbj|BAB10858.1| permease 1 [Arabidopsis thaliana]
 gb|AED97668.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 gb|AED97669.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
 gb|AED97670.1| Xanthine/uracil permease family protein [Arabidopsis thaliana]
Length=532

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|XP_006280290.1| hypothetical protein CARUB_v10026214mg [Capsella rubella]
 gb|EOA13188.1| hypothetical protein CARUB_v10026214mg [Capsella rubella]
Length=532

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N  FSS P V   VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGARWFNDMVNVPFSSEPFVAGSVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>emb|CDX84363.1| BnaC03g51370D [Brassica napus]
Length=532

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VG+ GLS LQF N+N  R   I G S+FLG+SIPQ+FNEY +   +G 
Sbjct  394  IIAALYCLFFAYVGAGGLSFLQFCNLNSFRTKFILGFSVFLGLSIPQYFNEYTAIKGYGP  453

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT   WFN  +N  FSS P V  +VA FLDNTL  + S  +KDRG  WW KFR+F+GD 
Sbjct  454  VHTGGRWFNDMVNVPFSSEPFVAGMVAFFLDNTLHKKDSSIRKDRGKHWWDKFRSFKGDT  513

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN++FP
Sbjct  514  RSEEFYSLPFNLNKYFP  530



>ref|XP_002282229.1| PREDICTED: nucleobase-ascorbate transporter 3 [Vitis vinifera]
 emb|CBI19583.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V + G+S LQF N N MRNL + GLSLFLG+SI Q+F  + +   HG 
Sbjct  407  IFAAIYCVLFGIVAATGISFLQFANSNSMRNLYVLGLSLFLGVSISQYFVSHTTTDGHGP  466

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T+ GWFN  +NTIFSSPPTV +IV   LDNTL+  +   DRG+ W V F  ++GD+RN
Sbjct  467  VKTDGGWFNDILNTIFSSPPTVAIIVGTLLDNTLDPRRFHDDRGIQWLVPFHHWKGDSRN  526

Query  402  EEFYTLPFNLNRFFP  358
            EEFY LP  +N + P
Sbjct  527  EEFYNLPLRINEYMP  541



>emb|CAN78223.1| hypothetical protein VITISV_006254 [Vitis vinifera]
Length=501

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AA+YCVL G+V + G+S LQF N N MRNL + GLSLFLG+SI Q+F  + +   HG 
Sbjct  363  IFAAIYCVLFGIVAATGISFLQFANSNSMRNLYVLGLSLFLGVSISQYFVSHTTTDGHGP  422

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKSKKDRGMPWWVKFRTFRGDNRN  403
            V T+ GWFN  +NTIFSSPPTV +IV   LDNTL+  +   DRG+ W V F  ++GD+RN
Sbjct  423  VKTDGGWFNDILNTIFSSPPTVAIIVGTLLDNTLDPRRFHDDRGIQWLVPFHHWKGDSRN  482

Query  402  EEFYTLPFNLNRFFP  358
            EEFY LP  +N + P
Sbjct  483  EEFYNLPLRINEYMP  497



>ref|XP_003573107.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Brachypodium 
distachyon]
Length=539

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 94/137 (69%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+AALYCV    VGS GL  LQF N+N  R   I G SLF+G+S+PQ+FNEY S    G 
Sbjct  401  IFAALYCVFFAYVGSAGLGFLQFCNLNSFRTKFILGFSLFMGLSVPQYFNEYTSVAGFGP  460

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  +N +FSS   VG +VA  LDNTL    S  +KDRG  WW KFR++R D 
Sbjct  461  VHTRARWFNDMVNVLFSSKAFVGGVVAYVLDNTLHRHDSVVRKDRGYHWWDKFRSYRTDT  520

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  521  RSEEFYSLPFNLNKFFP  537



>ref|XP_004238704.1| PREDICTED: nucleobase-ascorbate transporter 7 [Solanum lycopersicum]
Length=533

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VGS GLS LQF N+N  R   I G S+F+G+SIPQ+FNEY +   +G 
Sbjct  395  IVAALYCLFFAYVGSAGLSFLQFCNLNSFRTKFILGFSIFMGLSIPQYFNEYTAINGYGP  454

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVE--KSKKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V  ++A+FLD +L  +   ++KDRGMPWW KF++F+ D 
Sbjct  455  VHTRARWFNDMINVPFSSEPFVAGLLALFLDVSLHRKDVATRKDRGMPWWDKFKSFKTDT  514

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  515  RSEEFYSLPFNLNKFFP  531



>ref|XP_010238137.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Brachypodium distachyon]
Length=483

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 96/137 (70%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I+A +YCV    VG+ G+S LQF N+N  R   I G + F+GIS+PQ+FNEY +   HG 
Sbjct  345  IFAGMYCVFFAYVGACGVSLLQFCNLNSFRTKFILGFAFFMGISVPQYFNEYAAVSGHGP  404

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FS+ P V  +VA FLDNT+ + +S  +KDRG  WW KFR+F+ D 
Sbjct  405  VHTGARWFNDMINVPFSNKPFVAGLVAYFLDNTMHLHQSAVRKDRGYHWWDKFRSFKKDA  464

Query  408  RNEEFYTLPFNLNRFFP  358
            R++EFY+LPFNLN+FFP
Sbjct  465  RSQEFYSLPFNLNKFFP  481



>ref|XP_009595521.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VGS GLS LQF N+N  R   I G S+F+G+SIPQ+FNEY +   +G 
Sbjct  395  IVAALYCLFFAYVGSAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINGYGP  454

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V  ++A+FLD +L  + +  +KDRGMPWW KF++F+ D 
Sbjct  455  VHTRARWFNDMINVPFSSEPFVAGLLALFLDVSLHKKDAATRKDRGMPWWDKFKSFKTDT  514

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  515  RSEEFYSLPFNLNKFFP  531



>ref|XP_009799732.1| PREDICTED: nucleobase-ascorbate transporter 7-like [Nicotiana 
sylvestris]
Length=533

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 98/137 (72%), Gaps = 2/137 (1%)
 Frame = -2

Query  762  IYAALYCvlxglvgsvglsxLQFTNMNCMRNLLITGLSLFLGISIPQFFNEYWSQGRHGL  583
            I AALYC+    VGS GLS LQF N+N  R   I G S+F+G+SIPQ+FNEY +   +G 
Sbjct  395  IVAALYCLFFAYVGSAGLSFLQFCNLNSFRTKFILGFSVFMGLSIPQYFNEYTAINGYGP  454

Query  582  VHTNAGWFNAFINTIFSSPPTVGLIVAVFLDNTLEVEKS--KKDRGMPWWVKFRTFRGDN  409
            VHT A WFN  IN  FSS P V  ++A+FLD +L  + +  +KDRGMPWW KF++F+ D 
Sbjct  455  VHTRARWFNDMINVPFSSEPFVAGLLALFLDVSLHKKDAATRKDRGMPWWDKFKSFKTDT  514

Query  408  RNEEFYTLPFNLNRFFP  358
            R+EEFY+LPFNLN+FFP
Sbjct  515  RSEEFYSLPFNLNKFFP  531



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100