BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027M05

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006367511.1|  PREDICTED: uncharacterized protein LOC102589547    346   2e-112   
ref|XP_006341815.1|  PREDICTED: uncharacterized protein LOC102587665    340   1e-111   
ref|XP_004239150.1|  PREDICTED: uncharacterized protein LOC101248575    341   2e-110   Solanum lycopersicum
ref|XP_004245178.1|  PREDICTED: uncharacterized protein LOC101258288    335   7e-108   
ref|XP_009765489.1|  PREDICTED: uncharacterized protein LOC104217035    333   3e-107   Nicotiana sylvestris
emb|CDP13254.1|  unnamed protein product                                326   7e-105   Coffea canephora [robusta coffee]
gb|KDP26669.1|  hypothetical protein JCGZ_17827                         316   1e-100   Jatropha curcas
gb|KHG05074.1|  Endoglucanase                                           307   3e-97    Gossypium arboreum [tree cotton]
ref|XP_011042367.1|  PREDICTED: uncharacterized protein LOC105138074    306   7e-97    Populus euphratica
ref|XP_010248702.1|  PREDICTED: uncharacterized protein LOC104591536    305   1e-96    Nelumbo nucifera [Indian lotus]
ref|XP_011086688.1|  PREDICTED: uncharacterized protein LOC105168334    305   2e-96    Sesamum indicum [beniseed]
gb|KJB15656.1|  hypothetical protein B456_002G188600                    305   2e-96    Gossypium raimondii
ref|XP_002515055.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    305   3e-96    Ricinus communis
ref|XP_007044872.1|  Cellulase protein                                  303   1e-95    
gb|KDO82153.1|  hypothetical protein CISIN_1g008330mg                   292   4e-94    Citrus sinensis [apfelsine]
ref|XP_002312657.2|  hypothetical protein POPTR_0008s18380g             299   6e-94    Populus trichocarpa [western balsam poplar]
gb|KDO82152.1|  hypothetical protein CISIN_1g008330mg                   292   5e-93    Citrus sinensis [apfelsine]
ref|XP_011034023.1|  PREDICTED: uncharacterized protein LOC105132312    295   1e-92    Populus euphratica
gb|KHN06535.1|  Endoglucanase                                           292   2e-92    Glycine soja [wild soybean]
ref|XP_006438205.1|  hypothetical protein CICLE_v10031098mg             293   8e-92    Citrus clementina [clementine]
gb|KDO82151.1|  hypothetical protein CISIN_1g008330mg                   293   8e-92    Citrus sinensis [apfelsine]
ref|XP_006483983.1|  PREDICTED: uncharacterized protein LOC102624331    293   1e-91    Citrus sinensis [apfelsine]
ref|XP_002285424.1|  PREDICTED: uncharacterized protein LOC100244027    292   1e-91    Vitis vinifera
ref|XP_004504142.1|  PREDICTED: uncharacterized protein LOC101503968    291   4e-91    Cicer arietinum [garbanzo]
ref|XP_011042368.1|  PREDICTED: uncharacterized protein LOC105138075    288   5e-90    Populus euphratica
ref|XP_010100346.1|  hypothetical protein L484_027655                   285   1e-88    
ref|XP_008389746.1|  PREDICTED: uncharacterized protein LOC103452050    284   2e-88    
ref|XP_007159685.1|  hypothetical protein PHAVU_002G258500g             284   4e-88    Phaseolus vulgaris [French bean]
ref|XP_009359244.1|  PREDICTED: uncharacterized protein LOC103949843    282   8e-88    Pyrus x bretschneideri [bai li]
gb|KHN29014.1|  Endoglucanase                                           279   1e-86    Glycine soja [wild soybean]
ref|XP_003532808.1|  PREDICTED: uncharacterized protein LOC100818309    279   3e-86    Glycine max [soybeans]
ref|XP_010044528.1|  PREDICTED: uncharacterized protein LOC104433472    278   3e-86    Eucalyptus grandis [rose gum]
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       285   3e-86    Glycine soja [wild soybean]
ref|XP_004309996.1|  PREDICTED: uncharacterized protein LOC101307271    276   2e-85    Fragaria vesca subsp. vesca
gb|KEH20742.1|  cellulase (glycosyl hydrolase family 5)                 276   2e-85    Medicago truncatula
ref|XP_004170960.1|  PREDICTED: uncharacterized LOC101217177            270   3e-84    
gb|KHN19917.1|  hypothetical protein glysoja_032397                     270   3e-84    Glycine soja [wild soybean]
ref|XP_008446127.1|  PREDICTED: uncharacterized protein LOC103488945    273   5e-84    Cucumis melo [Oriental melon]
ref|XP_003539156.1|  PREDICTED: uncharacterized protein LOC100816102    271   1e-83    Glycine max [soybeans]
ref|XP_003524249.1|  PREDICTED: uncharacterized protein LOC100789885    271   3e-83    Glycine max [soybeans]
gb|KGN51727.1|  hypothetical protein Csa_5G593400                       270   4e-83    Cucumis sativus [cucumbers]
ref|XP_004135502.1|  PREDICTED: uncharacterized protein LOC101217177    270   5e-83    
gb|KHN06534.1|  Endoglucanase                                           268   5e-82    Glycine soja [wild soybean]
ref|XP_007132485.1|  hypothetical protein PHAVU_011G098000g             266   6e-82    Phaseolus vulgaris [French bean]
ref|XP_008221942.1|  PREDICTED: uncharacterized protein LOC103321869    267   1e-81    
ref|XP_007159684.1|  hypothetical protein PHAVU_002G258400g             265   5e-81    Phaseolus vulgaris [French bean]
ref|XP_007223308.1|  hypothetical protein PRUPE_ppa003807mg             264   1e-80    Prunus persica
gb|EPS61076.1|  hypothetical protein M569_13724                         259   3e-80    Genlisea aurea
ref|XP_008236799.1|  PREDICTED: uncharacterized protein LOC103335561    260   2e-79    Prunus mume [ume]
ref|XP_010904543.1|  PREDICTED: uncharacterized protein LOC105031942    261   3e-79    Elaeis guineensis
gb|KHG22500.1|  Endoglucanase E1                                        259   3e-79    Gossypium arboreum [tree cotton]
gb|KJB78033.1|  hypothetical protein B456_012G173600                    259   8e-79    Gossypium raimondii
ref|XP_010250986.1|  PREDICTED: uncharacterized protein LOC104593039    254   2e-76    Nelumbo nucifera [Indian lotus]
ref|XP_004504189.1|  PREDICTED: uncharacterized protein LOC101490831    247   2e-74    Cicer arietinum [garbanzo]
ref|XP_009385963.1|  PREDICTED: uncharacterized protein LOC103973...    246   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN43979.1|  Endoglucanase E1                                        243   2e-73    Glycine soja [wild soybean]
ref|XP_009385956.1|  PREDICTED: uncharacterized protein LOC103973...    246   2e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793719.1|  PREDICTED: uncharacterized protein LOC103709945    244   2e-73    
gb|AES72136.2|  cellulase (glycosyl hydrolase family 5)                 246   2e-73    Medicago truncatula
ref|XP_003552802.1|  PREDICTED: uncharacterized protein LOC100805196    243   9e-73    Glycine max [soybeans]
ref|XP_008389747.1|  PREDICTED: uncharacterized protein LOC103452051    242   3e-72    
emb|CAN62580.1|  hypothetical protein VITISV_036569                     231   1e-71    Vitis vinifera
ref|XP_003601885.1|  Endoglucanase                                      243   1e-71    
emb|CAN72915.1|  hypothetical protein VITISV_020826                     228   7e-71    Vitis vinifera
emb|CAN73208.1|  hypothetical protein VITISV_009079                     228   1e-70    Vitis vinifera
ref|XP_010026597.1|  PREDICTED: uncharacterized protein LOC104416968    236   3e-70    
ref|XP_008793758.1|  PREDICTED: uncharacterized protein LOC103709981    236   3e-70    
ref|XP_002284888.2|  PREDICTED: uncharacterized protein LOC100258876    234   2e-69    Vitis vinifera
ref|XP_010250982.1|  PREDICTED: uncharacterized protein LOC104593...    233   3e-69    
ref|XP_010250979.1|  PREDICTED: uncharacterized protein LOC104593...    233   3e-69    
ref|XP_010249430.1|  PREDICTED: uncharacterized protein LOC104591974    231   3e-68    
ref|XP_010682344.1|  PREDICTED: uncharacterized protein LOC104897211    231   4e-68    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010249431.1|  PREDICTED: uncharacterized protein LOC104591975    231   5e-68    Nelumbo nucifera [Indian lotus]
ref|XP_002284895.1|  PREDICTED: uncharacterized protein LOC100253729    230   5e-68    Vitis vinifera
ref|XP_010904544.1|  PREDICTED: uncharacterized protein LOC105031943    231   6e-68    Elaeis guineensis
gb|AAS00040.1|  unknown                                                 221   6e-68    Vitis riparia [frost grape]
ref|XP_010528075.1|  PREDICTED: uncharacterized protein LOC104805267    231   6e-68    Tarenaya hassleriana [spider flower]
gb|EYU30606.1|  hypothetical protein MIMGU_mgv1a018920mg                229   9e-68    Erythranthe guttata [common monkey flower]
ref|XP_010026596.1|  PREDICTED: uncharacterized protein LOC104416965    229   2e-67    
emb|CAN60394.1|  hypothetical protein VITISV_015741                     217   2e-66    Vitis vinifera
ref|XP_004975980.1|  PREDICTED: uncharacterized protein LOC101758857    226   3e-66    Setaria italica
gb|KFK33555.1|  hypothetical protein AALP_AA5G028800                    226   3e-66    Arabis alpina [alpine rockcress]
emb|CBI20318.3|  unnamed protein product                                221   3e-66    Vitis vinifera
gb|ACN33507.1|  unknown                                                 219   2e-65    Zea mays [maize]
gb|EMT27118.1|  hypothetical protein F775_19072                         224   3e-65    
gb|EAY94563.1|  hypothetical protein OsI_16341                          223   4e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_002284881.1|  PREDICTED: uncharacterized protein LOC100264047    222   5e-65    Vitis vinifera
emb|CAH67676.1|  H0510A06.1                                             223   6e-65    Oryza sativa [red rice]
emb|CAD41089.2|  OSJNBb0011N17.6                                        223   7e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010026600.1|  PREDICTED: uncharacterized protein LOC104416972    224   7e-65    Eucalyptus grandis [rose gum]
dbj|BAK00694.1|  predicted protein                                      222   2e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002446674.1|  hypothetical protein SORBIDRAFT_06g020260          221   2e-64    Sorghum bicolor [broomcorn]
emb|CBI20316.3|  unnamed protein product                                209   3e-64    Vitis vinifera
ref|XP_010556349.1|  PREDICTED: uncharacterized protein LOC104825675    221   3e-64    Tarenaya hassleriana [spider flower]
ref|XP_010514258.1|  PREDICTED: uncharacterized protein LOC104790245    220   7e-64    Camelina sativa [gold-of-pleasure]
emb|CDX83590.1|  BnaC07g23300D                                          220   9e-64    
ref|NP_001132121.1|  hypothetical protein precursor                     219   9e-64    Zea mays [maize]
ref|XP_010248706.1|  PREDICTED: uncharacterized protein LOC104591...    219   1e-63    Nelumbo nucifera [Indian lotus]
ref|XP_009152076.1|  PREDICTED: uncharacterized protein LOC103875318    219   2e-63    Brassica rapa
gb|AIZ06017.1|  hypothetical protein                                    218   3e-63    Zea nicaraguensis
emb|CDY13613.1|  BnaA06g33100D                                          218   6e-63    Brassica napus [oilseed rape]
ref|XP_010502521.1|  PREDICTED: uncharacterized protein LOC104779823    217   1e-62    Camelina sativa [gold-of-pleasure]
emb|CBI20314.3|  unnamed protein product                                206   1e-62    Vitis vinifera
ref|XP_002876947.1|  predicted protein                                  216   2e-62    
ref|XP_010556350.1|  PREDICTED: uncharacterized protein LOC104825676    216   2e-62    Tarenaya hassleriana [spider flower]
dbj|BAB02432.1|  unnamed protein product                                216   2e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026595.1|  PREDICTED: uncharacterized protein LOC104416964    215   4e-62    Eucalyptus grandis [rose gum]
ref|XP_010248705.1|  PREDICTED: uncharacterized protein LOC104591...    215   4e-62    Nelumbo nucifera [Indian lotus]
ref|XP_006290844.1|  hypothetical protein CARUB_v10016955mg             214   9e-62    
ref|XP_006652422.1|  PREDICTED: uncharacterized protein LOC102702088    213   2e-61    Oryza brachyantha
emb|CAH67677.1|  H0510A06.2                                             213   3e-61    Oryza sativa [red rice]
ref|XP_003579979.1|  PREDICTED: uncharacterized protein LOC100845861    213   4e-61    Brachypodium distachyon [annual false brome]
emb|CAD41090.2|  OSJNBb0011N17.7                                        213   5e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EEE61202.1|  hypothetical protein OsJ_15212                          213   5e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77495.1|  hypothetical protein OsI_16343                          213   6e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_002889989.1|  glycosyl hydrolase family 5 protein                210   4e-60    Arabidopsis lyrata subsp. lyrata
gb|KCW59700.1|  hypothetical protein EUGRSUZ_H02458                     209   5e-60    Eucalyptus grandis [rose gum]
gb|KCW59699.1|  hypothetical protein EUGRSUZ_H02457                     208   1e-59    Eucalyptus grandis [rose gum]
gb|AAD31066.1|AC007357_15  F3F19.15                                     207   2e-59    Arabidopsis thaliana [mouse-ear cress]
ref|NP_172772.2|  Cellulase (glycosyl hydrolase family 5) protein       207   3e-59    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189244.1|  Cellulase (glycosyl hydrolase family 5) protein       206   1e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501449.1|  PREDICTED: uncharacterized protein LOC104778702    197   4e-58    
ref|XP_006395581.1|  hypothetical protein EUTSA_v10003934mg             204   7e-58    
ref|XP_010691763.1|  PREDICTED: uncharacterized protein LOC104905020    202   3e-57    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006417151.1|  hypothetical protein EUTSA_v10007253mg             202   5e-57    Eutrema salsugineum [saltwater cress]
ref|XP_004975985.1|  PREDICTED: uncharacterized protein LOC101760765    200   2e-56    Setaria italica
ref|XP_010494994.1|  PREDICTED: uncharacterized protein LOC104772040    195   2e-56    
ref|XP_006307168.1|  hypothetical protein CARUB_v10008758mg             197   2e-55    Capsella rubella
gb|EEC77494.1|  hypothetical protein OsI_16340                          197   2e-55    Oryza sativa Indica Group [Indian rice]
ref|XP_010240029.1|  PREDICTED: uncharacterized protein LOC100839976    197   4e-55    Brachypodium distachyon [annual false brome]
ref|XP_010458756.1|  PREDICTED: uncharacterized protein LOC104739...    196   4e-55    
emb|CAH66880.1|  OSIGBa0158F13.11                                       196   4e-55    Oryza sativa [red rice]
ref|NP_001053105.1|  Os04g0480900                                       196   5e-55    
ref|XP_010495004.1|  PREDICTED: uncharacterized protein LOC104772051    196   5e-55    Camelina sativa [gold-of-pleasure]
dbj|BAK05121.1|  predicted protein                                      196   7e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010476303.1|  PREDICTED: uncharacterized protein LOC104755594    196   8e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010458755.1|  PREDICTED: uncharacterized protein LOC104739...    195   1e-54    Camelina sativa [gold-of-pleasure]
gb|KCW59701.1|  hypothetical protein EUGRSUZ_H02460                     188   1e-54    Eucalyptus grandis [rose gum]
ref|XP_006400290.1|  hypothetical protein EUTSA_v10015581mg             194   2e-54    Eutrema salsugineum [saltwater cress]
emb|CDY16066.1|  BnaC08g40570D                                          194   3e-54    Brassica napus [oilseed rape]
ref|XP_010662248.1|  PREDICTED: thylakoid lumenal protein At1g122...    186   3e-53    Vitis vinifera
ref|XP_002871770.1|  glycosyl hydrolase family 5 protein                191   4e-53    
ref|XP_009148543.1|  PREDICTED: uncharacterized protein LOC103871957    191   1e-52    Brassica rapa
ref|XP_006289374.1|  hypothetical protein CARUB_v10002868mg             189   2e-52    Capsella rubella
emb|CDY19395.1|  BnaC05g09040D                                          189   2e-52    Brassica napus [oilseed rape]
ref|NP_197252.1|  Glycosyl hydrolase superfamily protein                188   3e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381699.1|  PREDICTED: uncharacterized protein LOC103969775    187   4e-52    
emb|CDY38435.1|  BnaA10g17230D                                          188   5e-52    Brassica napus [oilseed rape]
ref|XP_009107523.1|  PREDICTED: uncharacterized protein LOC103833179    187   6e-52    Brassica rapa
ref|XP_010492706.1|  PREDICTED: uncharacterized protein LOC104770057    187   7e-52    Camelina sativa [gold-of-pleasure]
emb|CDY16914.1|  BnaC09g40410D                                          187   8e-52    Brassica napus [oilseed rape]
ref|XP_004955049.1|  PREDICTED: uncharacterized protein LOC101776534    187   1e-51    Setaria italica
ref|XP_010420476.1|  PREDICTED: uncharacterized protein LOC104706046    187   1e-51    Camelina sativa [gold-of-pleasure]
gb|EMT10461.1|  Endoglucanase E1                                        186   1e-51    
ref|XP_002446675.1|  hypothetical protein SORBIDRAFT_06g020270          187   1e-51    Sorghum bicolor [broomcorn]
ref|NP_189245.1|  Cellulase (glycosyl hydrolase family 5) protein       185   4e-51    Arabidopsis thaliana [mouse-ear cress]
gb|ACF85134.1|  unknown                                                 184   7e-51    Zea mays [maize]
ref|XP_010549752.1|  PREDICTED: uncharacterized protein LOC104820833    184   9e-51    Tarenaya hassleriana [spider flower]
gb|KFK38059.1|  hypothetical protein AALP_AA3G064700                    182   1e-50    Arabis alpina [alpine rockcress]
ref|XP_006292902.1|  hypothetical protein CARUB_v10019167mg             183   2e-50    
ref|NP_001130915.1|  hydrolase, hydrolyzing O-glycosyl compound p...    184   2e-50    Zea mays [maize]
ref|XP_004975262.1|  PREDICTED: uncharacterized protein LOC101779133    184   2e-50    Setaria italica
emb|CDX98009.1|  BnaA06g07600D                                          184   2e-50    
ref|XP_002876948.1|  glycosyl hydrolase family 5 protein                183   3e-50    
gb|ACF79301.1|  unknown                                                 184   3e-50    Zea mays [maize]
ref|XP_010425288.1|  PREDICTED: uncharacterized protein LOC104710406    182   1e-49    Camelina sativa [gold-of-pleasure]
ref|XP_010502524.1|  PREDICTED: uncharacterized protein LOC104779826    180   5e-49    
gb|EAY86525.1|  hypothetical protein OsI_07905                          181   6e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_010266913.1|  PREDICTED: plastocyanin, chloroplastic-like        174   6e-49    Nelumbo nucifera [Indian lotus]
ref|XP_002452393.1|  hypothetical protein SORBIDRAFT_04g024910          179   2e-48    
ref|XP_008678768.1|  PREDICTED: uncharacterized protein LOC100501...    176   1e-47    Zea mays [maize]
ref|XP_008678767.1|  PREDICTED: uncharacterized protein LOC100501...    176   2e-47    Zea mays [maize]
emb|CDY13614.1|  BnaA06g33090D                                          174   2e-47    Brassica napus [oilseed rape]
ref|XP_009152075.1|  PREDICTED: uncharacterized protein LOC103875317    176   2e-47    Brassica rapa
ref|XP_006378255.1|  hypothetical protein POPTR_0010s05970g             164   5e-47    
emb|CDX83591.1|  BnaC07g23310D                                          171   4e-46    
gb|KEH20758.1|  cellulase (glycosyl hydrolase family 5), putative       156   1e-43    Medicago truncatula
gb|KFK25904.1|  hypothetical protein AALP_AA8G177600                    163   5e-43    Arabis alpina [alpine rockcress]
gb|KFK43579.1|  hypothetical protein AALP_AA1G144700                    163   1e-42    Arabis alpina [alpine rockcress]
emb|CDY26627.1|  BnaA09g46500D                                          158   2e-42    Brassica napus [oilseed rape]
emb|CDY38093.1|  BnaC02g06800D                                          150   7e-39    Brassica napus [oilseed rape]
ref|XP_006395580.1|  hypothetical protein EUTSA_v10003968mg             151   1e-38    Eutrema salsugineum [saltwater cress]
emb|CDX89335.1|  BnaA01g15580D                                          151   2e-38    
ref|XP_009387704.1|  PREDICTED: uncharacterized protein LOC103974573    144   3e-38    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002272386.2|  PREDICTED: uncharacterized protein LOC100250178    150   3e-38    Vitis vinifera
ref|XP_010932263.1|  PREDICTED: uncharacterized protein LOC105052971    143   4e-38    Elaeis guineensis
emb|CDY38091.1|  BnaC02g06820D                                          149   5e-38    Brassica napus [oilseed rape]
ref|XP_008807477.1|  PREDICTED: uncharacterized protein LOC103719832    142   6e-38    Phoenix dactylifera
ref|XP_010437042.1|  PREDICTED: uncharacterized protein LOC104720...    148   1e-37    Camelina sativa [gold-of-pleasure]
emb|CBI34407.3|  unnamed protein product                                147   3e-37    Vitis vinifera
ref|XP_009121460.1|  PREDICTED: uncharacterized protein LOC103846306    147   4e-37    Brassica rapa
ref|XP_002272422.2|  PREDICTED: uncharacterized protein LOC100245045    147   5e-37    Vitis vinifera
ref|XP_002272534.1|  PREDICTED: uncharacterized protein LOC100257079    147   5e-37    Vitis vinifera
ref|XP_010492588.1|  PREDICTED: uncharacterized protein LOC104769...    146   6e-37    Camelina sativa [gold-of-pleasure]
emb|CBI34404.3|  unnamed protein product                                146   7e-37    Vitis vinifera
emb|CDX69429.1|  BnaA10g17780D                                          146   9e-37    
emb|CDY21995.1|  BnaC09g01010D                                          138   2e-36    Brassica napus [oilseed rape]
emb|CBI16819.3|  unnamed protein product                                142   2e-36    Vitis vinifera
ref|XP_010514260.1|  PREDICTED: uncharacterized protein LOC104790246    141   5e-35    
gb|KGN50360.1|  hypothetical protein Csa_5G168960                       139   5e-35    Cucumis sativus [cucumbers]
emb|CDX69431.1|  BnaA10g17800D                                          140   5e-35    
ref|XP_008467306.1|  PREDICTED: uncharacterized protein LOC103504686    139   2e-34    Cucumis melo [Oriental melon]
emb|CDY16991.1|  BnaC09g41180D                                          139   3e-34    Brassica napus [oilseed rape]
ref|XP_009403630.1|  PREDICTED: uncharacterized protein LOC103987145    132   3e-34    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004143723.1|  PREDICTED: uncharacterized protein LOC101213113    138   5e-34    Cucumis sativus [cucumbers]
ref|XP_003608279.1|  Endoglucanase                                      137   1e-33    Medicago truncatula
ref|XP_010053198.1|  PREDICTED: uncharacterized protein LOC104441706    136   3e-33    Eucalyptus grandis [rose gum]
ref|XP_008445780.1|  PREDICTED: uncharacterized protein LOC103488703    134   1e-32    Cucumis melo [Oriental melon]
ref|XP_006439449.1|  hypothetical protein CICLE_v10023534mg             133   2e-32    
ref|XP_004151386.1|  PREDICTED: uncharacterized protein LOC101207450    130   6e-32    
gb|KGN45940.1|  hypothetical protein Csa_6G028440                       130   3e-31    Cucumis sativus [cucumbers]
ref|XP_011080895.1|  PREDICTED: uncharacterized protein LOC105164045    130   5e-31    Sesamum indicum [beniseed]
ref|XP_006584934.1|  PREDICTED: uncharacterized protein LOC100811735    125   3e-30    
ref|XP_004170746.1|  PREDICTED: endoglucanase E1-like                   127   3e-30    
gb|ABR17494.1|  unknown                                                 127   4e-30    Picea sitchensis
ref|XP_002272454.2|  PREDICTED: uncharacterized protein LOC100267...    127   7e-30    
ref|XP_007159232.1|  hypothetical protein PHAVU_002G220300g             126   9e-30    Phaseolus vulgaris [French bean]
gb|KHN45741.1|  Endoglucanase                                           126   1e-29    Glycine soja [wild soybean]
ref|XP_006395579.1|  hypothetical protein EUTSA_v10003968mg             124   5e-29    
emb|CDX94332.1|  BnaC01g18520D                                          118   7e-29    
ref|XP_004151560.1|  PREDICTED: uncharacterized protein LOC101211788    122   8e-29    
ref|XP_006378254.1|  hypothetical protein POPTR_0010s059501g            115   1e-28    
ref|XP_004168760.1|  PREDICTED: uncharacterized protein LOC101223816    123   1e-28    
ref|XP_002272491.1|  PREDICTED: uncharacterized protein LOC100262188    122   2e-28    Vitis vinifera
gb|KEH18775.1|  hydrolyzing O-glycosyl compounds hydrolase              122   3e-28    Medicago truncatula
ref|XP_004510834.1|  PREDICTED: uncharacterized protein LOC101496378    122   4e-28    
gb|KGN57440.1|  hypothetical protein Csa_3G186670                       120   4e-28    Cucumis sativus [cucumbers]
ref|XP_008810943.1|  PREDICTED: uncharacterized protein LOC103722247    120   1e-27    
emb|CBI34405.3|  unnamed protein product                                122   1e-27    Vitis vinifera
gb|KGN50395.1|  hypothetical protein Csa_5G171770                       120   2e-27    Cucumis sativus [cucumbers]
ref|XP_008467257.1|  PREDICTED: uncharacterized protein LOC103504654    119   3e-27    Cucumis melo [Oriental melon]
ref|XP_010916958.1|  PREDICTED: uncharacterized protein LOC105041671    118   4e-27    
gb|EYU23411.1|  hypothetical protein MIMGU_mgv1a004205mg                119   5e-27    Erythranthe guttata [common monkey flower]
emb|CDP12092.1|  unnamed protein product                                120   8e-27    Coffea canephora [robusta coffee]
gb|KGN50394.1|  hypothetical protein Csa_5G171760                       117   1e-26    Cucumis sativus [cucumbers]
ref|XP_011026965.1|  PREDICTED: uncharacterized protein LOC105127394    115   5e-26    Populus euphratica
gb|KDP25367.1|  hypothetical protein JCGZ_20523                         114   8e-26    Jatropha curcas
gb|EYU23409.1|  hypothetical protein MIMGU_mgv1a004243mg                115   1e-25    Erythranthe guttata [common monkey flower]
ref|XP_003621369.1|  Endoglucanase E1                                   114   1e-25    
ref|XP_002298005.2|  hypothetical protein POPTR_0001s10020g             114   2e-25    
gb|AES77604.2|  hydrolyzing O-glycosyl compounds hydrolase              114   3e-25    Medicago truncatula
ref|XP_009605826.1|  PREDICTED: uncharacterized protein LOC104100317    113   3e-25    Nicotiana tomentosiformis
gb|EYU23408.1|  hypothetical protein MIMGU_mgv1a020519mg                113   4e-25    Erythranthe guttata [common monkey flower]
gb|EAZ23667.1|  hypothetical protein OsJ_07369                          113   4e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008459280.1|  PREDICTED: uncharacterized protein LOC103498458    113   1e-24    Cucumis melo [Oriental melon]
gb|KGN57438.1|  hypothetical protein Csa_3G185670                       110   2e-24    Cucumis sativus [cucumbers]
ref|XP_004168759.1|  PREDICTED: uncharacterized protein LOC101223591    110   3e-24    
ref|XP_009773950.1|  PREDICTED: uncharacterized protein LOC104224082    110   4e-24    Nicotiana sylvestris
ref|XP_002509877.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    110   6e-24    
ref|XP_004170742.1|  PREDICTED: uncharacterized protein LOC101225189    108   6e-24    
ref|XP_006400209.1|  hypothetical protein EUTSA_v10015466mg             108   1e-23    Eutrema salsugineum [saltwater cress]
gb|KDO76363.1|  hypothetical protein CISIN_1g039248mg                   107   2e-23    Citrus sinensis [apfelsine]
ref|NP_197172.1|  glycosyl hydrolase family protein                     108   2e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143962.1|  PREDICTED: uncharacterized protein LOC101211675    108   2e-23    Cucumis sativus [cucumbers]
ref|XP_002871731.1|  glycosyl hydrolase family 5 protein                107   2e-23    
gb|KGN50047.1|  hypothetical protein Csa_5G151630                       107   3e-23    Cucumis sativus [cucumbers]
ref|XP_004143963.1|  PREDICTED: uncharacterized protein LOC101211910    107   3e-23    
gb|KDP25366.1|  hypothetical protein JCGZ_20522                         108   3e-23    Jatropha curcas
ref|XP_004140825.1|  PREDICTED: uncharacterized protein LOC101208873    105   4e-23    
ref|XP_003621392.1|  Endoglucanase E1                                   107   5e-23    
gb|AES77610.2|  hydrolyzing O-glycosyl compounds hydrolase              107   5e-23    Medicago truncatula
gb|EYU23410.1|  hypothetical protein MIMGU_mgv1a004297mg                106   9e-23    Erythranthe guttata [common monkey flower]
gb|AFK37776.1|  unknown                                               99.8    1e-22    Lotus japonicus
ref|XP_008437728.1|  PREDICTED: uncharacterized protein LOC103483074    105   1e-22    Cucumis melo [Oriental melon]
ref|XP_006344017.1|  PREDICTED: uncharacterized protein LOC102582487    103   7e-22    Solanum tuberosum [potatoes]
ref|XP_008437726.1|  PREDICTED: uncharacterized protein LOC103483073    103   8e-22    Cucumis melo [Oriental melon]
emb|CDY34588.1|  BnaC03g56880D                                          102   9e-22    Brassica napus [oilseed rape]
emb|CDX85491.1|  BnaA02g03220D                                          101   2e-21    
ref|XP_006378253.1|  hypothetical protein POPTR_0010s059502g            100   3e-21    
ref|XP_009142284.1|  PREDICTED: uncharacterized protein LOC103866155    100   6e-21    Brassica rapa
gb|KDO82155.1|  hypothetical protein CISIN_1g008330mg                   100   6e-21    Citrus sinensis [apfelsine]
ref|XP_009126137.1|  PREDICTED: uncharacterized protein LOC103851062    100   8e-21    Brassica rapa
ref|XP_009142293.1|  PREDICTED: uncharacterized protein LOC103866164    100   8e-21    Brassica rapa
gb|KCW59703.1|  hypothetical protein EUGRSUZ_H02464                     100   9e-21    Eucalyptus grandis [rose gum]
gb|AFG68326.1|  hypothetical protein 0_4489_01                        93.2    1e-20    Pinus taeda
ref|XP_010437048.1|  PREDICTED: uncharacterized protein LOC104720...  99.8    2e-20    Camelina sativa [gold-of-pleasure]
gb|AFG68334.1|  hypothetical protein 0_4489_01                        92.8    2e-20    Pinus taeda
gb|EPS62091.1|  hypothetical protein M569_12701                       99.4    3e-20    Genlisea aurea
gb|AFG68327.1|  hypothetical protein 0_4489_01                        91.3    8e-20    Pinus taeda
ref|XP_002315653.2|  hypothetical protein POPTR_0010s05960g           95.9    1e-19    
ref|XP_002509879.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  97.1    3e-19    
ref|XP_006289055.1|  hypothetical protein CARUB_v10002452mg           94.4    3e-19    
ref|XP_009121461.1|  PREDICTED: uncharacterized protein LOC103846308  96.3    4e-19    
ref|XP_010026599.1|  PREDICTED: uncharacterized protein LOC104416971  95.1    4e-19    
ref|XP_010453833.1|  PREDICTED: uncharacterized protein LOC104735704  95.9    4e-19    
ref|XP_010497223.1|  PREDICTED: uncharacterized protein LOC104774279  92.0    3e-18    
ref|XP_010492589.1|  PREDICTED: uncharacterized protein LOC104769...  93.2    4e-18    
emb|CDP16213.1|  unnamed protein product                              92.4    6e-18    
gb|KDP25365.1|  hypothetical protein JCGZ_20521                       92.0    3e-17    
gb|KEH28356.1|  hydrolyzing O-glycosyl compounds hydrolase            90.1    5e-17    
ref|XP_009387346.1|  PREDICTED: uncharacterized protein LOC103974285  89.4    5e-17    
gb|EAY94564.1|  hypothetical protein OsI_16342                        87.4    8e-17    
ref|XP_003617143.1|  Oligoribonuclease                                90.1    1e-16    
gb|KCW77463.1|  hypothetical protein EUGRSUZ_D01801                   84.7    1e-15    
ref|XP_010420372.1|  PREDICTED: uncharacterized protein LOC104705962  85.5    1e-15    
ref|XP_003621368.1|  Endoglucanase                                    80.1    8e-14    
ref|XP_010325669.1|  PREDICTED: uncharacterized protein LOC101257885  80.5    9e-14    
emb|CDY40992.1|  BnaA02g27820D                                        78.6    3e-13    
ref|XP_007135020.1|  hypothetical protein PHAVU_010G095100g           78.6    4e-13    
gb|AGT16660.1|  hypothetical protein SHCRBa_026_H12_R_120             75.5    5e-13    
gb|AFW62836.1|  hypothetical protein ZEAMMB73_750687                  77.0    8e-13    
gb|AFW62835.1|  hypothetical protein ZEAMMB73_750687                  76.6    8e-13    
gb|EPS64690.1|  hypothetical protein M569_10090                       76.3    1e-12    
ref|XP_002509878.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  75.1    5e-12    
gb|KHN26287.1|  hypothetical protein glysoja_050239                   70.5    1e-11    
ref|XP_010536239.1|  PREDICTED: uncharacterized protein LOC104811274  70.1    3e-11    
ref|XP_010261410.1|  PREDICTED: uncharacterized protein LOC104600255  71.2    8e-11    
gb|KHN41605.1|  hypothetical protein glysoja_038343                   68.9    1e-10    
ref|NP_001173990.1|  Os04g0481050                                     62.0    3e-10    
emb|CDY16990.1|  BnaC09g41170D                                        64.7    3e-10    
ref|XP_006653527.1|  PREDICTED: uncharacterized protein LOC102709173  67.0    2e-09    
ref|XP_011080894.1|  PREDICTED: uncharacterized protein LOC105164044  65.9    4e-09    
ref|XP_004158142.1|  PREDICTED: uncharacterized LOC101213113          64.3    1e-08    
gb|KHN04647.1|  Endoglucanase                                         64.3    1e-08    
ref|XP_010658499.1|  PREDICTED: uncharacterized protein LOC100267...  61.6    2e-07    
ref|XP_010535458.1|  PREDICTED: uncharacterized protein LOC104810759  58.2    2e-06    
gb|KFH44162.1|  Endoglucanase-like protein                            57.8    2e-06    
emb|CDY40991.1|  BnaA02g27810D                                        53.5    2e-06    
dbj|BAD09277.1|  hypothetical protein                                 56.2    3e-06    
ref|NP_001047320.1|  Os02g0596200                                     56.2    8e-06    
ref|XP_002893942.1|  predicted protein                                55.8    1e-05    
gb|EKG14335.1|  Glycoside hydrolase family 5                          55.1    2e-05    
gb|EMS46776.1|  hypothetical protein TRIUR3_23304                     54.7    2e-05    
ref|XP_002145195.1|  cellulase family protein                         53.9    5e-05    
ref|XP_007357340.1|  glycosyl hydrolase family 5 protein/cellulase    52.4    2e-04    
ref|XP_007792420.1|  putative cellulase family protein                52.0    2e-04    
ref|XP_007585086.1|  putative cellulase family protein                51.2    3e-04    
ref|XP_001836746.2|  glycosyl hydrolase family 5 protein/cellulase    50.4    7e-04    
emb|CEJ81391.1|  hypothetical protein VHEMI01518                      50.1    0.001    
ref|XP_001908470.1|  hypothetical protein                             50.1    0.001    
gb|KIY63779.1|  glycoside hydrolase family 5 protein                  50.1    0.001    



>ref|XP_006367511.1| PREDICTED: uncharacterized protein LOC102589547 [Solanum tuberosum]
Length=560

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL GSYYLREG VGL E YGV+ WNWC+ RN SFL+RIS +QSPF+GP
Sbjct  338  LAAELDFDWALWTLVGSYYLREGVVGLNEVYGVMDWNWCDIRNSSFLKRISTVQSPFQGP  397

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            GY ESR HKLIFHPMTGLCVRR+S FQPLELGPCSESD W YT  K LT+ GTYFCLQA+
Sbjct  398  GYNESRSHKLIFHPMTGLCVRRISFFQPLELGPCSESDAWDYTPTKTLTLTGTYFCLQAD  457

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            K G+PAKLG+ CT+ +SKW+ ISDS+MHLSSKL+DG+N+CLDVDS NV+ TNTCKCL+ D
Sbjct  458  KSGQPAKLGIMCTNSNSKWQAISDSKMHLSSKLQDGTNLCLDVDSKNVVFTNTCKCLSKD  517

Query  218  SSCDPASQWFKIIDSTRG-TTTKSDFQSTSFLYFLAKKLFASYI  90
             +CDPASQWFKIIDSTR   TTKS FQS     FL      SYI
Sbjct  518  KTCDPASQWFKIIDSTRKQNTTKSFFQSKQIAQFLGNTF--SYI  559



>ref|XP_006341815.1| PREDICTED: uncharacterized protein LOC102587665, partial [Solanum 
tuberosum]
Length=425

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 189/226 (84%), Gaps = 3/226 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL GSYYLR+G VGL E+YG+L WNW + RN SFLQRIS++++PF+GP
Sbjct  200  LAAELDFDWALWTLVGSYYLRDGIVGLNEYYGILDWNWFDIRNSSFLQRISVIRTPFQGP  259

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            GY E+R HK+IFHPMTGLCV+R SL QPLELGPCSE++ W Y   KAL V GTYFCLQA+
Sbjct  260  GYAETRSHKVIFHPMTGLCVQRTSLLQPLELGPCSEAEAWSYAPAKALIVLGTYFCLQAD  319

Query  398  -KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN-  225
             KLG+PAKL + C+DDSSKW+IISDS+MHLSSKL+D ++VCLDVD NNVI+T TCKCL+ 
Sbjct  320  NKLGQPAKLSMICSDDSSKWDIISDSKMHLSSKLQDATSVCLDVDPNNVIVTQTCKCLST  379

Query  224  NDSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLFASYI  90
            ND++CDP SQWFKIIDSTR T TTKS  Q    ++FLA+  F SYI
Sbjct  380  NDTTCDPGSQWFKIIDSTRATKTTKSFLQIKPIIHFLARNFFGSYI  425



>ref|XP_004239150.1| PREDICTED: uncharacterized protein LOC101248575 [Solanum lycopersicum]
Length=572

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 188/226 (83%), Gaps = 3/226 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL GSYYLR+G VGL E+YG+L WNW + RN SFLQRIS++++PF+GP
Sbjct  347  LAAELDFDWALWTLVGSYYLRDGIVGLNEYYGILDWNWFDIRNSSFLQRISVIRTPFQGP  406

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA-  402
            GY E+R HK+IFHPMTGLCV+R SL QPLELGPCSE++ W Y   KAL V GTYFCLQA 
Sbjct  407  GYAETRPHKVIFHPMTGLCVQRTSLLQPLELGPCSEAEAWSYAPAKALIVLGTYFCLQAD  466

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN-  225
            +KLG+PAKLG+ C+DDSSKW+IISDS+MHLSSKL+D ++VCLDVD NNVI+T TCKCLN 
Sbjct  467  DKLGQPAKLGMICSDDSSKWDIISDSKMHLSSKLQDATSVCLDVDPNNVIVTQTCKCLNT  526

Query  224  NDSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLFASYI  90
            ND++CDP SQWFKIIDSTR T  TKS  Q    + FLA+  F SYI
Sbjct  527  NDTTCDPGSQWFKIIDSTRTTKITKSFLQIKPIIQFLARNFFGSYI  572



>ref|XP_004245178.1| PREDICTED: uncharacterized protein LOC101258288 [Solanum lycopersicum]
Length=561

 Score =   335 bits (858),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 181/224 (81%), Gaps = 3/224 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL GSYYLREG VGL E YGV+ WNWC+ RN SFL RIS +QSPF+GP
Sbjct  339  LAAELDFDWALWTLVGSYYLREGVVGLNEVYGVMDWNWCDIRNSSFLNRISAVQSPFQGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            GY ESR HKLIFHPMTGLCVRR+S  QPLELGPCSESD W YT  K+LT+ GTYFCLQA+
Sbjct  399  GYNESRSHKLIFHPMTGLCVRRISFLQPLELGPCSESDAWDYTTTKSLTLTGTYFCLQAD  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            K G+PAKLG+ CT+ +SKW+ ISDS+MHLSSKL+DG+++CLDVDS N I TN CKCL+ D
Sbjct  459  KSGQPAKLGIMCTNSNSKWQAISDSKMHLSSKLQDGTSLCLDVDSKNAIFTNPCKCLSKD  518

Query  218  SSCDPASQWFKIIDSTR-GTTTKSDFQSTSFLYFLAKKLFASYI  90
             +C+P SQWFKIIDSTR   +TKS FQS   + FL      SYI
Sbjct  519  KTCEPESQWFKIIDSTRQQNSTKSFFQSEHIVQFLGNTF--SYI  560



>ref|XP_009765489.1| PREDICTED: uncharacterized protein LOC104217035 [Nicotiana sylvestris]
Length=562

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LDFDWALWTL GSYYLR+G VGL E+YGVL  NW + RN SFL+RIS ++SPF+GP
Sbjct  338  LAAQLDFDWALWTLVGSYYLRDGVVGLNEYYGVLDCNWRDIRNSSFLERISAIRSPFQGP  397

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            GYTE+RLHK+IFHP TGLCVRR S  QPLELG CSE+  W Y   K LTV GTYFCLQA+
Sbjct  398  GYTETRLHKVIFHPKTGLCVRRTSFLQPLELGSCSEAAAWRYAPQKTLTVIGTYFCLQAD  457

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN-N  222
            KLG+PAKLG+ C+DDSSKWE ISDS+MHLSSKL+D ++VCLDVDSNNVI+T TCKCL+ N
Sbjct  458  KLGEPAKLGITCSDDSSKWETISDSKMHLSSKLQDATSVCLDVDSNNVIVTQTCKCLSTN  517

Query  221  DSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLFASYI  90
            D++CDP SQWFKIIDSTR T TTKS  Q    + FLA+  F SYI
Sbjct  518  DTTCDPGSQWFKIIDSTRVTKTTKSFLQIKPIIRFLARSFFGSYI  562



>emb|CDP13254.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   326 bits (835),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 180/223 (81%), Gaps = 3/223 (1%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD DWALWTL GSYYLREG  G +E YG+  WNWCE RN SF+QRIS +QSPFRGPG
Sbjct  311  AAELDLDWALWTLVGSYYLREGVAGKDESYGIYNWNWCETRNSSFIQRISALQSPFRGPG  370

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             +ESR HK+IFHP TGLCV+R SL +PLELGPCSE++ WGY+  K LT++GTY+CLQA+ 
Sbjct  371  VSESRPHKIIFHPATGLCVQRKSLLKPLELGPCSEAEAWGYSPQKTLTIKGTYYCLQADA  430

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            LG+PAKLG+ CTD SSKWE ISDS+MHLSSKL DGS VCLDVDSNNV++TN CKCL+ DS
Sbjct  431  LGQPAKLGIICTDKSSKWEAISDSKMHLSSKLCDGSEVCLDVDSNNVVVTNNCKCLSRDS  490

Query  215  SCDPASQWFKIIDSTR-GTTTKSDFQST--SFLYFLAKKLFAS  96
            SCDP SQWFK++DS+R GT++   F     S L+ LAK L  S
Sbjct  491  SCDPGSQWFKLVDSSRHGTSSTKSFSQMDDSILFNLAKTLAES  533



>gb|KDP26669.1| hypothetical protein JCGZ_17827 [Jatropha curcas]
Length=563

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 179/218 (82%), Gaps = 1/218 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD DWALWTL GSYYLREG +GL E+YGVL WNWC+ RN SFLQ+IS +QSPF+GPG
Sbjct  339  AAELDLDWALWTLVGSYYLREGVLGLNEYYGVLNWNWCDIRNSSFLQQISALQSPFQGPG  398

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             +ES LHK+IFHP+TGLCV+R S+ +PL+LGPC++S+ W YT  K L+++GTYFCLQA++
Sbjct  399  VSESNLHKVIFHPLTGLCVQRKSMLEPLKLGPCTDSEAWRYTPQKILSLKGTYFCLQADE  458

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            LGKPAKLG+ CTD  SKW++ISDS MHLSSK+ +G+ +CLDVDSNN I+ NTCKCL+ D+
Sbjct  459  LGKPAKLGVICTDSDSKWDVISDSNMHLSSKISNGTTICLDVDSNNTIVINTCKCLSRDN  518

Query  215  SCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFLAKKL  105
            +CDP SQWFK+++STR +T  K  F   S L +  +KL
Sbjct  519  TCDPGSQWFKLVNSTRSSTMAKPSFGINSILDYTKQKL  556



>gb|KHG05074.1| Endoglucanase [Gossypium arboreum]
Length=563

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 177/221 (80%), Gaps = 0/221 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYYLREG +GL E+YGVL +NWCE RN SF++RIS +QSPFRGP
Sbjct  336  VAAELDLDWALWTLVGSYYLREGVIGLNEYYGVLNYNWCETRNSSFIKRISALQSPFRGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E++LHK+IFHP TGLCV R S   PL LGPC+ S+ W Y++ K L V+GTYFCLQA+
Sbjct  396  GLSETKLHKVIFHPSTGLCVIRKSFLDPLLLGPCANSESWSYSSDKTLVVKGTYFCLQAD  455

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            + G  AKLG+FC+D +SKWE+I+DS+MHLSSKL++G ++CLDVDS+N I+TN+CKC++ D
Sbjct  456  ESGTLAKLGIFCSDSNSKWEMIADSKMHLSSKLRNGKSICLDVDSSNAIVTNSCKCISKD  515

Query  218  SSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFAS  96
            ++CDPASQWFK++DSTR  + +  F     ++ L  K F S
Sbjct  516  NTCDPASQWFKLVDSTRSRSEEQSFLHFDSIFDLPGKGFPS  556



>ref|XP_011042367.1| PREDICTED: uncharacterized protein LOC105138074 [Populus euphratica]
Length=561

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYYLR+G VG+ E+YGVL WNWCE RN +FLQ+IS +QSPFRGP
Sbjct  339  VAAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLNWNWCEARNSTFLQQISALQSPFRGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E+  HK+IFHP TGLCV R S+F+PL LG C+ES+ W YT+ K L+V+GTYFCLQ +
Sbjct  399  GLSEANPHKVIFHPSTGLCVLRKSMFEPLRLGRCTESEAWTYTSQKILSVKGTYFCLQTD  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             L KPAKLG+ CTD +SKW+ ISDS+MH SS   +G+ VCLDVDS+N I+TNTCKCL+ D
Sbjct  459  DLAKPAKLGIICTDSNSKWQTISDSKMHFSSTASNGTTVCLDVDSDNTIVTNTCKCLSKD  518

Query  218  SSCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFLAKKLFAS  96
            ++CDP SQWFK+++STR +T TK   +  S L F AK    S
Sbjct  519  NACDPESQWFKLVNSTRSSTMTKPLSRMNSILNFPAKGFHGS  560



>ref|XP_010248702.1| PREDICTED: uncharacterized protein LOC104591536 [Nelumbo nucifera]
Length=555

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELDFDWALWTLAGSYYLREG +G++E YGVL+WNWC+ RN SF++RIS++QSPF+GP
Sbjct  338  VAAELDFDWALWTLAGSYYLREGKIGMDETYGVLSWNWCKTRNSSFMERISVLQSPFQGP  397

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G ++ R +K+IFHP TGLCV R SLF+PL+LGPC+ES+ W YT  K L ++GTYFC+QA+
Sbjct  398  GLSDVRPYKVIFHPSTGLCVLRKSLFEPLKLGPCTESEAWSYTPPKNLLLKGTYFCIQAD  457

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LGKP KLG+FC+D SSKW++ISDS+MHLSS L DGS VCLDVDS N IIT  CKC++ D
Sbjct  458  ELGKPVKLGIFCSDPSSKWDMISDSKMHLSSTLSDGSTVCLDVDSTNTIITTPCKCVSRD  517

Query  218  SSCDPASQWFKIIDSTR  168
              CDPASQWFKI+ STR
Sbjct  518  DKCDPASQWFKIVTSTR  534



>ref|XP_011086688.1| PREDICTED: uncharacterized protein LOC105168334 [Sesamum indicum]
Length=574

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 173/223 (78%), Gaps = 2/223 (1%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD DWALW L GSYY+REG VG +E YGV  WNWC+ RN + L +IS +Q PFRGPG
Sbjct  350  AAELDVDWALWALTGSYYIREGVVGHDETYGVYNWNWCDVRNQTTLHKISALQYPFRGPG  409

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
            Y+E R HK++FHPMTGLCV+R+S  +PL LGPCSE++ W YT    LT++GTYFCLQA+ 
Sbjct  410  YSERRPHKILFHPMTGLCVKRMSFVEPLVLGPCSEAEAWSYTPQHTLTIKGTYFCLQADA  469

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN-D  219
            LG PAKLG+ CTD +SKWE +SDS+MHLSSKL+DG+NVCLDVDS+N ++ N CKCL+N +
Sbjct  470  LGHPAKLGIICTDSTSKWEAVSDSKMHLSSKLEDGTNVCLDVDSDNNVVMNNCKCLDNKN  529

Query  218  SSCDPASQWFKIIDSTRGTTTKSDF-QSTSFLYFLAKKLFASY  93
            + CDPASQWFK+IDSTR    KS F +  S L  +A    +S+
Sbjct  530  NKCDPASQWFKLIDSTRCGADKSFFLEINSVLKLVANNFLSSF  572



>gb|KJB15656.1| hypothetical protein B456_002G188600 [Gossypium raimondii]
Length=563

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 177/221 (80%), Gaps = 0/221 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYYLREG +GL E+YGVL +NWCE RN SF++RIS +QSPFRGP
Sbjct  336  VAAELDLDWALWTLVGSYYLREGVIGLNEYYGVLNYNWCETRNSSFIERISALQSPFRGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E++LHK+IFHP TGLCV R S   PL LGPC++S+ W Y++ K L V+GTYFCLQA+
Sbjct  396  GLSETKLHKVIFHPSTGLCVIRKSFLDPLCLGPCADSESWSYSSDKTLVVKGTYFCLQAD  455

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            + G   KLG+FC+D +SKWE+I+DS+MHLSSKL++G ++CLDVDS+N I+TN+CKC++ D
Sbjct  456  ESGTLVKLGIFCSDSNSKWEMIADSKMHLSSKLRNGKSICLDVDSSNAIVTNSCKCISKD  515

Query  218  SSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFAS  96
            ++CDPASQWFK++DSTR  + +  F     ++ L  K F S
Sbjct  516  NTCDPASQWFKLVDSTRSRSEERSFLHFDSIFDLPGKGFLS  556



>ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=566

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 177/220 (80%), Gaps = 1/220 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD+DWALWTL GSYYLR+G +GL E+YGVL WNWC+ RN SFLQ+IS +QSPF+GP
Sbjct  339  VAAELDWDWALWTLVGSYYLRQGVIGLNEYYGVLNWNWCDVRNSSFLQQISALQSPFQGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E+  HK+IFHP TGLCV+R S+ +PL LG C++S+ W YT+   LT+ GTYFCLQA+
Sbjct  399  GLSETNPHKVIFHPSTGLCVQRKSMLEPLRLGSCTDSEAWRYTSENTLTLRGTYFCLQAD  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LGKPAKLG+ CTD +SKW++ISDS+MHLSSK+ +G+ VCLDVDSNN I+ +TCKCL+ D
Sbjct  459  ELGKPAKLGIICTDSTSKWDVISDSKMHLSSKITNGTAVCLDVDSNNTIVISTCKCLSRD  518

Query  218  SSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFLAKKLF  102
            ++CDP SQWFK+++STR + T K   +  S L  L  K F
Sbjct  519  NTCDPESQWFKLVNSTRSSATAKPSLRINSILLDLPAKEF  558



>ref|XP_007044872.1| Cellulase protein [Theobroma cacao]
 gb|EOY00704.1| Cellulase protein [Theobroma cacao]
Length=563

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 175/213 (82%), Gaps = 5/213 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYYLREG VGL E+YG+L WNWCE RN SFL+RIS +QSPFRGP
Sbjct  336  VAAELDLDWALWTLVGSYYLREGVVGLNEYYGILNWNWCEIRNSSFLERISALQSPFRGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E++LHK+IFHP TGLCV R SL  PL LGPC++S+ W Y+    L V+GTYFCLQA+
Sbjct  396  GLSETKLHKVIFHPSTGLCVLRKSLLDPLRLGPCTDSEAWSYSPQNTLVVKGTYFCLQAD  455

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            + G  A+LG+ C++ +SKWE+ISDS+MHLSSKL++G+++CLDVDS N I+TN+CKCL+ND
Sbjct  456  ESGTLARLGIICSESNSKWEMISDSKMHLSSKLRNGTSICLDVDSTNTIVTNSCKCLSND  515

Query  218  SSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYF  120
            + CDP SQWFK++DSTR   ++S  +  SFL+F
Sbjct  516  NMCDPESQWFKLVDSTR---SRSGVK--SFLHF  543



>gb|KDO82153.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
 gb|KDO82154.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=341

 Score =   292 bits (747),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGP
Sbjct  115  VAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGP  174

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+
Sbjct  175  GVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAK  234

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D
Sbjct  235  HVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRD  294

Query  218  SSCDPASQWFKIID  177
             +CDPASQWFK++D
Sbjct  295  KTCDPASQWFKLVD  308



>ref|XP_002312657.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
 gb|EEE90024.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
Length=566

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 173/225 (77%), Gaps = 2/225 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELDFDWALWTL GSYY R+G +G+ E+YGVL  NW E RN +FLQ+IS +QSPFRGP
Sbjct  339  VAAELDFDWALWTLVGSYYFRQGVIGMNEYYGVLNSNWRETRNSTFLQQISALQSPFRGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E  LHK+IFHP TGLCV R S+F+PL LGPC++S+ W YT  K L+V+GTYFCLQ +
Sbjct  399  GVSEVHLHKVIFHPSTGLCVLRKSMFEPLRLGPCTQSEAWNYTPQKILSVKGTYFCLQTD  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +L KPAKLG+ CTD +SKWE ISDS+MHLSSK  +G+ VCLD+  NN I+T+TCKCL+ D
Sbjct  459  ELAKPAKLGIICTDSNSKWEAISDSKMHLSSKAPNGTAVCLDIGYNNTIVTSTCKCLSKD  518

Query  218  SSCDPASQWFKIIDSTR--GTTTKSDFQSTSFLYFLAKKLFASYI  90
            ++CDP SQWFK+++STR   T TK     +S L F AK     ++
Sbjct  519  NTCDPESQWFKLVNSTRRSSTMTKPSSLISSILNFPAKDFLWKFL  563



>gb|KDO82152.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=414

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGP
Sbjct  188  VAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGP  247

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+
Sbjct  248  GVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAK  307

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D
Sbjct  308  HVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRD  367

Query  218  SSCDPASQWFKIID  177
             +CDPASQWFK++D
Sbjct  368  KTCDPASQWFKLVD  381



>ref|XP_011034023.1| PREDICTED: uncharacterized protein LOC105132312 [Populus euphratica]
Length=566

 Score =   295 bits (756),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 173/225 (77%), Gaps = 2/225 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYYLR+G +G+ E+YGVL  NW E RN +FLQ+IS +QSPFRGP
Sbjct  339  VAAELDLDWALWTLVGSYYLRQGVIGMNEYYGVLNSNWRETRNSTFLQQISALQSPFRGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E  LHK+IFHP TGLCV R S+ +PL LGPC++S+ W YT  K L+V+GTYFCLQ +
Sbjct  399  GVSEVHLHKVIFHPSTGLCVLRKSMLEPLRLGPCTKSEAWNYTPQKILSVKGTYFCLQTD  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +L KPAKLG+ CTD +SKWE ISDS+MHLSSK  +G+ VCLD+ SNN I+TNTCKCL+ D
Sbjct  459  ELAKPAKLGIMCTDSNSKWETISDSKMHLSSKAPNGTPVCLDIGSNNTIVTNTCKCLSKD  518

Query  218  SSCDPASQWFKIIDSTRGTT--TKSDFQSTSFLYFLAKKLFASYI  90
            ++CDP SQWFK+++ST  ++  TK     +S L F AK     ++
Sbjct  519  NTCDPESQWFKLVNSTTRSSIMTKPSSLISSILNFPAKDFLWKFL  563



>gb|KHN06535.1| Endoglucanase [Glycine soja]
Length=474

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 3/215 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYY R+G +G+EEFYG+L+W+W + RN +FL RIS +Q PFRGP
Sbjct  257  VAAELDLDWALWTLVGSYYFRQGVIGMEEFYGILSWDWTQVRNTTFLNRISALQLPFRGP  316

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G T    +KLIFHP+TGLCV R SL  PL LGPC  SD W YT  K L+++GTYFC+QAE
Sbjct  317  GITRGNPYKLIFHPLTGLCVIRKSLLDPLTLGPCYLSDGWKYTPQKILSIKGTYFCIQAE  376

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
              G PAKLG+ C+D +S+WE+ISDS++HLSSKL D SNVCLDVD NN I+TN CKCL+ D
Sbjct  377  NEGMPAKLGIICSDPNSRWEMISDSKLHLSSKLSDDSNVCLDVDDNNNIVTNACKCLSRD  436

Query  218  SSCDPASQWFKIIDSTRG---TTTKSDFQSTSFLY  123
             +CDP+SQWFK+IDS R    TT+ S   ++S LY
Sbjct  437  RTCDPSSQWFKLIDSGRRSMLTTSTSSMLNSSDLY  471



>ref|XP_006438205.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
 gb|ESR51445.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
Length=570

 Score =   293 bits (751),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGP
Sbjct  344  VAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGP  403

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+
Sbjct  404  GVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAK  463

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D
Sbjct  464  HVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRD  523

Query  218  SSCDPASQWFKIID  177
             +CDPASQWFK++D
Sbjct  524  KTCDPASQWFKLVD  537



>gb|KDO82151.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=570

 Score =   293 bits (751),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGP
Sbjct  344  VAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGP  403

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+
Sbjct  404  GVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAK  463

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D
Sbjct  464  HVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRD  523

Query  218  SSCDPASQWFKIID  177
             +CDPASQWFK++D
Sbjct  524  KTCDPASQWFKLVD  537



>ref|XP_006483983.1| PREDICTED: uncharacterized protein LOC102624331 [Citrus sinensis]
Length=588

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD+DWALWTL GSYYLREG +GL E+YG+  WNWC+ RN SFL+RIS +QSPFRGP
Sbjct  362  VAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGP  421

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E+ LHK+I+HP TGLCV+R S   PL LGPC+ES+ W YT  K ++++G YFCLQA+
Sbjct  422  GVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAK  481

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +G+ VCLDVDS+N I+TNTCKCL+ D
Sbjct  482  HVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRD  541

Query  218  SSCDPASQWFKIID  177
             +CDPASQWFK++D
Sbjct  542  KTCDPASQWFKLVD  555



>ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera]
Length=552

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 160/200 (80%), Gaps = 0/200 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL GSYY REG +GLEEFYG+L WNWCE RN SFLQRIS +QSPF+GP
Sbjct  334  LAAELDFDWALWTLVGSYYTREGVIGLEEFYGLLNWNWCEVRNSSFLQRISALQSPFQGP  393

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +++R HK+IFHP TGLC+   S+F+PL LGPC ESD W YT  K L ++ TYFCLQA+
Sbjct  394  DLSDARPHKVIFHPATGLCIVWKSVFEPLTLGPCPESDAWSYTPQKTLIMKETYFCLQAD  453

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
              G P KLG+ CT+  SKWE ISDS+MHLS+KL DG+ VCLD+DS+N I+TN CKCL+ D
Sbjct  454  GPGNPGKLGIICTEPGSKWESISDSKMHLSTKLGDGTTVCLDIDSSNNIVTNACKCLSGD  513

Query  218  SSCDPASQWFKIIDSTRGTT  159
            + CDP SQWFKI+++T  +T
Sbjct  514  NKCDPGSQWFKIVNATNIST  533



>ref|XP_004504142.1| PREDICTED: uncharacterized protein LOC101503968 [Cicer arietinum]
Length=554

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 167/218 (77%), Gaps = 1/218 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA+LD DWALWTL GSYY R+G +G+EEFYG+L W+W + RN+SF+QRI+ +Q PF+GPG
Sbjct  337  AADLDLDWALWTLVGSYYFRQGVIGMEEFYGILNWDWTQLRNISFIQRIASLQLPFQGPG  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             TE   HKLIFHP+TGLCV R SL +PL LGPCS SD W Y+  K L+++GTYFC+QA+K
Sbjct  397  ITEGSPHKLIFHPLTGLCVIRKSLVEPLMLGPCSLSDGWNYSPQKTLSIKGTYFCIQAQK  456

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
             G PA L + C+D +S W++ISDS++HLSS + +G+ VCLDVD NNVI+TN CKCL+ND 
Sbjct  457  QGVPAILSIMCSDPNSIWDMISDSKLHLSSNINNGTKVCLDVDDNNVIVTNACKCLSNDH  516

Query  215  SCDPASQWFKIIDSTRG-TTTKSDFQSTSFLYFLAKKL  105
            +CDPASQWFK+IDS R   +T S     + L    K+L
Sbjct  517  TCDPASQWFKLIDSGRRLISTTSTLSELNLLELFMKRL  554



>ref|XP_011042368.1| PREDICTED: uncharacterized protein LOC105138075 [Populus euphratica]
Length=542

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYYLR+G VG+ E+YGVL  +W E RN +FLQ IS +QSPFRGP
Sbjct  339  VAAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLNLDWREVRNSTFLQLISAIQSPFRGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E+  HK+IFHP TGLCV R S+  PL LG C+ES+ W YT  K L+V+GTYFCLQ +
Sbjct  399  GLSEANPHKVIFHPSTGLCVLRKSMLAPLRLGRCAESEAWSYTPQKILSVKGTYFCLQTD  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             + KPAKLG+ CTD +SKWE ISDS+MHLSS    G+ VCLD+DSNN I+TNTCKCL+ D
Sbjct  459  DVAKPAKLGIICTDSNSKWETISDSKMHLSSNASSGTTVCLDIDSNNTIVTNTCKCLSKD  518

Query  218  SSCDPASQWFKIIDSTRGTT  159
            ++CDP SQWFK+++STR +T
Sbjct  519  NACDPESQWFKLVNSTRSST  538



>ref|XP_010100346.1| hypothetical protein L484_027655 [Morus notabilis]
 gb|EXB82480.1| hypothetical protein L484_027655 [Morus notabilis]
Length=559

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTL GSYY R+G VG+ E+YGVL W+W E RN S LQ+IS +Q PF+GP
Sbjct  343  VAAELDLDWALWTLVGSYYFRQGVVGMNEYYGVLNWDWNEIRNASVLQKISAIQYPFQGP  402

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E+R HK+IFHP TGLCV R S    L LGPCS+SD W YT  K L ++GTYFCLQ +
Sbjct  403  GLAETRKHKIIFHPSTGLCVVRKSFTDALTLGPCSKSDGWYYTPQKILEIKGTYFCLQVD  462

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             +GKPA+LG+ C +  SKWEIISDS++HL++K   G+ VCLDVDSNNV++TN CKCL+ D
Sbjct  463  DVGKPARLGIICMESDSKWEIISDSKLHLAAKTSSGTTVCLDVDSNNVVVTNLCKCLSRD  522

Query  218  SSCDPASQWFKIIDSTR  168
            SSCDP SQWF+++D+TR
Sbjct  523  SSCDPGSQWFQLVDTTR  539



>ref|XP_008389746.1| PREDICTED: uncharacterized protein LOC103452050 [Malus domestica]
Length=552

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D D+ALWTL GSYYLR+G VG+EE+YG+L W+W + RN S  QR+S++QSP +GPG
Sbjct  335  AAEFDVDFALWTLVGSYYLRQGVVGMEEYYGILNWDWSDIRNSSLTQRLSVLQSPLQGPG  394

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
              +SR+HK+IFHP TGLC+ +V    PL+LGPCS+S  W Y++ K LT++GTYFC+QA+K
Sbjct  395  LAQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCSQSGAWAYSSRKVLTLKGTYFCIQADK  454

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            L KPA +G+ CT  +S+W+IISDS++HL SK  DG+ VCLDVDS+N ++TN+C CL+ DS
Sbjct  455  LNKPAAVGIJCTTRNSQWDIISDSKLHLQSKTMDGTEVCLDVDSSNTVVTNSCNCLSRDS  514

Query  215  SCDPASQWFKIIDSTRGTTTKS  150
            SCDP +QWFK++DST  ++ KS
Sbjct  515  SCDPGNQWFKLVDSTINSSPKS  536



>ref|XP_007159685.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
 gb|ESW31679.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
Length=565

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D DWALWTL GSYY R+G VG+EEFYG+L W+W + RN SFL RIS +Q PFRGP
Sbjct  343  VAAEHDLDWALWTLVGSYYFRQGVVGMEEFYGILNWDWNQVRNASFLNRISSLQLPFRGP  402

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G T+   +KLI+HP+TGLCV R +L +PL LGPC+ SD W YT  K L+V+GTYFC+ AE
Sbjct  403  GITKGNPYKLIYHPLTGLCVIRKTLLEPLTLGPCNLSDGWKYTPQKILSVKGTYFCIHAE  462

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
              G  A LG+ C+D +S+WE++SDS++HLSSKL DGS+VCLDVD NN+I+TN CKCL+ D
Sbjct  463  NEGMAATLGIICSDSNSRWEMVSDSKLHLSSKLSDGSDVCLDVDDNNIIVTNACKCLSRD  522

Query  218  SSCDPASQWFKIIDSTR  168
             +CDP+SQWFK+IDS R
Sbjct  523  HTCDPSSQWFKLIDSGR  539



>ref|XP_009359244.1| PREDICTED: uncharacterized protein LOC103949843 [Pyrus x bretschneideri]
Length=552

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD D++LWTL GSYY REG VG EE+YG+L W+W + RN S  QR+S++QSP +GPG
Sbjct  335  AAELDVDFSLWTLVGSYYFREGVVGTEEYYGILNWDWSDIRNSSLTQRLSVLQSPLQGPG  394

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             ++SR+HK+IFHP TGLC+ +V    PL+LGPCS+S  W Y++ K LT++GTYFC+QA++
Sbjct  395  LSQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCSQSGAWTYSSRKVLTLKGTYFCIQADE  454

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            L KPA +G+ CT  +S+W+IISDS++HL SK  DG+ VCLDVDS+N ++T++CKCL+ D+
Sbjct  455  LNKPAAVGILCTTTNSQWDIISDSKLHLQSKTTDGTEVCLDVDSSNTVVTSSCKCLSRDN  514

Query  215  SCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFL  117
            SCDPASQWFK++DST  TT T    + TS ++ +
Sbjct  515  SCDPASQWFKLVDSTINTTPTSPILEITSVVHMI  548



>gb|KHN29014.1| Endoglucanase [Glycine soja]
Length=533

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 148/197 (75%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            L AELD DWA WTL GSYY REG +G+EEFYG+LTW+W + R+ SFL RIS +Q PFRGP
Sbjct  312  LVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWTQVRSTSFLNRISALQIPFRGP  371

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E   +KLIFHP+TGLCV   S    L LGPCS SD W YT  K L +  T FC+ AE
Sbjct  372  GIIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCSSSDAWTYTPQKTLLINNTNFCIHAE  431

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            + GKPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+T  CKCLN D
Sbjct  432  QEGKPATLSITCSDANSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTTACKCLNQD  491

Query  218  SSCDPASQWFKIIDSTR  168
             +CDPASQWFK+IDS R
Sbjct  492  KTCDPASQWFKLIDSGR  508



>ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max]
Length=574

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 148/197 (75%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            L AELD DWA WTL GSYY REG +G+EEFYG+LTW+W + R+ SFL RIS +Q PFRGP
Sbjct  353  LVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWTQVRSTSFLNRISALQIPFRGP  412

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E   +KLIFHP+TGLCV   S    L LGPCS SD W YT  K L +  T FC+ AE
Sbjct  413  GIIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCSSSDAWTYTPQKTLLINNTNFCIHAE  472

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            + GKPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+T  CKCLN D
Sbjct  473  QEGKPATLSITCSDANSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTTACKCLNQD  532

Query  218  SSCDPASQWFKIIDSTR  168
             +CDPASQWFK+IDS R
Sbjct  533  KTCDPASQWFKLIDSGR  549



>ref|XP_010044528.1| PREDICTED: uncharacterized protein LOC104433472 [Eucalyptus grandis]
 gb|KCW86615.1| hypothetical protein EUGRSUZ_B03243 [Eucalyptus grandis]
Length=560

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 166/223 (74%), Gaps = 0/223 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LDFDWALWTL GSYYLREG VG+ E+YG L  NW E RN S  QR   +Q P +GP
Sbjct  336  VAADLDFDWALWTLVGSYYLREGVVGMIEYYGALDENWAELRNSSLFQRFRALQPPLKGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E+  HK+IFHP TGLCV R SL +P++LGPC+ES+ W YT  K L+++ TYFC+QA 
Sbjct  396  GLSETTPHKVIFHPATGLCVLRKSLLEPMKLGPCTESEAWNYTPQKVLSLKATYFCIQAV  455

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            ++GKPAKLG+ CT  +SKW+IIS+S+MHLSS   +G++VCLDVDS+N I+T++CKCL+ D
Sbjct  456  EVGKPAKLGIICTGSNSKWDIISESKMHLSSNTSNGASVCLDVDSDNTIVTSSCKCLSRD  515

Query  218  SSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFASYI  90
            S CDP+SQWFK+++STR       F   + +  L +K    ++
Sbjct  516  SKCDPSSQWFKLVESTRSLCATRTFDLLNSILDLPRKGLVGFL  558



>gb|KHN29015.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=826

 Score =   285 bits (728),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 162/212 (76%), Gaps = 2/212 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELD DWALWTL GSYY R+G +G+EEFYG+L+W+W + RN +FL RIS +Q PFRGP
Sbjct  607  LAAELDLDWALWTLVGSYYFRQGVIGMEEFYGILSWDWIQVRNTTFLNRISALQLPFRGP  666

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G T    +KLIFHP+TGLCV R SL   L LGPC  SD W YT  K L+++GTYFC+QAE
Sbjct  667  GITRGNPYKLIFHPLTGLCVIRKSLLDRLTLGPCYLSDGWKYTPQKILSIKGTYFCMQAE  726

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
              G PA LG+ C+D +S+WE+ISDS++HLSSKL D SNVCLDVD NN I+TN CKCL+ D
Sbjct  727  SEGMPATLGIMCSDPNSRWEMISDSKLHLSSKLSDDSNVCLDVDDNNNIVTNACKCLSKD  786

Query  218  SSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY  123
             +CDP+SQWFK+IDS  G+ +     ++S LY
Sbjct  787  RTCDPSSQWFKLIDS--GSRSMLTTSTSSMLY  816



>ref|XP_004309996.1| PREDICTED: uncharacterized protein LOC101307271 [Fragaria vesca 
subsp. vesca]
Length=550

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 164/219 (75%), Gaps = 1/219 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA+LD ++ALWTL GSYYLR G +G+ E+YG+L WNW E RN S LQR+S++QSPF+GPG
Sbjct  332  AAQLDVEYALWTLVGSYYLRSGVLGMNEYYGLLNWNWGEIRNSSLLQRLSVLQSPFQGPG  391

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             +E R HK+I HP TGLC+ +V    PL+LGPCS+S  W Y++ K L ++GTYFC+QA++
Sbjct  392  LSEVRKHKIILHPSTGLCLLKVGFMGPLKLGPCSQSGAWSYSSRKVLALKGTYFCIQADQ  451

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            LGKPA +G+ CTD +S+W+ ISDS++HL SK  DG+ VCLDVDS+N I+TN+CKCL+ D 
Sbjct  452  LGKPAAVGIICTDTNSQWDTISDSKLHLQSKTPDGTEVCLDVDSSNTIVTNSCKCLSKDK  511

Query  215  SCDPASQWFKIIDSTRGTTTKSD-FQSTSFLYFLAKKLF  102
            SCDP SQWF ++DST  + + S   Q  S L  L   + 
Sbjct  512  SCDPGSQWFSLVDSTLTSKSTSPILQVNSVLDMLGMNVL  550



>gb|KEH20742.1| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=558

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 153/194 (79%), Gaps = 1/194 (1%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD DWALWTL GSYY R+G +G+EEFYG+  W+W + RN SFLQRI+ +Q PF+GPG
Sbjct  336  AAELDLDWALWTLVGSYYFRQGVIGMEEFYGIFNWDWTQVRNASFLQRIASLQLPFQGPG  395

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             T    HKL+FHP TGLCV R SL +PL+L PCS SD W YT  K L+V+GTYFC+QA K
Sbjct  396  ITVGNPHKLLFHPSTGLCVIRKSLLEPLKLDPCSLSDGWNYTPQKILSVKGTYFCIQAVK  455

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGS-NVCLDVDSNNVIITNTCKCLNND  219
             G PA L + C++ +SKW++ISDS++HLSSK+  GS NVCLDV+ NN+I+TN CKCL+ND
Sbjct  456  EGMPATLSILCSNPNSKWDMISDSKLHLSSKINSGSTNVCLDVNDNNIIVTNACKCLSND  515

Query  218  SSCDPASQWFKIID  177
             SCDP SQWFK+ID
Sbjct  516  HSCDPGSQWFKLID  529



>ref|XP_004170960.1| PREDICTED: uncharacterized LOC101217177, partial [Cucumis sativus]
Length=421

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWA+WTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS +QSPF+GP
Sbjct  198  VAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQSPFQGP  257

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E R + +IFHP++GLCV R SL  PL LGPC ++D W YT  K LT++GTYFC+QA+
Sbjct  258  GLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQKFLTLKGTYFCIQAD  317

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNN  222
            ++GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVDS+ N I+TN+CKCL+ 
Sbjct  318  EIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDSSTNEIVTNSCKCLSR  377

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSCDP+SQWFK+++STR
Sbjct  378  DSSCDPSSQWFKLVNSTR  395



>gb|KHN19917.1| hypothetical protein glysoja_032397 [Glycine soja]
Length=464

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            L A+LD DWALWTL G+YY+R+G VG+EE++G+L  +W + RN SFLQRIS +Q PF+GP
Sbjct  257  LVAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILNSDWIQVRNTSFLQRISAIQLPFKGP  316

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPL-ELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G +E++ +K+IFHP+TGLC+ R S  +PL  LGPCS SD W YT  K L+++GTYFCLQA
Sbjct  317  GLSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPCSNSDAWEYTDQKILSIKGTYFCLQA  376

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
            E+ GK AKLG  C+  +S+WE+ISDS+MHLS++  + S VCLDVD+NN+I+TN C+CL+ 
Sbjct  377  EEEGKQAKLGNACSGSNSRWEMISDSKMHLSTQTNNASGVCLDVDTNNIIVTNICQCLSK  436

Query  221  DSSCDPASQWFKIIDSTR  168
            D++CDPA+QWFK++DSTR
Sbjct  437  DNTCDPATQWFKLVDSTR  454



>ref|XP_008446127.1| PREDICTED: uncharacterized protein LOC103488945 [Cucumis melo]
Length=554

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D DWALWTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS++Q+P +GP
Sbjct  329  VAAEFDLDWALWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISVLQTPLQGP  388

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E R + LIFHP++GLCV R SL  PL LGPC +SD W YT  K LT++GTYFC+QA+
Sbjct  389  GLAERREYNLIFHPLSGLCVVRKSLLDPLRLGPCVDSDAWYYTPQKFLTLKGTYFCIQAD  448

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNN  222
            ++GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVD+N N I+TN+CKCL+ 
Sbjct  449  EIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDANTNEIVTNSCKCLSR  508

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSCDP+SQWFK+++STR
Sbjct  509  DSSCDPSSQWFKLVNSTR  526



>ref|XP_003539156.1| PREDICTED: uncharacterized protein LOC100816102 [Glycine max]
Length=544

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            L A+LD DWALWTL G+YY+R+G VG+EE++G+L  +W + RN SFLQRIS +Q PF+GP
Sbjct  337  LVAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILNSDWIQVRNTSFLQRISAIQLPFKGP  396

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPL-ELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G +E++ +K+IFHP+TGLC+ R S  +PL  LGPCS SD W YT  K L+++GTYFCLQA
Sbjct  397  GLSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPCSNSDAWEYTDQKILSIKGTYFCLQA  456

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
            E+ GK AKLG  C+  +S+WE+ISDS+MHLS++  + S VCLDVD+NN+I+TN C+CL+ 
Sbjct  457  EEEGKQAKLGNACSGSNSRWEMISDSKMHLSTQTNNASGVCLDVDTNNIIVTNICQCLSK  516

Query  221  DSSCDPASQWFKIIDSTR  168
            D++CDPA+QWFK++DSTR
Sbjct  517  DNTCDPATQWFKLVDSTR  534



>ref|XP_003524249.1| PREDICTED: uncharacterized protein LOC100789885 [Glycine max]
Length=571

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 152/216 (70%), Gaps = 4/216 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            L AELD DWA WTL GSYY REG +G+EEFYG+LTW+W + R+ SFL RIS +Q PFRGP
Sbjct  350  LVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLTWDWNQVRSTSFLNRISALQIPFRGP  409

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E   HKLIFHP+TGLCV   S    L L  CS SD W YT  K L V  T FC+ AE
Sbjct  410  GIIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACSSSDAWTYTPQKTLLVNNTDFCIHAE  469

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +  KPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+TN CKCL+ D
Sbjct  470  EERKPATLSMTCSDPNSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTNACKCLSKD  529

Query  218  SSCDPASQWFKIIDSTR----GTTTKSDFQSTSFLY  123
             +CDP SQWFK+IDS R     T+T S   S   L+
Sbjct  530  KTCDPGSQWFKLIDSGRRSISTTSTLSMLNSPDLLW  565



>gb|KGN51727.1| hypothetical protein Csa_5G593400 [Cucumis sativus]
Length=550

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWA+WTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS +QSPF+GP
Sbjct  327  VAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQSPFQGP  386

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E R + +IFHP++GLCV R SL  PL LGPC ++D W YT  K LT++GTYFC+QA+
Sbjct  387  GLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQKFLTLKGTYFCIQAD  446

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNN  222
            ++GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVDS+ N I+TN+CKCL+ 
Sbjct  447  EIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDSSTNEIVTNSCKCLSR  506

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSCDP+SQWFK+++STR
Sbjct  507  DSSCDPSSQWFKLVNSTR  524



>ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus]
Length=549

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWA+WTL GSYYLREG VGL EFYG+L WNWC  RN +FLQRIS +QSPF+GP
Sbjct  326  VAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILDWNWCNLRNSTFLQRISALQSPFQGP  385

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E R + +IFHP++GLCV R SL  PL LGPC ++D W YT  K LT++GTYFC+QA+
Sbjct  386  GLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCVDTDAWYYTPQKFLTLKGTYFCIQAD  445

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNN  222
            ++GK AKLG+ CT +++KW++ISDS++HLSSK  +GS VCLDVDS+ N I+TN+CKCL+ 
Sbjct  446  EIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSNGSLVCLDVDSSTNEIVTNSCKCLSR  505

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSCDP+SQWFK+++STR
Sbjct  506  DSSCDPSSQWFKLVNSTR  523



>gb|KHN06534.1| Endoglucanase [Glycine soja]
Length=566

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 152/216 (70%), Gaps = 4/216 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            L AELD DWA WTL GS+Y REG +G+EEFYG+L+W+W + R+ SFL RIS +Q PFRGP
Sbjct  345  LVAELDLDWAYWTLVGSHYFREGVIGMEEFYGLLSWDWNQVRSTSFLNRISALQIPFRGP  404

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E   HKLIFHP+TGLCV   S    L L  CS SD W YT  K L V  T FC+ AE
Sbjct  405  GIIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACSSSDAWTYTPQKTLLVNNTDFCIHAE  464

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +  KPA L + C+D +SKWE+ISDS MHLSSKL DGSN+CLDVD NN+I+TN CKCL+ D
Sbjct  465  EERKPATLSMTCSDPNSKWEMISDSNMHLSSKLSDGSNLCLDVDDNNIIVTNACKCLSKD  524

Query  218  SSCDPASQWFKIIDSTR----GTTTKSDFQSTSFLY  123
             +CDP SQWFK+IDS R     T+T S   S   L+
Sbjct  525  KTCDPGSQWFKLIDSGRRSISTTSTLSMLNSPDLLW  560



>ref|XP_007132485.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
 gb|ESW04479.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
Length=530

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 154/197 (78%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
             AA+LD DWALWTL GSYY+R+G VG+ E YG+L  +W E  N SFLQRIS +Q PFRGP
Sbjct  332  FAAQLDLDWALWTLGGSYYIRKGVVGMNESYGILNSDWSEVSNPSFLQRISAIQIPFRGP  391

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +E++  K+IFHP+TG C+ R SL + L LGPCS SD W YT    L+++GT FCLQAE
Sbjct  392  GLSEAKPFKVIFHPLTGFCIIRKSLVEALRLGPCSNSDGWEYTEQNILSIKGTNFCLQAE  451

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
              GK AK+G  C   +S+WE+ISDS+MHLS+++ + S +CLDVD+NN+I+TNTCKCL+ D
Sbjct  452  GEGKQAKIGNICLAPNSRWEMISDSKMHLSTQINNSSGLCLDVDNNNIIVTNTCKCLSKD  511

Query  218  SSCDPASQWFKIIDSTR  168
            ++C+PASQWFK++DSTR
Sbjct  512  NTCEPASQWFKVVDSTR  528



>ref|XP_008221942.1| PREDICTED: uncharacterized protein LOC103321869 [Prunus mume]
Length=584

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD D+ALWTL GSYYL++G +G+ E+YGVL W+W + RN S  QR+S++QSPF+GPG
Sbjct  380  AAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLNWDWSDVRNSSLSQRLSVLQSPFQGPG  439

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             ++SRLHK+IFHP TGLC+ +V    PL+LG CS+S  W Y++ K LT++GTYFC+Q ++
Sbjct  440  LSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCSQSGAWSYSSKKILTLKGTYFCIQVDE  499

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            L KPA++G+ CT  +S+W+ ISDS +HLSSK  DG++VCLDVDS+N I+T++CKCL  DS
Sbjct  500  LEKPAQVGIICTTPNSQWDTISDSGLHLSSKTLDGTDVCLDVDSSNTIVTSSCKCLGRDS  559

Query  215  SCDPASQWFKIID  177
            SCDP SQWFK++D
Sbjct  560  SCDPESQWFKLVD  572



>ref|XP_007159684.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
 gb|ESW31678.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
Length=573

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 153/208 (74%), Gaps = 4/208 (2%)
 Frame = -3

Query  734  WALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLH  555
            WA WTL GSYY+REG VG+EE YGVLTW+W + R++SFL RIS +Q PFRGPG  E   +
Sbjct  360  WAYWTLVGSYYIREGVVGMEEVYGVLTWDWNQVRSISFLNRISALQHPFRGPGIIEGNSY  419

Query  554  KLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKL  375
            KL+FHP+TGLCV R S    L LGPCS SD W YT+ K+L V  T  C+  E+  KPA L
Sbjct  420  KLMFHPVTGLCVIRKSQVNTLTLGPCSSSDGWKYTSQKSLLVNDTNLCIHGERERKPATL  479

Query  374  GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQ  195
               C+D SSKWE+ISDS MHLSSKL DGSNVCLDVD++N+I+TNTCKCL+ D+ CDP +Q
Sbjct  480  STACSDSSSKWEVISDSNMHLSSKLSDGSNVCLDVDADNIIVTNTCKCLSKDNKCDPGTQ  539

Query  194  WFKIIDSTR----GTTTKSDFQSTSFLY  123
            WFK+IDS R     T+T S   S++ L+
Sbjct  540  WFKLIDSGRRSISTTSTMSILDSSNLLW  567



>ref|XP_007223308.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
 gb|EMJ24507.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
Length=547

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 157/193 (81%), Gaps = 0/193 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD D+ALWTL GSYYL++G +G+ E+YGVL W+W + RN S  QR+S++QSPF+GPG
Sbjct  343  AAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLNWDWSDIRNSSLSQRLSVLQSPFQGPG  402

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             ++SRLHK+IFHP TGLC+ +V    PL+LG CS+S  W Y++ K L+++GTYFC+QA++
Sbjct  403  LSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCSQSGAWSYSSKKILSLKGTYFCIQADE  462

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            L KPA++G+ CT  +S+W+ ISDS +HLSSK  +G++VCLDVDS+N I+ ++CKCL  DS
Sbjct  463  LEKPAQVGIICTTPNSQWDTISDSGLHLSSKTLNGTDVCLDVDSSNTIVASSCKCLGRDS  522

Query  215  SCDPASQWFKIID  177
            SCDP SQWFK++D
Sbjct  523  SCDPESQWFKLVD  535



>gb|EPS61076.1| hypothetical protein M569_13724, partial [Genlisea aurea]
Length=411

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWALWTLAGSYYLREG VG  E YGV +++W + RN + L +I+ +Q PFRGPG
Sbjct  201  AAEQDLDWALWTLAGSYYLREGVVGYNETYGVYSFDWNQIRNGTILSKIASLQYPFRGPG  260

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
            Y E  +HK++FHP TGLCV+R SL   L LGPC E++ W  T  K LTV+GT FCL+A++
Sbjct  261  YEEVPVHKVLFHPSTGLCVKRASLLDALALGPCVEAEAWSNTTEKTLTVDGTPFCLEADE  320

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN-D  219
             GKPAKL + C   ++KWE ISDS+MHLS+ L+DGS VCL +DS+N IIT++CKCL++ +
Sbjct  321  SGKPAKLSVICDGQNTKWETISDSKMHLSATLEDGSKVCLSIDSDNNIITDSCKCLDDTN  380

Query  218  SSCDPASQWFKIIDSTR  168
            S+CDP +QWFKIIDSTR
Sbjct  381  STCDPGNQWFKIIDSTR  397



>ref|XP_008236799.1| PREDICTED: uncharacterized protein LOC103335561 [Prunus mume]
Length=544

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 157/198 (79%), Gaps = 2/198 (1%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAELD D+ALWTL GSYYLR+G +G+ E+YGVL  +W + RN S  QR+S++QSPF+GP 
Sbjct  341  AAELDLDFALWTLVGSYYLRDGVLGMNEYYGVLNSDWSDIRNSSLSQRLSVLQSPFQGPD  400

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA--GKALTVEGTYFCLQA  402
             ++S  HK+IFHP TGLC+ +V    PL+LGPCS+S PW Y++   K LT++G+Y CLQ 
Sbjct  401  ISQSSWHKIIFHPATGLCLVQVGQLAPLKLGPCSQSGPWIYSSQTQKFLTLQGSYLCLQV  460

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
            ++L KPAKLG+ C   +S+W+ ISDS +HLSSK  +G+NVCLDVDS+N I+TN+CKCL+ 
Sbjct  461  DELEKPAKLGVICRPPNSQWDTISDSGLHLSSKTLNGTNVCLDVDSSNTIVTNSCKCLSR  520

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSC+P SQWFK++DSTR
Sbjct  521  DSSCNPESQWFKLVDSTR  538



>ref|XP_010904543.1| PREDICTED: uncharacterized protein LOC105031942 [Elaeis guineensis]
Length=563

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 159/205 (78%), Gaps = 2/205 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALW L GSYY+REG  GL+E YGVL W+WC+ RN S LQRI  +Q+PF+GP
Sbjct  335  VAAELDLDWALWALQGSYYIREGIRGLDEVYGVLAWDWCKTRNSSMLQRIQAIQAPFQGP  394

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G ++ + + +IFHP TGLCV + SLF+PLELGPC+ES+ W ++A + + ++ T  CL+A+
Sbjct  395  GLSDIQPYTIIFHPSTGLCVLKKSLFEPLELGPCNESEAWTFSAEQTIALKDTLLCLKAD  454

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSN-NVIITNTCKCLN  225
              GKPAKLG+ C+D  SKWE+ISDS+MH+S+ +  + S++CLDVDS+   I+TN CKCL+
Sbjct  455  GAGKPAKLGIICSDTQSKWELISDSKMHVSTNISSNASSLCLDVDSDGKSIVTNPCKCLS  514

Query  224  NDSSCDPASQWFKIIDSTRGTTTKS  150
             D SCDP SQWFK++DSTR T  K+
Sbjct  515  KDQSCDPESQWFKMVDSTRPTIYKN  539



>gb|KHG22500.1| Endoglucanase E1 [Gossypium arboreum]
Length=524

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 154/211 (73%), Gaps = 3/211 (1%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             AELD DWALWTL GSYYLREG +GL E+YG++ WNW + RN SF++RIS +QSPFRG G
Sbjct  277  VAELDLDWALWTLVGSYYLREGVIGLNEYYGIMDWNWIDMRNSSFVERISALQSPFRGLG  336

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             +E+ LHK+IFHP+TGLCV R      L LGPC++S+ W Y+  K L ++GT  CLQA++
Sbjct  337  LSETELHKVIFHPLTGLCVLRKQSGSSLSLGPCTDSEAWNYSPQKTLELKGTQLCLQADE  396

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
             G   KLG  C   +S+WE ISDS+MHLS KL + ++VC+D+DSNN ++   CKCLN+DS
Sbjct  397  PGTMVKLGTICGGSNSRWETISDSKMHLSLKLGNVTSVCMDIDSNNNVVVADCKCLNDDS  456

Query  215  SCDPASQWFKIIDSTR---GTTTKSDFQSTS  132
             CDP SQWFK+++STR   G  +  DF S +
Sbjct  457  QCDPKSQWFKLVNSTRSGNGGNSFVDFDSIT  487



>gb|KJB78033.1| hypothetical protein B456_012G173600 [Gossypium raimondii]
Length=579

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 154/219 (70%), Gaps = 0/219 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            + AELD DWALWTL GSYYLREG +G  E+YG+L WNW + RN SF++RIS +QSPFRG 
Sbjct  331  MVAELDLDWALWTLVGSYYLREGVIGFNEYYGILDWNWIDMRNSSFVERISALQSPFRGL  390

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E+ LHK+IFHP+TGLCV R      L LGPC++S+ W Y+  K L ++GT  CLQA+
Sbjct  391  GLLETELHKVIFHPLTGLCVLRKPSGSSLSLGPCTDSEAWNYSPQKTLELKGTQLCLQAD  450

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            + G   KLG  C   +S+WE ISDS+MHLS KL + ++VC+D+DSNN I+   CKCLN+D
Sbjct  451  EPGTMVKLGTICGGSNSRWETISDSKMHLSLKLGNVTSVCMDIDSNNDIVVAGCKCLNDD  510

Query  218  SSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLF  102
            S CDP SQWFK+++STR     + F     +    K++F
Sbjct  511  SQCDPKSQWFKLVNSTRSGNGGNSFVDFDSITDFGKRVF  549



>ref|XP_010250986.1| PREDICTED: uncharacterized protein LOC104593039 [Nelumbo nucifera]
Length=583

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 159/203 (78%), Gaps = 3/203 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LD+DWALWTL G YYLR+G VG++E YGVL+W+W   RN +F+Q+IS +QSPF+GP
Sbjct  331  VAAQLDWDWALWTLVGRYYLRQGVVGMDETYGVLSWDWNNIRNSTFVQQISALQSPFQGP  390

Query  578  GYT-ESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQ  405
            G + E   HK+IFHP TGLCV R SL  + L+LG C+ES+ W YT  K L+++ T  CLQ
Sbjct  391  GLSSEVTPHKVIFHPSTGLCVVRKSLMMELLKLGSCTESEAWSYTPEKTLSLKDTNLCLQ  450

Query  404  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCL  228
            A++LG+ AKLG+ C+D SS+W++ISDS+MH+SS L +GS VC+DVDSN N IIT+ CKCL
Sbjct  451  ADELGEAAKLGIICSDLSSRWDMISDSKMHISSNLTNGSTVCIDVDSNTNTIITSQCKCL  510

Query  227  NNDSSCDPASQWFKIIDSTRGTT  159
              D +CDP+ QWF I++STR TT
Sbjct  511  TKDHTCDPSGQWFIIVNSTRSTT  533



>ref|XP_004504189.1| PREDICTED: uncharacterized protein LOC101490831 [Cicer arietinum]
Length=527

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA+ D DWALWTLAGSYY+ +G  G+EE YG+L  +W +PRN +FLQR++ +Q PFRGPG
Sbjct  335  AADQDLDWALWTLAGSYYINQGVFGVEEVYGILNSDWTKPRNPTFLQRLASLQLPFRGPG  394

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
             T+ + +KLI+HP+TGLCV R S  QPL+L  CS S+ W Y   K L++  +++C+QA  
Sbjct  395  ITQGKPYKLIYHPLTGLCVARKSKLQPLKLNACSYSNGWNYKPQKTLSIYRSHYCIQAMN  454

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
             GKPA +   C    S W++ISDS +HLS+ + +G+NVCLDVD NNVI+TN CKCL+NDS
Sbjct  455  QGKPAIISKSC----STWDMISDSTLHLSTNINNGTNVCLDVDHNNVIVTNACKCLSNDS  510

Query  215  SCDPASQWFKIIDSTR  168
            +CDPASQWFK+IDS +
Sbjct  511  TCDPASQWFKLIDSGK  526



>ref|XP_009385963.1| PREDICTED: uncharacterized protein LOC103973176 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=556

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 146/198 (74%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
             AAE D DWALW L GSYY+REG +GL+E YG L+W+WC+ RN SF+QR+S +QSPF+GP
Sbjct  339  FAAEKDIDWALWALQGSYYIREGQLGLDETYGALSWDWCKARNSSFIQRLSAIQSPFQGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G ++S  + +IFHP TGLC+   S  + L+LG C+ES  W YT  K L ++GT +CLQ E
Sbjct  399  GLSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCAESTAWRYTRQKKLMLKGTKYCLQPE  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  222
             + KPAKLG  C   S+KW +IS S+MH+SS L  +G+NVCLD+D N  I+TN CKCL+ 
Sbjct  459  GVSKPAKLGFGCKVSSAKWHLISSSKMHISSNLTNNGNNVCLDIDDNGTIMTNQCKCLSL  518

Query  221  DSSCDPASQWFKIIDSTR  168
            D +C+P SQWFKII S+R
Sbjct  519  DGTCNPGSQWFKIIRSSR  536



>gb|KHN43979.1| Endoglucanase E1 [Glycine soja]
Length=471

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 151/201 (75%), Gaps = 7/201 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LDFDWA WTLAGSYYLREGTVGL E YG+LT N   P     LQRIS +Q P+RGP
Sbjct  277  LAAQLDFDWAYWTLAGSYYLREGTVGLIEVYGILTQNTTLPTTTFLLQRISAIQLPYRGP  336

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEG-TYFCLQA  402
            G +E   HK+IFHP+TGLC+      +PL+LGPCS S+ W YTA K L+V+G    CLQA
Sbjct  337  GLSEVEAHKVIFHPLTGLCIS--GKLEPLKLGPCSNSEGWEYTAQKVLSVKGRNSTCLQA  394

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
            E  GK AKLG  C    S WEI+SDS++HLSSK+ + S+VCLDVDSNN I+TN CKCL+ 
Sbjct  395  EGEGKEAKLGNEC----SVWEIVSDSKLHLSSKINNASDVCLDVDSNNNIVTNACKCLSG  450

Query  221  DSSCDPASQWFKIIDSTRGTT  159
            D +CDPASQWFK++DSTR +T
Sbjct  451  DKTCDPASQWFKLVDSTRKST  471



>ref|XP_009385956.1| PREDICTED: uncharacterized protein LOC103973176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 146/198 (74%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
             AAE D DWALW L GSYY+REG +GL+E YG L+W+WC+ RN SF+QR+S +QSPF+GP
Sbjct  339  FAAEKDIDWALWALQGSYYIREGQLGLDETYGALSWDWCKARNSSFIQRLSAIQSPFQGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G ++S  + +IFHP TGLC+   S  + L+LG C+ES  W YT  K L ++GT +CLQ E
Sbjct  399  GLSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCAESTAWRYTRQKKLMLKGTKYCLQPE  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLNN  222
             + KPAKLG  C   S+KW +IS S+MH+SS L  +G+NVCLD+D N  I+TN CKCL+ 
Sbjct  459  GVSKPAKLGFGCKVSSAKWHLISSSKMHISSNLTNNGNNVCLDIDDNGTIMTNQCKCLSL  518

Query  221  DSSCDPASQWFKIIDSTR  168
            D +C+P SQWFKII S+R
Sbjct  519  DGTCNPGSQWFKIIRSSR  536



>ref|XP_008793719.1| PREDICTED: uncharacterized protein LOC103709945 [Phoenix dactylifera]
Length=530

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 155/212 (73%), Gaps = 2/212 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALW L G+YY+REG +GL+E YGVL W+WC+ RN S LQRI  +Q+PF+GP
Sbjct  311  VAAELDLDWALWALQGNYYVREGNLGLDEVYGVLAWDWCKIRNSSMLQRIQSIQAPFQGP  370

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G +  + + +IFHP TGLCV + SLF+PL LGPC+ES+ W +TA + + ++ T  CL+A+
Sbjct  371  GLSSMQPYTIIFHPSTGLCVLKKSLFEPLGLGPCNESEAWTFTADQTIALKDTLICLKAD  430

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHL-SSKLKDGSNVCLDVDSN-NVIITNTCKCLN  225
               KPAKLG+ C+D  SKWE+ISDS+MH+ +    + S++CLDV S+   I+TN C+CL+
Sbjct  431  GESKPAKLGIICSDTRSKWELISDSKMHVSTKSSSNSSSLCLDVGSDGRSIVTNPCRCLS  490

Query  224  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTSF  129
             D SCDP SQWFK+++STR T  K+      F
Sbjct  491  KDQSCDPESQWFKMVNSTRPTINKNSLMELQF  522



>gb|AES72136.2| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=608

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 152/207 (73%), Gaps = 6/207 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWA WTL+GSYY+R+G V ++E +G+L  NW + RN SFLQRIS +Q PF+GP
Sbjct  337  VAAELDLDWAYWTLSGSYYIRQGVVDVDETFGILNGNWSQVRNTSFLQRISAIQHPFQGP  396

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  ES  +K+IFHP+ GLCV   SL +PL++GPCS SD W YT    L ++GT FCLQ E
Sbjct  397  GLLESEPYKVIFHPLRGLCVLSKSLHEPLKMGPCSNSDGWEYTPQNILLLKGTKFCLQGE  456

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG---SNVCLDVDSNNVIITNTCKCL  228
              GK  KLG  C+   S WE+ISDS+MHLS  + +    S+VCLDVD+NN+++TN+CKC+
Sbjct  457  GEGKQVKLGTTCSGPESTWEMISDSKMHLSYNVNNNGSTSSVCLDVDANNIVVTNSCKCI  516

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSD  147
            +  ++CDPASQWFK++D    +TT SD
Sbjct  517  SKVNTCDPASQWFKLVDR---STTSSD  540



>ref|XP_003552802.1| PREDICTED: uncharacterized protein LOC100805196 [Glycine max]
Length=533

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 151/201 (75%), Gaps = 7/201 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LDFDWA WTLAGSYYLREGTVGL E YG+LT N   P     LQRIS +Q P+RGP
Sbjct  339  LAAQLDFDWAYWTLAGSYYLREGTVGLIEVYGILTQNTTLPTTTFLLQRISAIQLPYRGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEG-TYFCLQA  402
            G +E   HK+IFHP+TGLC+      +PL+LGPCS S+ W YTA K L+V+G    CLQA
Sbjct  399  GLSEVEAHKVIFHPLTGLCIS--GKLEPLKLGPCSNSEGWEYTAQKVLSVKGRNSTCLQA  456

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
            E  GK AKLG  C    S WEI+SDS++HLSSK+ + S+VCLDVDSNN I+TN CKCL+ 
Sbjct  457  EGEGKEAKLGNEC----SVWEIVSDSKLHLSSKINNASDVCLDVDSNNNIVTNACKCLSG  512

Query  221  DSSCDPASQWFKIIDSTRGTT  159
            D +CDPASQWFK++DSTR +T
Sbjct  513  DKTCDPASQWFKLVDSTRKST  533



>ref|XP_008389747.1| PREDICTED: uncharacterized protein LOC103452051 [Malus domestica]
Length=545

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            A ELD D+A W+L GSYYLR+G  G++E+YG+L  +W   RN S  Q+IS++Q+  +G G
Sbjct  331  AVELDVDFAQWSLVGSYYLRQGVKGMKEYYGILNSDWSGIRNSSLTQKISVLQTSIKGAG  390

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
                RLHK+IFHP TGLC+ +V    PL+LGPCS++  W Y++ K L +    FC+QA++
Sbjct  391  LHTPRLHKIIFHPATGLCLLKVGTRGPLKLGPCSQTQGWTYSSTKVLLLNKNEFCIQADQ  450

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            L KPA LG+ CT  +S+WE ISDS+MHL SK  DG+ VCLDVDS+  I+TN CKCL+ DS
Sbjct  451  LNKPAVLGIPCTTPNSRWETISDSQMHLQSKTTDGTEVCLDVDSDKTIVTNACKCLSGDS  510

Query  215  SCDPASQWFKIIDS  174
            SCDPASQWFK++DS
Sbjct  511  SCDPASQWFKVVDS  524



>emb|CAN62580.1| hypothetical protein VITISV_036569 [Vitis vinifera]
Length=221

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 139/199 (70%), Gaps = 19/199 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL             EE  G++ WN       SF QRIS +QSP +GP
Sbjct  34   LAAELDFDWALWTL-------------EETNGLMNWN------SSFFQRISALQSPLQGP  74

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+IFHP TGLC+ R S  +PL+LGPC++S+ WGYT  K LTV+GTYFCLQA 
Sbjct  75   DVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTKSEAWGYTPQKLLTVKGTYFCLQAV  134

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL   
Sbjct  135  GLGKPAKLSIICTKPGSNWEIISDSKMYLSTKLGDGTRVCLDVDSSSTIVTDACKCLGRG  194

Query  218  SSCDPASQWFKIIDSTRGT  162
              CDP SQWFK++DST  T
Sbjct  195  DMCDPGSQWFKVVDSTNIT  213



>ref|XP_003601885.1| Endoglucanase [Medicago truncatula]
Length=655

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 148/200 (74%), Gaps = 3/200 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWA WTL+GSYY+R+G V ++E +G+L  NW + RN SFLQRIS +Q PF+GP
Sbjct  327  VAAELDLDWAYWTLSGSYYIRQGVVDVDETFGILNGNWSQVRNTSFLQRISAIQHPFQGP  386

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  ES  +K+IFHP+ GLCV   SL +PL++GPCS SD W YT    L ++GT FCLQ E
Sbjct  387  GLLESEPYKVIFHPLRGLCVLSKSLHEPLKMGPCSNSDGWEYTPQNILLLKGTKFCLQGE  446

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG---SNVCLDVDSNNVIITNTCKCL  228
              GK  KLG  C+   S WE+ISDS+MHLS  + +    S+VCLDVD+NN+++TN+CKC+
Sbjct  447  GEGKQVKLGTTCSGPESTWEMISDSKMHLSYNVNNNGSTSSVCLDVDANNIVVTNSCKCI  506

Query  227  NNDSSCDPASQWFKIIDSTR  168
            +  ++CDPASQWFK++ ++ 
Sbjct  507  SKVNTCDPASQWFKLLGASE  526



>emb|CAN72915.1| hypothetical protein VITISV_020826 [Vitis vinifera]
Length=221

 Score =   228 bits (582),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 137/199 (69%), Gaps = 19/199 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL             EE  G++ WN       +F QRIS  QSP +GP
Sbjct  34   LAAELDFDWALWTL-------------EETNGLMNWN------SNFFQRISAXQSPLQGP  74

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+I HP TGLC+ R SL +PL+LGPC+ES+ WGYT  K L V+GTYFCLQA 
Sbjct  75   DVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTESEAWGYTPQKILIVKGTYFCLQAV  134

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL  D
Sbjct  135  GLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDGTTVCLDVDSSSNIVTDACKCLGRD  194

Query  218  SSCDPASQWFKIIDSTRGT  162
              CDP SQWF ++DST  T
Sbjct  195  DMCDPGSQWFNVVDSTNIT  213



>emb|CAN73208.1| hypothetical protein VITISV_009079 [Vitis vinifera]
Length=221

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 136/196 (69%), Gaps = 19/196 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA LDFDWALWTL             EE  G++ WN       +F QRIS  QSP +GP
Sbjct  34   LAAXLDFDWALWTL-------------EETNGLMNWN------SNFFQRISAXQSPLQGP  74

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+I HP TGLC+ R SL +PL+LGPC+ES+ WGYT  K L V+GTYFCLQA 
Sbjct  75   DVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTESEAWGYTPQKILIVKGTYFCLQAV  134

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL  D
Sbjct  135  GLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDGTTVCLDVDSSSNIVTDACKCLGRD  194

Query  218  SSCDPASQWFKIIDST  171
              CDP SQWFK++DST
Sbjct  195  DXCDPGSQWFKVVDST  210



>ref|XP_010026597.1| PREDICTED: uncharacterized protein LOC104416968 [Eucalyptus grandis]
 gb|KCW59702.1| hypothetical protein EUGRSUZ_H02462 [Eucalyptus grandis]
Length=514

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 146/197 (74%), Gaps = 0/197 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D+D+ALWTL G+YYLR+G VG EEFYG+  ++W   RN S+L+RIS++Q PF+GP
Sbjct  317  MAAEFDWDFALWTLQGNYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQLPFQGP  376

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  ++  HK+IFHP+TGLC+ R      L LGPC  S+PW YT   AL V G    L+A 
Sbjct  377  GGLQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSYTPQNALWVMGLPLYLRAI  436

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             LG+PA+LG   T+  +KWE+IS S MHLSSK +DGS VCLDV+++N ++   CKCL+++
Sbjct  437  GLGRPARLGTSPTEPGTKWEMISASEMHLSSKAEDGSTVCLDVNTHNTVMVEACKCLSSE  496

Query  218  SSCDPASQWFKIIDSTR  168
            SSCDPASQWF+++D TR
Sbjct  497  SSCDPASQWFRLVDRTR  513



>ref|XP_008793758.1| PREDICTED: uncharacterized protein LOC103709981 [Phoenix dactylifera]
Length=549

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALW L GSYY+REG +G +E YGVL W+WC+ RN SF+ RI+ +Q+PF+GP
Sbjct  336  VAAELDLDWALWALQGSYYIREGQLGYDETYGVLGWDWCKARNSSFVNRIAALQAPFQGP  395

Query  578  GYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G + +  + +IFHP+TGLC V++ S    LELG C+ S+ W YTA + + +EGT +C+ A
Sbjct  396  GLSNNSPYDIIFHPLTGLCVVKKSSSKNLLELGLCANSEAWNYTAEQNVMLEGTKYCMLA  455

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            +  G+ A+LG  C   +S WE+ISDSRMH+SSKL K+GS VCLD+  +  IITN CKCL+
Sbjct  456  KGAGRRARLGTGCGGSNSIWELISDSRMHVSSKLPKNGSTVCLDISQDGTIITNLCKCLS  515

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +C+P SQWFKII STR
Sbjct  516  QDGTCNPDSQWFKIIRSTR  534



>ref|XP_002284888.2| PREDICTED: uncharacterized protein LOC100258876 [Vitis vinifera]
Length=518

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 139/199 (70%), Gaps = 19/199 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL             EE  G++ WN       +F QRIS +QSP +GP
Sbjct  331  LAAELDFDWALWTL-------------EETNGLMNWNS------NFFQRISALQSPLQGP  371

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+I HP TGLC+ R SL +PL+LGPC+ES+ WGYT  K L V+GTYFCLQA 
Sbjct  372  DVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTESEAWGYTPQKILIVKGTYFCLQAV  431

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             LGKPAKL + CT   S WEIISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL  D
Sbjct  432  GLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDGTTVCLDVDSSSNIVTDACKCLGRD  491

Query  218  SSCDPASQWFKIIDSTRGT  162
              CDP SQWFK++DST  T
Sbjct  492  DMCDPGSQWFKVVDSTNIT  510



>ref|XP_010250982.1| PREDICTED: uncharacterized protein LOC104593037 isoform X2 [Nelumbo 
nucifera]
Length=531

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 142/197 (72%), Gaps = 1/197 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELDFDWALWTL GSYYLREG +GLEE YGV+ W+W  PRN +FL+R+S ++S FRGP
Sbjct  334  VAAELDFDWALWTLMGSYYLREGVLGLEEVYGVMNWDWSGPRNSTFLRRLSSIRSAFRGP  393

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E   +++++HP+TGLCV+R S  + L+LG C E   W YT    + V+GT  CL  +
Sbjct  394  GLDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCDEPASWIYTPEMTIKVKGTGLCLHGD  453

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LG+ A L   C    S W  I+DS+MHL+SKL  GS VCLD+DS N IIT+ C+CL  D
Sbjct  454  RLGERANLQ-DCNSPGSIWMPITDSKMHLASKLAGGSTVCLDIDSKNKIITSPCQCLLGD  512

Query  218  SSCDPASQWFKIIDSTR  168
             +CDP SQWFKII+STR
Sbjct  513  PTCDPGSQWFKIINSTR  529



>ref|XP_010250979.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250981.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 142/197 (72%), Gaps = 1/197 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELDFDWALWTL GSYYLREG +GLEE YGV+ W+W  PRN +FL+R+S ++S FRGP
Sbjct  336  VAAELDFDWALWTLMGSYYLREGVLGLEEVYGVMNWDWSGPRNSTFLRRLSSIRSAFRGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G  E   +++++HP+TGLCV+R S  + L+LG C E   W YT    + V+GT  CL  +
Sbjct  396  GLDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCDEPASWIYTPEMTIKVKGTGLCLHGD  455

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LG+ A L   C    S W  I+DS+MHL+SKL  GS VCLD+DS N IIT+ C+CL  D
Sbjct  456  RLGERANLQ-DCNSPGSIWMPITDSKMHLASKLAGGSTVCLDIDSKNKIITSPCQCLLGD  514

Query  218  SSCDPASQWFKIIDSTR  168
             +CDP SQWFKII+STR
Sbjct  515  PTCDPGSQWFKIINSTR  531



>ref|XP_010249430.1| PREDICTED: uncharacterized protein LOC104591974 [Nelumbo nucifera]
Length=538

 Score =   231 bits (589),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 145/199 (73%), Gaps = 2/199 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LDFDWALW   GSYYLREG   L E Y VL W+W +PRN +FL+R++ +QSPFRGP
Sbjct  338  VAADLDFDWALWAFMGSYYLREGYYALNEVYAVLDWDWAKPRNTTFLKRVAGIQSPFRGP  397

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSES-DPWGYTAGKALTV-EGTYFCLQ  405
            G+++ R + +++HP+TGLCV++VS  +P++LG C+ + + W YT  K L +  G  +CLQ
Sbjct  398  GFSDVRPYNILYHPLTGLCVQKVSPMEPVKLGSCAAAPEAWIYTPQKTLMLNNGMRYCLQ  457

Query  404  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
            A+ +G    LG  C+   S W  IS S++HLSSKL +G++VCLD+D +  I+TNTC+CL 
Sbjct  458  ADGVGNGVMLGNACSGPGSNWYQISASKLHLSSKLANGTSVCLDIDPSYNIVTNTCQCLT  517

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +CDPA QWFKII STR
Sbjct  518  GDKTCDPAGQWFKIITSTR  536



>ref|XP_010682344.1| PREDICTED: uncharacterized protein LOC104897211 [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 144/200 (72%), Gaps = 1/200 (1%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            AE D DWALWTLAG+YYLREG VG+ E+YG+L  +W + RN SFL+RIS++Q+P +GPG 
Sbjct  340  AEHDLDWALWTLAGNYYLREGVVGMVEYYGLLNSDWTQVRNTSFLERISVIQAPLQGPGM  399

Query  572  TESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
            ++   H +I+HP TGLCV +  +    ++LG C+ES+ W YT  + LT++G+Y CL A+ 
Sbjct  400  SQRTEHNIIYHPSTGLCVVKKPMTPMGVQLGNCAESNRWTYTPSQTLTIKGSYLCLHAQG  459

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            +  PA+L L+C    ++W  ISDS++HLS+ L     VCLDVDS+N +IT TCKCL+ND+
Sbjct  460  MNLPARLSLYCPGVGTRWTPISDSKLHLSASLSRRVTVCLDVDSDNNLITTTCKCLSNDN  519

Query  215  SCDPASQWFKIIDSTRGTTT  156
             CDP SQWFKI++     TT
Sbjct  520  KCDPGSQWFKIVEVADTITT  539



>ref|XP_010249431.1| PREDICTED: uncharacterized protein LOC104591975 [Nelumbo nucifera]
Length=541

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 142/199 (71%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELDFDWALW   GSYYLREG +GL+E Y V+ W W  PRN +FL+R+S +QSPFRG 
Sbjct  339  VAAELDFDWALWAFMGSYYLREGVMGLDEVYAVMNWGWSGPRNSTFLRRLSALQSPFRGA  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLE--LGPCSESDPWGYTAGKALTVEG-TYFCL  408
            G  E   +++++HP+TGLCV+R S  +PL+  LG C+ES  W YT    L V G T  CL
Sbjct  399  GLDEVAPYQILYHPLTGLCVQRGSFKKPLDLKLGSCAESAQWMYTPEMTLAVNGTTVLCL  458

Query  407  QAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
            QA+ LG+ AKL   C+  ++KW+ ISDSRMHLS+ L   S  CLD+DS N II + C+CL
Sbjct  459  QADGLGRRAKLRGDCSSPATKWKPISDSRMHLSTTLPTNSTACLDIDSKNNIIASRCQCL  518

Query  227  NNDSSCDPASQWFKIIDST  171
              D+SCDPASQWFKII ST
Sbjct  519  WGDASCDPASQWFKIIYST  537



>ref|XP_002284895.1| PREDICTED: uncharacterized protein LOC100253729 [Vitis vinifera]
Length=512

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 138/199 (69%), Gaps = 19/199 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL             EE  G++ WN       SF QRIS +QSP +GP
Sbjct  325  LAAELDFDWALWTL-------------EETNGLMNWNS------SFFQRISALQSPLQGP  365

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+IFHP TGLC+ R S  +PL+LGPC++S+ WGYT  K LTV+GTYFCLQA 
Sbjct  366  DVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTKSEAWGYTPQKLLTVKGTYFCLQAV  425

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             LGKPAKL + CT   S WE ISDS+M+LS+KL DG+ VCLDVDS++ I+T+ CKCL   
Sbjct  426  GLGKPAKLSIICTKPGSNWENISDSKMYLSTKLGDGTRVCLDVDSSSTIVTDACKCLGRG  485

Query  218  SSCDPASQWFKIIDSTRGT  162
              CDP SQWFK++DST  T
Sbjct  486  DMCDPGSQWFKVVDSTNIT  504



>ref|XP_010904544.1| PREDICTED: uncharacterized protein LOC105031943 [Elaeis guineensis]
Length=554

 Score =   231 bits (588),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 152/207 (73%), Gaps = 2/207 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALW L GSYY+REG +G +E YG+L W+WC+ RN SF+ RIS +Q+PF+GP
Sbjct  341  VAAELDLDWALWALQGSYYIREGQLGYDETYGLLGWDWCKARNSSFVNRISALQAPFQGP  400

Query  578  GYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G + +  + +IFHP+TGLC V++ S    LELG C++S+ W YTA + + +E T +C+ A
Sbjct  401  GLSNNSPYNIIFHPLTGLCVVKKFSSKNLLELGQCADSEAWNYTAEQHVMLEDTKYCMLA  460

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK-DGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ A+LG  C   +S WE+ISDS+MH+S+KL  +GS VCLD+  +  +ITN CKCL+
Sbjct  461  KGVGRRARLGTSCGGSNSIWELISDSKMHVSTKLPINGSTVCLDISQDGTVITNLCKCLS  520

Query  224  NDSSCDPASQWFKIIDSTRGTTTKSDF  144
             D +C+P SQWFKII STR   +++ +
Sbjct  521  LDGTCNPDSQWFKIIRSTRERESQTAY  547



>gb|AAS00040.1| unknown [Vitis riparia]
Length=221

 Score =   221 bits (562),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 136/196 (69%), Gaps = 19/196 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWT+             EE  G++ WN       S  QRIS +QSP +GP
Sbjct  34   LAAELDFDWALWTV-------------EETNGLMNWN------SSVFQRISALQSPLQGP  74

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA 
Sbjct  75   DVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAV  134

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D
Sbjct  135  ELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLADSTTVCLDVDSSSTIVTDACKCLGRD  194

Query  218  SSCDPASQWFKIIDST  171
             +CDP SQWFK++DST
Sbjct  195  DTCDPGSQWFKVVDST  210



>ref|XP_010528075.1| PREDICTED: uncharacterized protein LOC104805267 [Tarenaya hassleriana]
Length=575

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 150/206 (73%), Gaps = 3/206 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALWTLAGSYY RE  +G +E++GVL W+W   RN +F QRIS +Q PFRGP
Sbjct  330  VAAELDLDWALWTLAGSYYTREKAIGADEYFGVLDWSWIGIRNSTFFQRISAIQRPFRGP  389

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQ  405
            G  E+  HK+IFHP TGLCV R S   P  L+LGPC+ESD W +T  + L+V+    C++
Sbjct  390  GLMETYPHKVIFHPSTGLCVVRESWPNPFRLKLGPCNESDSWRHTPHRILSVKEQLLCIK  449

Query  404  AEKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             ++ G+PAKL +F ++ S SKW++ S+S+M L+S    G++VCLDVDS++ I+T +CKCL
Sbjct  450  VDERGQPAKLRIFFSEASCSKWKVTSESKMQLASLTWSGASVCLDVDSDSNIVTTSCKCL  509

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKS  150
            + +  CDP SQWFK++ STR   TK+
Sbjct  510  HGNEPCDPGSQWFKLVTSTRRRRTKA  535



>gb|EYU30606.1| hypothetical protein MIMGU_mgv1a018920mg, partial [Erythranthe 
guttata]
Length=504

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 144/225 (64%), Gaps = 37/225 (16%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWALW L GSYY+REG VGL+E YGV  WNW E RN + LQ+IS +Q PFRGP 
Sbjct  311  AAEQDVDWALWALTGSYYIREGVVGLDETYGVYNWNWGEIRNQTTLQKISALQYPFRGP-  369

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAE  399
                                            CSE++ W Y T  K LT+ GTYFCL+A+
Sbjct  370  --------------------------------CSEAEAWSYSTPQKTLTIVGTYFCLEAD  397

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LG+PAKLG+FC+D ++KWE IS+S+ HLSSKL DG+ VCLD+DS+N I+TN CKCLN +
Sbjct  398  ELGQPAKLGIFCSDATTKWEAISESKNHLSSKLGDGTKVCLDIDSDNNIVTNNCKCLNRN  457

Query  218  SSCDPASQWFKIIDSTRGTTTKSDFQST---SFLYFLAKKLFASY  93
            S CDP SQWFKIIDSTR  TT ++       S +  +AK    S+
Sbjct  458  SKCDPGSQWFKIIDSTRSATTDNNLLHRVIGSIVKLIAKIFLGSF  502



>ref|XP_010026596.1| PREDICTED: uncharacterized protein LOC104416965 [Eucalyptus grandis]
Length=515

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 143/198 (72%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D+D+ALWTL GSYYLR+G VG EEFYG+  ++W   RN S+L+RIS++Q PF+GP
Sbjct  317  MAAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQLPFQGP  376

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-TVEGTYFCLQA  402
            G  ++  HK+IFHP+TGLC+ R      L LGPC  S+PW +T   AL  + G    L+A
Sbjct  377  GGRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSHTPQNALGLMAGKPLYLRA  436

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
              LG+PA LG   T+  +KWE+IS S MHLSS  +DGS VCLDV +NN ++   CKCL++
Sbjct  437  VGLGRPATLGTSPTEPGTKWEMISASEMHLSSMAEDGSTVCLDVIANNTVMVEACKCLSS  496

Query  221  DSSCDPASQWFKIIDSTR  168
            +SSCDPASQWF+++D TR
Sbjct  497  ESSCDPASQWFRLVDRTR  514



>emb|CAN60394.1| hypothetical protein VITISV_015741 [Vitis vinifera]
Length=221

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 134/196 (68%), Gaps = 19/196 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWT              EE  G++ WN          QRIS +QSP +GP
Sbjct  34   LAAELDFDWALWTX-------------EETNGLMNWN------SXXFQRISALQSPLQGP  74

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA 
Sbjct  75   XVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAV  134

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D
Sbjct  135  ELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGDSTTVCLDVDSSSTIVTDACKCLGRD  194

Query  218  SSCDPASQWFKIIDST  171
             +CDP SQWFK++DST
Sbjct  195  DTCDPGSQWFKVVDST  210



>ref|XP_004975980.1| PREDICTED: uncharacterized protein LOC101758857 [Setaria italica]
Length=557

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REG +  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  336  VAAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGP  395

Query  578  GYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   SR  + LIFHP TGLCV   S  + LELGPC  S+ W YT+   L V+ T  CLQA
Sbjct  396  GLPNSREPYNLIFHPQTGLCVLATS-SKSLELGPCDRSNAWNYTSAYELVVKSTGQCLQA  454

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ AKLG  C+  SSKW++IS+SRMH+S++L K+G+ VCLD   +  IITN CKCL 
Sbjct  455  KSVGENAKLGTDCSKPSSKWQLISNSRMHVSAELTKNGTRVCLDAGPDGAIITNQCKCLI  514

Query  224  NDSSCDPASQWFKIIDSTRGTTTKSDF  144
             D +C+P SQWFK+I S+R T   S  
Sbjct  515  IDPACNPESQWFKVILSSRDTPGGSSI  541



>gb|KFK33555.1| hypothetical protein AALP_AA5G028800 [Arabis alpina]
Length=552

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 156/230 (68%), Gaps = 17/230 (7%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DWALWT+ GSYY+RE T+  +E YGVL WNW   RN + LQ IS +QSPFRGP
Sbjct  332  LAADLDLDWALWTVVGSYYVREKTIEYDETYGVLDWNWSSIRNSTMLQMISSIQSPFRGP  391

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E+   K++FHP TGLCV R SLFQ L+LG C + + W  T+ + L++ E   FCL+A
Sbjct  392  GLMETHPKKIMFHPSTGLCVVRKSLFQ-LKLGSCDKPESWRLTSHRVLSLREEEIFCLKA  450

Query  401  EKLGKPAKL-----GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNT  240
             + GK  KL     GL+C    SKW++ S+S+M +SS  + G++VCLDVDS NN I+TN+
Sbjct  451  YEKGKSVKLRVFFFGLYC----SKWKLKSESKMQISSVSRSGNSVCLDVDSENNNIVTNS  506

Query  239  CKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFASYI  90
            CKCL  +SSCDP SQWFK++ STR     S F+   FL F  KK F S I
Sbjct  507  CKCLKGNSSCDPRSQWFKLVTSTR-----SRFKPKPFLQFSPKKTFLSLI  551



>emb|CBI20318.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 136/196 (69%), Gaps = 19/196 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWT+             EE  G++ WN       S  QRIS +QSP +GP
Sbjct  177  LAAELDFDWALWTV-------------EETNGLMNWN------SSVFQRISALQSPLQGP  217

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA 
Sbjct  218  DVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAV  277

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D
Sbjct  278  ELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGDSTTVCLDVDSSSTIVTDACKCLGRD  337

Query  218  SSCDPASQWFKIIDST  171
             +CDP SQWFK++DST
Sbjct  338  DTCDPGSQWFKVVDST  353



>gb|ACN33507.1| unknown [Zea mays]
Length=369

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REG +  +E YG+LTW+WC  RN SF++RI+ +QS F+GP
Sbjct  148  VAAEMDLDWAIWALQGSYYIREGILAYDESYGLLTWDWCTARNPSFIKRINSLQSAFQGP  207

Query  578  GYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   ++  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQA
Sbjct  208  GLPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPCDESNAWNYTSAYELVVKSTGQCLQA  266

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +GK AKLG  C+  SSKW +ISDS+MH+S++L K+G+ VCL+   +  I TN CKCL+
Sbjct  267  QSVGKNAKLGTDCSKPSSKWHLISDSKMHVSAELAKNGTRVCLEASPDGAIRTNQCKCLS  326

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +CDP SQWFK+I S+R
Sbjct  327  VDPTCDPESQWFKVILSSR  345



>gb|EMT27118.1| hypothetical protein F775_19072 [Aegilops tauschii]
Length=571

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 3/200 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REG +  +E YG+LTW+W   RN SF++RI+ +QSPF+GP
Sbjct  349  VAAEMDLDWAVWALEGSYYIREGILAYDETYGLLTWDWYTARNPSFIERINSLQSPFQGP  408

Query  578  GYTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S + +K+IFHP+TGLCV  V     L+LGPC ESD W YT+   L ++ T  CL+A
Sbjct  409  GLPSSHQPYKVIFHPLTGLCV-LVESANVLKLGPCDESDAWNYTSAYELVLKHTGQCLEA  467

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G  AKLG  C+   SKW++ISDSRMH+S++L K+G+ VCL+   + VI T+ CKCL 
Sbjct  468  KSVGDTAKLGTGCSKSCSKWQLISDSRMHVSAELTKNGTRVCLEAGPDGVITTDQCKCLT  527

Query  224  NDSSCDPASQWFKIIDSTRG  165
             D +CDP SQWFK+I S+RG
Sbjct  528  EDPTCDPESQWFKVISSSRG  547



>gb|EAY94563.1| hypothetical protein OsI_16341 [Oryza sativa Indica Group]
Length=552

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 148/203 (73%), Gaps = 3/203 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  334  VAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGP  393

Query  578  GYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  + +IFHP++GLCV  V   + LELGPC ES+ W YT+   L ++ T  CLQA
Sbjct  394  GLPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPCDESNAWNYTSTHELVLQHTGQCLQA  452

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ A+LG  C+  SSKW++IS+S MH+S++L K+G+ VCLD   + +I TN CKCL 
Sbjct  453  KSVGENAQLGTDCSKSSSKWQLISNSGMHVSTELTKNGTGVCLDATPDGIITTNPCKCLT  512

Query  224  NDSSCDPASQWFKIIDSTRGTTT  156
             D  C+P SQWFKII S+R T T
Sbjct  513  GDPICNPESQWFKIILSSRHTGT  535



>ref|XP_002284881.1| PREDICTED: uncharacterized protein LOC100264047 [Vitis vinifera]
Length=509

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 136/196 (69%), Gaps = 19/196 (10%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWT+             EE  G++ WN       S  QRIS +QSP +GP
Sbjct  322  LAAELDFDWALWTV-------------EETNGLMNWN------SSVFQRISALQSPLQGP  362

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  R HK+I HP TGLC+   S  +PL+LGPC++SD WGYT  K L V+G+YFCLQA 
Sbjct  363  DVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCTKSDAWGYTPQKLLIVKGSYFCLQAV  422

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
            +LGKPAKL + CT   S W+IISDS+M+LS+KL D + VCLDVDS++ I+T+ CKCL  D
Sbjct  423  ELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGDSTTVCLDVDSSSTIVTDACKCLGRD  482

Query  218  SSCDPASQWFKIIDST  171
             +CDP SQWFK++DST
Sbjct  483  DTCDPGSQWFKVVDST  498



>emb|CAH67676.1| H0510A06.1 [Oryza sativa Indica Group]
 emb|CAH66881.1| OSIGBa0158F13.12 [Oryza sativa Indica Group]
Length=553

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 148/203 (73%), Gaps = 3/203 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  335  VAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGP  394

Query  578  GYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  + +IFHP++GLCV  V   + LELGPC ES+ W YT+   L ++ T  CLQ 
Sbjct  395  GLPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPCDESNAWNYTSTHELVLQHTGQCLQV  453

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ A+LG  C+  SSKW++IS+S MH+S++L K+G+ VCLD   + +I TN CKCL 
Sbjct  454  KSVGENAQLGTDCSKSSSKWQLISNSGMHVSTELTKNGTRVCLDATPDGIITTNPCKCLT  513

Query  224  NDSSCDPASQWFKIIDSTRGTTT  156
             D +C+P SQWFKII S+R T T
Sbjct  514  GDPNCNPESQWFKIILSSRHTGT  536



>emb|CAD41089.2| OSJNBb0011N17.6 [Oryza sativa Japonica Group]
 gb|EAZ31113.1| hypothetical protein OsJ_15211 [Oryza sativa Japonica Group]
Length=550

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 148/203 (73%), Gaps = 3/203 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  332  VAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGP  391

Query  578  GYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  + +IFHP++GLCV  V   + LELGPC ES+ W YT+   L ++ T  CLQ 
Sbjct  392  GLPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPCDESNAWNYTSTHELVLQHTGQCLQV  450

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ A+LG  C+  SSKW++IS+S MH+S++L K+G+ VCLD   + +I TN CKCL 
Sbjct  451  KSVGENAQLGTDCSKSSSKWQLISNSGMHVSTELTKNGTRVCLDATPDGIITTNPCKCLT  510

Query  224  NDSSCDPASQWFKIIDSTRGTTT  156
             D +C+P SQWFKII S+R T T
Sbjct  511  GDPNCNPESQWFKIILSSRHTGT  533



>ref|XP_010026600.1| PREDICTED: uncharacterized protein LOC104416972 [Eucalyptus grandis]
Length=647

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 1/198 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D+D+ALWTL GSYYLREG VG+EEFYG+   +W   RN S+L+R+S++Q PF+GP
Sbjct  449  MAAEFDWDFALWTLQGSYYLREGVVGVEEFYGLFNNDWSGIRNSSYLRRLSVLQLPFQGP  508

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-TVEGTYFCLQA  402
            G  ++   K+IFHP+TGLC+ R +    L LGPC  S+PW +T   AL  + G    L+A
Sbjct  509  GGRQTVAQKVIFHPLTGLCILRRTRPTRLVLGPCIYSEPWSHTPQNALGLMAGKPLYLRA  568

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
              LG+PA LG   T+  +KWE+IS S MHLSS  +DGS VCLD+ +NN ++   CKCL++
Sbjct  569  VGLGRPATLGTSPTEPGTKWEMISASEMHLSSMAEDGSTVCLDMIANNTVMVEACKCLSS  628

Query  221  DSSCDPASQWFKIIDSTR  168
            +SSCDPASQWF+++D TR
Sbjct  629  ESSCDPASQWFRLVDRTR  646


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  326  SRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
            S +HLSSK KD S VCLD+ +NN ++   CKCL  ++SCD ASQWFK+ D+ R
Sbjct  3    SELHLSSKAKDRSAVCLDMGANNTVVVEACKCLGGNNSCDLASQWFKLADTNR  55



>dbj|BAK00694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 145/200 (73%), Gaps = 3/200 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REG +  +E YG+LTW+W   RN SF++RI+ +QSPF+GP
Sbjct  339  VAAEMDLDWAVWALEGSYYIREGILAYDETYGLLTWDWYTARNPSFIERINSLQSPFQGP  398

Query  578  GYTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G + S + +K+IFHP+TGLCV  V     L+LGPC ES+ W YT+   L ++ T  CL+A
Sbjct  399  GLSSSHKSYKVIFHPLTGLCV-LVESANVLKLGPCDESNAWNYTSTYELVLKQTGQCLEA  457

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G  AKLG  C+   SKW++ISDS MH+S++L K+G+ VCLD   + VI T+ CKCL 
Sbjct  458  KSVGDTAKLGTGCSKSCSKWQLISDSGMHVSAELTKNGTRVCLDAGPDGVITTDQCKCLT  517

Query  224  NDSSCDPASQWFKIIDSTRG  165
             D +CDP SQWFK+I S+RG
Sbjct  518  EDPTCDPESQWFKVISSSRG  537



>ref|XP_002446674.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
 gb|EES11002.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
Length=556

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DW++W L GSYY+REG +  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  335  VAAEMDLDWSIWALQGSYYIREGILAYDESYGLLSWDWCTARNPSFIKRINSLQSPFQGP  394

Query  578  GYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQ 
Sbjct  395  GLPNSQEPYNIIFHPQSGLCVLARS-SKLLELGPCDESNAWNYTSAYNLVVKNTGQCLQV  453

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +GK AKLG  C+  SSKW +IS+S+MH+S++L K+G+ VCLD      IITN CKCL+
Sbjct  454  KSVGKNAKLGTDCSKPSSKWNLISNSKMHVSAELTKNGTRVCLDASPAGAIITNQCKCLS  513

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +CDP SQWFK+I S+R
Sbjct  514  VDPTCDPESQWFKVIVSSR  532



>emb|CBI20316.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = -3

Query  650  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  471
            NW    N +F QRIS +QSP +GP  +  R HK+I HP TGLC+ R SL +PL+LGPC+E
Sbjct  2    NW----NSNFFQRISALQSPLQGPDVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTE  57

Query  470  SDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG  291
            S+ WGYT  K L V+GTYFCLQA  LGKPAKL + CT   S WEIISDS+M+LS+KL DG
Sbjct  58   SEAWGYTPQKILIVKGTYFCLQAVGLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDG  117

Query  290  SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  162
            + VCLDVDS++ I+T+ CKCL  D  CDP SQWFK++DST  T
Sbjct  118  TTVCLDVDSSSNIVTDACKCLGRDDMCDPGSQWFKVVDSTNIT  160



>ref|XP_010556349.1| PREDICTED: uncharacterized protein LOC104825675 [Tarenaya hassleriana]
Length=555

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWALW L+GSYY+REG  G+ EFYG L  +W + RN SFLQRIS++QSP +GPG
Sbjct  339  AAENDIDWALWVLSGSYYIREGVAGMVEFYGALDADWNDARNSSFLQRISLLQSPLQGPG  398

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
              ++  + LIFHP+TGLC+ + S   P  L LGPC ES+PW YT+   L ++G  FCLQ 
Sbjct  399  -PQTGDYNLIFHPLTGLCMVQ-SQINPTKLALGPCYESEPWSYTSENNLKIQGLPFCLQN  456

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD-SNNVIITNTCKCLN  225
               GKP KLG+ C    SKW  IS S MHL+S   +  ++CLDVD SNNV+I N CKC+ 
Sbjct  457  TGTGKPVKLGISCWSPVSKWHTISASEMHLASTTSEQISLCLDVDGSNNVVIANDCKCMA  516

Query  224  NDSSCDPASQWFKIIDSTR  168
             DS C P SQWFKII +TR
Sbjct  517  EDSRCQPMSQWFKIIKATR  535



>ref|XP_010514258.1| PREDICTED: uncharacterized protein LOC104790245 [Camelina sativa]
Length=562

 Score =   220 bits (561),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/212 (53%), Positives = 148/212 (70%), Gaps = 4/212 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DWALWTLAGSYY+R  T+G +E YGVL WNW   RN + LQ +S +Q+PFRGP
Sbjct  336  LAADLDLDWALWTLAGSYYIRGRTIGSDETYGVLDWNWLSIRNSTILQMVSTIQTPFRGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E++  K++FHP++GLCV R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A
Sbjct  396  GLMETQPKKIMFHPLSGLCVVRKSLFQ-LKLGSCNRSESWRLSSHRVLSLAEERILCLKA  454

Query  401  EKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
             + G   KL LF T+   SKW ++SDS+M LSS  K+G+ VCLDVDS +N I+T  CKCL
Sbjct  455  YEKGNSVKLRLFFTEFHCSKWRLLSDSKMQLSSVTKNGAFVCLDVDSRSNKIVTRRCKCL  514

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  132
              +SSCDP SQWFK++ STR  +    F   S
Sbjct  515  QGNSSCDPRSQWFKLVTSTRRRSISKPFLQIS  546



>emb|CDX83590.1| BnaC07g23300D [Brassica napus]
Length=557

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 153/219 (70%), Gaps = 9/219 (4%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DWALWTLAGSYY+RE T+G +E YGVL W+W   RN + LQ IS +QSPFRGP
Sbjct  333  LAADLDLDWALWTLAGSYYIREKTIGYDETYGVLDWSWSSIRNSTILQMISAIQSPFRGP  392

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E+   K+IFHP TGLC+ R SLFQ L+LG C  S+ +  ++ + L++ E    CL+A
Sbjct  393  GLMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCDRSESFRLSSQRVLSLAEEKILCLKA  451

Query  401  EKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCL  228
             + GK  KL L+ ++   S+W+++S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL
Sbjct  452  YEKGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLDVDSDSNNIVTKSCKCL  511

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDF-----QSTSFL  126
              D+SCDP SQWFK++ STR     + F     QS +FL
Sbjct  512  EEDASCDPKSQWFKVVTSTRSRFRANPFLRVSPQSKTFL  550



>ref|NP_001132121.1| hypothetical protein precursor [Zea mays]
 gb|ACF80825.1| unknown [Zea mays]
 gb|AFW58604.1| hypothetical protein ZEAMMB73_652830 [Zea mays]
Length=555

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REG +  +E YG+LTW+WC  RN SF++RI+ +QS F+GP
Sbjct  334  VAAEMDLDWAIWALQGSYYIREGILAYDESYGLLTWDWCTARNPSFIKRINSLQSAFQGP  393

Query  578  GYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   ++  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQA
Sbjct  394  GLPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPCDESNAWNYTSAYELVVKSTGQCLQA  452

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +GK AKLG  C+  SSKW +ISDS+MH+S++L K+G+ VCL+   +  I TN CKCL+
Sbjct  453  QSVGKNAKLGTDCSKPSSKWHLISDSKMHVSAELAKNGTRVCLEASPDGAIRTNQCKCLS  512

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +CDP SQWFK+I S+R
Sbjct  513  VDPTCDPESQWFKVILSSR  531



>ref|XP_010248706.1| PREDICTED: uncharacterized protein LOC104591538 isoform X2 [Nelumbo 
nucifera]
Length=538

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 136/194 (70%), Gaps = 13/194 (7%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D DWAL T            G++E YG+L   W    N S ++R+S++QSPF GP
Sbjct  332  VAAEKDLDWALGT------------GIDEAYGLLNSEWFGTGNASPMKRVSLLQSPFLGP  379

Query  578  G-YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                  R H++IFHP TGLCV R S+ +PL+LG C ES+ W YT  K L V+GTYFCLQA
Sbjct  380  DDLLNVRPHEMIFHPSTGLCVLRKSVIEPLKLGSCVESESWAYTPQKTLVVKGTYFCLQA  439

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
            + +GKPAKLG+ C D  SKW++ISD++MHLSSKL DGS+VCLDVDS+N IITN CKC + 
Sbjct  440  DGVGKPAKLGIICNDPGSKWDLISDTKMHLSSKLADGSSVCLDVDSSNSIITNPCKCSSG  499

Query  221  DSSCDPASQWFKII  180
              +CDP SQWFKI+
Sbjct  500  APNCDPTSQWFKIV  513



>ref|XP_009152076.1| PREDICTED: uncharacterized protein LOC103875318 [Brassica rapa]
Length=559

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 153/214 (71%), Gaps = 9/214 (4%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DWALWTLAGSYY+RE T+G +E YGVL W+W   RN + LQ IS +QSPFRGP
Sbjct  335  LAADLDLDWALWTLAGSYYVREKTIGYDETYGVLDWSWSSIRNSTILQMISSIQSPFRGP  394

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E+   K+IFHP TGLC+ R SLFQ L+LG C  S+ +  ++ + L++ E    CL+A
Sbjct  395  GLMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCDRSESFRLSSQRVLSLAEEKILCLKA  453

Query  401  EKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCL  228
             + GK  KL L+ ++   S+W+++S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL
Sbjct  454  YEKGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLDVDSDSNNIVTKSCKCL  513

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  126
              D+SCDP SQWFK++     T+T+S F++  FL
Sbjct  514  EGDASCDPKSQWFKVV-----TSTRSRFRANPFL  542



>gb|AIZ06017.1| hypothetical protein [Zea nicaraguensis]
Length=555

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REG +  +E YG+L+W+WC  RN  F++RI+ +QS F+GP
Sbjct  334  VAAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWCTARNPGFIKRINSLQSVFQGP  393

Query  578  GYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   ++  + +IFHP +GLCV   S  + LELGPC ES+ W YT+   L V+ T  CLQA
Sbjct  394  GLPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPCGESNAWNYTSAYELVVKSTGQCLQA  452

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +GK AKLG  C++ SSKW +ISDS+MHLS++L K+G+ VCL+   +  I TN CKCL+
Sbjct  453  QSVGKNAKLGTDCSEPSSKWHLISDSKMHLSAELAKNGTRVCLEASPDGAIRTNQCKCLS  512

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +CDP SQWFK+I S+R
Sbjct  513  VDPTCDPESQWFKVILSSR  531



>emb|CDY13613.1| BnaA06g33100D [Brassica napus]
Length=559

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 153/214 (71%), Gaps = 9/214 (4%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LD DWALWTLAGSYY+RE T+G +E YGVL W+W   RN + LQ IS +QSPFRGP
Sbjct  335  VAADLDLDWALWTLAGSYYVREKTIGYDETYGVLDWSWSSIRNSTILQMISSIQSPFRGP  394

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E+   K+IFHP TGLC+ R SLFQ L+LG C  S+ +  ++ + L++ E    CL+A
Sbjct  395  GLMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCDRSESFRLSSQRVLSLAEEKILCLKA  453

Query  401  EKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCL  228
             + GK  KL L+ ++   S+W+++S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL
Sbjct  454  YERGKSVKLRLYFSESYCSRWKLLSESKMQLSSITKNGESVCLDVDSDSNNIVTKSCKCL  513

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  126
              D+SCDP SQWFK++     T+T+S F++  FL
Sbjct  514  EGDASCDPKSQWFKVV-----TSTRSRFRANPFL  542



>ref|XP_010502521.1| PREDICTED: uncharacterized protein LOC104779823 [Camelina sativa]
Length=558

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 146/212 (69%), Gaps = 4/212 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DWALWTLAGSYY+R  T+G +E YGVL WNW   RN + LQ +S +Q+PF GP
Sbjct  335  LAADLDLDWALWTLAGSYYIRGKTIGSDETYGVLDWNWLNVRNSTILQMVSAIQTPFTGP  394

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E++  K++FHP++GLC+ R  LF+ L+LG C  S+ W  ++ + L++ E    CL+A
Sbjct  395  GLMETQPKKIMFHPLSGLCIVRKPLFR-LKLGSCKRSESWRLSSHRVLSLAEERILCLKA  453

Query  401  EKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
             + G P KL LF T+   SKW ++SDS+M LSS  K+G+ VCLDVDS +N I+T  CKCL
Sbjct  454  YEKGNPVKLRLFFTEFQCSKWRLLSDSKMQLSSITKNGAFVCLDVDSRSNKIVTRRCKCL  513

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  132
              +SSCDP SQWFK++ STR  +    F   S
Sbjct  514  QGNSSCDPRSQWFKLVTSTRRRSISKPFLQIS  545



>emb|CBI20314.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = -3

Query  650  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  471
            NW    N SF QRIS +QSP +GP  +  R HK+IFHP TGLC+ R S  +PL+LGPC++
Sbjct  2    NW----NSSFFQRISALQSPLQGPDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTK  57

Query  470  SDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG  291
            S+ WGYT  K LTV+GTYFCLQA  LGKPAKL + CT   S WE ISDS+M+LS+KL DG
Sbjct  58   SEAWGYTPQKLLTVKGTYFCLQAVGLGKPAKLSIICTKPGSNWENISDSKMYLSTKLGDG  117

Query  290  SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  162
            + VCLDVDS++ I+T+ CKCL     CDP SQWFK++DST  T
Sbjct  118  TRVCLDVDSSSTIVTDACKCLGRGDMCDPGSQWFKVVDSTNIT  160



>ref|XP_002876947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 150/212 (71%), Gaps = 6/212 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DW+LWTLAGSYY+RE T+G +E YGVL WNW   RN + LQ IS +QSPF+  
Sbjct  330  LAADLDLDWSLWTLAGSYYIREKTIGTDETYGVLDWNWSSIRNSTILQMISAIQSPFQ--  387

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E++  K++FHP TGLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A
Sbjct  388  GLMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCNRSESWKLSSHRVLSLTEEKILCLKA  446

Query  401  EKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
             + GK  KL LF +D   SKW+++SDS+M LSS  K+G ++CLDVDS NN I+TN+CKCL
Sbjct  447  YEDGKSVKLRLFFSDSYCSKWKLLSDSKMQLSSITKNGVSICLDVDSNNNNIVTNSCKCL  506

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  132
              +SSCDP SQWFK++ STR  +    F   S
Sbjct  507  LGNSSCDPRSQWFKLVTSTRRRSKPKPFLQIS  538



>ref|XP_010556350.1| PREDICTED: uncharacterized protein LOC104825676 [Tarenaya hassleriana]
Length=560

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWALWTL GSYY+R+G VG+ E+YG L  +W + RN SFLQR+S++QS  +GPG
Sbjct  339  AAENDVDWALWTLTGSYYIRQGVVGMIEYYGALDSDWNDVRNSSFLQRLSLLQSQLQGPG  398

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
               +  + LIFHP+TGLCV +  L  P  L LGPC ES+PW YT+   L ++G  FC+Q+
Sbjct  399  -PRTDFYDLIFHPLTGLCVVQSEL-DPTLLTLGPCKESEPWSYTSKNNLKIQGMPFCIQS  456

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG-SNVCLDVDSNNVIITNTCKCLN  225
                KP +LGL C   +SKW+ IS S+MHL+S   +  S++CLDVD+N+ ++ N CKCL+
Sbjct  457  TGTQKPVRLGLSCWSPNSKWQTISASKMHLASTTSNKTSSLCLDVDTNSNVVANPCKCLS  516

Query  224  NDSSCDPASQWFKIIDSTRG  165
             DSSC+P SQWFKI+ +T G
Sbjct  517  KDSSCEPMSQWFKIVRATTG  536



>dbj|BAB02432.1| unnamed protein product [Arabidopsis thaliana]
Length=561

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 155/224 (69%), Gaps = 8/224 (4%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+ D DW+LWTLAGSYY+RE ++G +E YGVL +NW   RN + LQ IS +Q+PF GP
Sbjct  338  LAADRDLDWSLWTLAGSYYIREKSIGSDESYGVLDFNWSSIRNSTILQMISAIQTPFIGP  397

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E++  K++FHP TGLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A
Sbjct  398  GLMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCNRSESWRLSSHRVLSLAEEQILCLKA  456

Query  401  EKLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
             + GK  KL LF ++   SKW++ SDS+M LSS  K+G +VCLDVD+ NN I+TN+CKCL
Sbjct  457  YEKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSITKNGFSVCLDVDTENNNIVTNSCKCL  516

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY---FLAKKL  105
              +SSCDP SQWFK++ STR  +    F   S LY   FL K L
Sbjct  517  RGNSSCDPRSQWFKLVTSTRRRSRPKPFLQIS-LYSKTFLQKSL  559



>ref|XP_010026595.1| PREDICTED: uncharacterized protein LOC104416964 [Eucalyptus grandis]
Length=535

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 145/202 (72%), Gaps = 5/202 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LDFDWALWT+ GSYYLR+G VG+EE +GVL  ++  PRN SFLQRIS +Q+PF+G 
Sbjct  336  VAAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLNKDFSGPRNASFLQRISALQAPFQG-  394

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              + S   +++FHP+TGLC++R    + L+LG C+ES+ W +T    + + GT  C+QA+
Sbjct  395  ATSSSPTRRILFHPLTGLCIQRKREQEQLQLGACNESEAWTHTRHHTIRMRGTDLCMQAD  454

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN--VCLDVD-SNNVIITNTCKCL  228
            +L KP KL   C D  S+W+ IS+S+MH SS +  GSN  VCLD+D S   +I + CKCL
Sbjct  455  RLEKPVKLSTDCADHGSRWKTISESKMHFSSNIV-GSNVTVCLDIDFSTKTVIASPCKCL  513

Query  227  NNDSSCDPASQWFKIIDSTRGT  162
              D++C+PASQWF++++ TR T
Sbjct  514  REDATCNPASQWFELVNMTRST  535



>ref|XP_010248705.1| PREDICTED: uncharacterized protein LOC104591538 isoform X1 [Nelumbo 
nucifera]
Length=540

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 135/196 (69%), Gaps = 15/196 (8%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D DWAL T            G++E YG+L   W    N S ++R+S++QSPF   
Sbjct  332  VAAEKDLDWALGT------------GIDEAYGLLNSEWFGTGNASPMKRVSLLQSPFLDA  379

Query  578  G---YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCL  408
            G       R H++IFHP TGLCV R S+ +PL+LG C ES+ W YT  K L V+GTYFCL
Sbjct  380  GPDDLLNVRPHEMIFHPSTGLCVLRKSVIEPLKLGSCVESESWAYTPQKTLVVKGTYFCL  439

Query  407  QAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
            QA+ +GKPAKLG+ C D  SKW++ISD++MHLSSKL DGS+VCLDVDS+N IITN CKC 
Sbjct  440  QADGVGKPAKLGIICNDPGSKWDLISDTKMHLSSKLADGSSVCLDVDSSNSIITNPCKCS  499

Query  227  NNDSSCDPASQWFKII  180
            +   +CDP SQWFKI+
Sbjct  500  SGAPNCDPTSQWFKIV  515



>ref|XP_006290844.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
 gb|EOA23742.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
Length=554

 Score =   214 bits (545),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 147/211 (70%), Gaps = 3/211 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DWALWTLAGSYY+R+ T+G +E YGVL W+W   RN + LQ IS +Q+PF GP
Sbjct  332  LAADLDVDWALWTLAGSYYIRDKTIGSDETYGVLDWDWSSIRNSTILQMISAIQTPFTGP  391

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E++  K++FHP +GLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A
Sbjct  392  GLMETQPKKIMFHPSSGLCIVRKSLFQ-LKLGSCNRSESWKLSSHQVLSLTEERILCLKA  450

Query  401  EKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
             + GK  KL LF +D   SKW+++SDS+M L S  K+G+ VCLDVDS + I+  +CKCL 
Sbjct  451  YEKGKAVKLRLFFSDFHCSKWKLLSDSKMQLLSVTKNGTIVCLDVDSYSKIVMRSCKCLQ  510

Query  224  NDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  132
             +SSCDP SQWFK++ S+R  +    F   S
Sbjct  511  GNSSCDPRSQWFKLVTSSRRRSKSKPFIQIS  541



>ref|XP_006652422.1| PREDICTED: uncharacterized protein LOC102702088, partial [Oryza 
brachyantha]
Length=529

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 145/200 (73%), Gaps = 3/200 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+W   RN SF++RI+ +QSPF+GP
Sbjct  309  VAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWSATRNPSFIKRINSLQSPFQGP  368

Query  578  GYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  + +IFHP+TGLC+  V   + LELGPC ES+ W YT+   L ++ T  CLQA
Sbjct  369  GLPNSKEPYNVIFHPLTGLCL-VVKSSEALELGPCDESNAWSYTSTNQLVLKHTGQCLQA  427

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ AKLG  C+  S+KW++IS S MH+S++L K+G+ VCLD   +  I TN C+CL 
Sbjct  428  KSVGENAKLGTDCSKSSAKWQLISYSGMHVSAELTKNGTRVCLDATPDGTIETNLCECLT  487

Query  224  NDSSCDPASQWFKIIDSTRG  165
             D +C+P SQWFKII S++G
Sbjct  488  LDPNCNPESQWFKIILSSKG  507



>emb|CAH67677.1| H0510A06.2 [Oryza sativa Indica Group]
 emb|CAH66882.1| OSIGBa0158F13.13 [Oryza sativa Indica Group]
Length=555

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 141/216 (65%), Gaps = 15/216 (7%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGP
Sbjct  320  VAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGP  379

Query  578  GYTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYF  414
            G  E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    
Sbjct  380  GLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLL  439

Query  413  CLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DS  264
            CL+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D 
Sbjct  440  CLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDD  499

Query  263  NNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  156
               ++TN C+CL+ D+SCDP SQWFK++ STR   +
Sbjct  500  GRSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVAS  535



>ref|XP_003579979.1| PREDICTED: uncharacterized protein LOC100845861 [Brachypodium 
distachyon]
Length=558

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REG +  +E YG+L+W+W   RN SF++RI+ +QSPF+GP
Sbjct  338  VAAEMDLDWAIWALQGSYYIREGILAYDESYGLLSWDWYTARNPSFIKRINYLQSPFQGP  397

Query  578  GYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  +  IFHP+TGLCV  V     LELGPC ES+ W YT+   L ++ +  CL+A
Sbjct  398  GLPNSKKPYNAIFHPLTGLCV-LVKSPNSLELGPCDESNAWNYTSTCELVLKHSGQCLEA  456

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G  AKLG   +   SKW++ISDSRMH+S++L K+G+ VCLD   + VI TN CKCL 
Sbjct  457  KSVGDIAKLGTVSSKSCSKWQLISDSRMHVSTELTKNGTRVCLDASPDGVISTNQCKCLI  516

Query  224  NDSSCDPASQWFKIIDSTRG  165
             D +C+P SQWFK+I S++G
Sbjct  517  EDPTCNPESQWFKVILSSKG  536



>emb|CAD41090.2| OSJNBb0011N17.7 [Oryza sativa Japonica Group]
Length=555

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 140/212 (66%), Gaps = 15/212 (7%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGP
Sbjct  320  VAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGP  379

Query  578  GYTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYF  414
            G  E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    
Sbjct  380  GLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLL  439

Query  413  CLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DS  264
            CL+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D 
Sbjct  440  CLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDD  499

Query  263  NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
               ++TN C+CL+ D+SCDP SQWFK++ STR
Sbjct  500  GRSLVTNPCRCLSADNSCDPESQWFKLVTSTR  531



>gb|EEE61202.1| hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
Length=571

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 140/212 (66%), Gaps = 15/212 (7%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGP
Sbjct  336  VAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYF  414
            G  E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    
Sbjct  396  GLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLL  455

Query  413  CLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DS  264
            CL+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D 
Sbjct  456  CLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDD  515

Query  263  NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
               ++TN C+CL+ D+SCDP SQWFK++ STR
Sbjct  516  GRSLVTNPCRCLSADNSCDPESQWFKLVTSTR  547



>gb|EEC77495.1| hypothetical protein OsI_16343 [Oryza sativa Indica Group]
Length=571

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 140/212 (66%), Gaps = 15/212 (7%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LD DWALWTL GSYYLREG +GL+E YGVL W WC+PRN + L R+  +Q PFRGP
Sbjct  336  VAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALTRLHALQRPFRGP  395

Query  578  GYTESRLHKLIFHPMTGLCVRRVS---LFQPLELGPCSESDPWGYTAGKALTV--EGTYF  414
            G  E+  + ++FHP TG CV R S   +   LELG C E++ W YTA +      +    
Sbjct  396  GLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELGSCGEAEAWAYTASQQRLSPRDSPLL  455

Query  413  CLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS---------SKLKDGSNVCLDV-DS  264
            CL+AE  G+PA+LGL C D+ ++W + SDS++HL+          +  +G  +CLDV D 
Sbjct  456  CLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLAVNASSSSSSPETSNGGMLCLDVGDD  515

Query  263  NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
               ++TN C+CL+ D+SCDP SQWFK++ STR
Sbjct  516  GRSLVTNPCRCLSADNSCDPESQWFKLVTSTR  547



>ref|XP_002889989.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66248.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 136/199 (68%), Gaps = 6/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS +QSP +GPG
Sbjct  342  AAENDVDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISFLQSPLQGPG  401

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                  + L+FHP+TGLC+ R SL  P  L LGPC+ S+PW YT  KAL ++  + CLQ+
Sbjct  402  -PRIDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIKDQHLCLQS  458

Query  401  EKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
                 P  +    C+   SKW+ IS SRMHLSS   + +++CLDVD+ N I+ N CKCL+
Sbjct  459  NGPKNPVTMTRTSCSTSGSKWQTISASRMHLSSTTSNKTSLCLDVDTANNIVANACKCLS  518

Query  224  NDSSCDPASQWFKIIDSTR  168
             DSSC+P SQWFKII +TR
Sbjct  519  KDSSCEPMSQWFKIIKATR  537



>gb|KCW59700.1| hypothetical protein EUGRSUZ_H02458, partial [Eucalyptus grandis]
Length=516

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 132/186 (71%), Gaps = 1/186 (1%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D+D+ALWTL GSYYLR+G VG EEFYG+  ++W   RN S+L+RIS++Q PF+GP
Sbjct  331  MAAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFNYDWSGIRNSSYLRRISVLQLPFQGP  390

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-TVEGTYFCLQA  402
            G  ++  HK+IFHP+TGLC+ R      L LGPC  S+PW +T   AL  + G    L+A
Sbjct  391  GGRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCIYSEPWSHTPQNALGLMAGKPLYLRA  450

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
              LG+PA LG   T+  +KWE+IS S MHLSS  +DGS VCLDV +NN ++   CKCL++
Sbjct  451  VGLGRPATLGTSPTEPGTKWEMISASEMHLSSMAEDGSTVCLDVIANNTVMVEACKCLSS  510

Query  221  DSSCDP  204
            +SSCDP
Sbjct  511  ESSCDP  516



>gb|KCW59699.1| hypothetical protein EUGRSUZ_H02457, partial [Eucalyptus grandis]
Length=528

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 140/195 (72%), Gaps = 5/195 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LDFDWALWT+ GSYYLR+G VG+EE +GVL  ++  PRN SFLQRIS +Q+PF+G 
Sbjct  336  VAAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLNKDFSGPRNASFLQRISALQAPFQG-  394

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              + S   +++FHP+TGLC++R    + L+LG C+ES+ W +T    + + GT  C+QA+
Sbjct  395  ATSSSPTRRILFHPLTGLCIQRKREQEQLQLGACNESEAWTHTRHHTIRMRGTDLCMQAD  454

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN--VCLDVD-SNNVIITNTCKCL  228
            +L KP KL   C D  S+W+ IS+S+MH SS +  GSN  VCLD+D S   +I + CKCL
Sbjct  455  RLEKPVKLSTDCADHGSRWKTISESKMHFSSNIV-GSNVTVCLDIDFSTKTVIASPCKCL  513

Query  227  NNDSSCDPASQWFKI  183
              D++C+PASQWF++
Sbjct  514  REDATCNPASQWFEL  528



>gb|AAD31066.1|AC007357_15 F3F19.15 [Arabidopsis thaliana]
Length=522

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 135/199 (68%), Gaps = 6/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS +QSP +GPG
Sbjct  312  AAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFLQSPLQGPG  371

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
               +  + L+FHP+TGLC+ R SL  P  L LGPC+ S+PW YT  KAL ++    CLQ+
Sbjct  372  -PRTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIKDQQLCLQS  428

Query  401  EKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
                 P  +    C+   SKW+ IS SRMHL+S   + +++CLDVD+ N ++ N CKCL+
Sbjct  429  NGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTANNVVANACKCLS  488

Query  224  NDSSCDPASQWFKIIDSTR  168
             D SC+P SQWFKII +TR
Sbjct  489  KDKSCEPMSQWFKIIKATR  507



>ref|NP_172772.2| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AAU05478.1| At1g13130 [Arabidopsis thaliana]
 gb|AEE28973.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=552

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 135/199 (68%), Gaps = 6/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS +QSP +GPG
Sbjct  342  AAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFLQSPLQGPG  401

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
               +  + L+FHP+TGLC+ R SL  P  L LGPC+ S+PW YT  KAL ++    CLQ+
Sbjct  402  -PRTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIKDQQLCLQS  458

Query  401  EKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
                 P  +    C+   SKW+ IS SRMHL+S   + +++CLDVD+ N ++ N CKCL+
Sbjct  459  NGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTANNVVANACKCLS  518

Query  224  NDSSCDPASQWFKIIDSTR  168
             D SC+P SQWFKII +TR
Sbjct  519  KDKSCEPMSQWFKIIKATR  537



>ref|NP_189244.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AEE77124.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=551

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 153/224 (68%), Gaps = 10/224 (4%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+ D DW+LWTLAGSYY+RE ++G +E YGVL +NW   RN + LQ IS +Q+PF   
Sbjct  330  LAADRDLDWSLWTLAGSYYIREKSIGSDESYGVLDFNWSSIRNSTILQMISAIQTPF--I  387

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E++  K++FHP TGLC+ R SLFQ L+LG C+ S+ W  ++ + L++ E    CL+A
Sbjct  388  GLMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCNRSESWRLSSHRVLSLAEEQILCLKA  446

Query  401  EKLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
             + GK  KL LF ++   SKW++ SDS+M LSS  K+G +VCLDVD+ NN I+TN+CKCL
Sbjct  447  YEKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSITKNGFSVCLDVDTENNNIVTNSCKCL  506

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY---FLAKKL  105
              +SSCDP SQWFK++ STR  +    F   S LY   FL K L
Sbjct  507  RGNSSCDPRSQWFKLVTSTRRRSRPKPFLQIS-LYSKTFLQKSL  549



>ref|XP_010501449.1| PREDICTED: uncharacterized protein LOC104778702 [Camelina sativa]
Length=259

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  51   AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  110

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP+TGLC+ +  + +  L LGPC+ S+PW YT  KAL ++    CLQ+ 
Sbjct  111  -PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPCNSSEPWSYTK-KALRIKDRPLCLQSN  168

Query  398  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
                P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  169  GPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAASNNTSLCLDVDATNNNVVANACKCLS  228

Query  224  NDSSCDPASQWFKIIDSTR  168
             DSSC+P SQWFKII +TR
Sbjct  229  KDSSCEPMSQWFKIIKATR  247



>ref|XP_006395581.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
 gb|ESQ32867.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
Length=557

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 147/212 (69%), Gaps = 6/212 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAA+LD DWALWTLAGSYY+RE T+G +E +GVL  NW   RN   LQ IS +QSPFR  
Sbjct  336  LAADLDLDWALWTLAGSYYVREKTIGSDESFGVLDLNWSSIRNSIILQMISAIQSPFR--  393

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTV-EGTYFCLQA  402
            G  E++  K+IFHP +GLC+ R SLFQ L+LG C+ S+ +  ++ + L++ E   FCL+A
Sbjct  394  GLMETQPKKIIFHPSSGLCIVRKSLFQ-LKLGSCNRSESFKLSSHRVLSLTEEQIFCLKA  452

Query  401  EKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCL  228
             ++G P KL LF ++   SKW+ +S+S+M LSS  K+G +VCLDVDS+ N I+T +CKCL
Sbjct  453  YEIGDPVKLRLFFSESYCSKWKFLSESKMQLSSFTKNGESVCLDVDSDSNNIVTKSCKCL  512

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  132
              ++SC+P SQWFK++ STR       F   S
Sbjct  513  EGNASCNPKSQWFKLVTSTRSRCKTKPFLRIS  544



>ref|XP_010691763.1| PREDICTED: uncharacterized protein LOC104905020 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 128/195 (66%), Gaps = 7/195 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
             E D DWALW L GSYYLREG V  +E +G+L   W   RN  FLQRIS++Q P +GP  
Sbjct  333  VEHDLDWALWALTGSYYLREGQVNAKEQFGILDPKWTHIRNERFLQRISVIQYPRQGPEA  392

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQP---LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            +    HK+IFHP+TGLC+    L +P   ++LG CS+S+ W +T    L ++G+Y CL+A
Sbjct  393  SFRNKHKMIFHPLTGLCI----LSKPGMEVQLGNCSKSNHWNHTPENTLEIKGSYLCLKA  448

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
            + L  PAKL   C  + + W  ISDS++HL++ L + S  CLDVDS N +IT +CKCL+ 
Sbjct  449  QGLNLPAKLSTSCRGEGTSWAPISDSKLHLATTLSNNSTACLDVDSQNNLITTSCKCLSE  508

Query  221  DSSCDPASQWFKIID  177
             + CDP SQWFKI D
Sbjct  509  KNKCDPGSQWFKIAD  523



>ref|XP_006417151.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
 gb|ESQ35504.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
Length=561

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/220 (47%), Positives = 142/220 (65%), Gaps = 8/220 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YG L  +W   RN SFLQ+IS++QSP +GPG
Sbjct  342  AAENDVDWSLWALTGSYYLRQGVVGMIEYYGALDSDWISVRNSSFLQKISLLQSPLQGPG  401

Query  575  YTESRLHKLIFHPMTGLCV-RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP+TGLCV R +     L LGPC+ S PW YT  K L ++    CLQ+ 
Sbjct  402  -PRTDAYNLVFHPLTGLCVVRSLKDTTMLTLGPCNSSQPWSYTK-KTLRIKDQLLCLQSN  459

Query  398  KLGKPAKLGLF---CTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
              G   ++ +    C+   S W+ IS SRMHL++   + +++CLDVD+ N ++ N CKCL
Sbjct  460  --GPKNRVTMTRTSCSKPGSIWQTISASRMHLAATTSNKTSICLDVDATNNVVANACKCL  517

Query  227  NNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKK  108
            +NDSSC+P SQWFKII +TR   +   ++  S L  L+ K
Sbjct  518  SNDSSCEPMSQWFKIIKATRPLKSLGLYKQISSLDNLSPK  557



>ref|XP_004975985.1| PREDICTED: uncharacterized protein LOC101760765 [Setaria italica]
Length=566

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 137/209 (66%), Gaps = 12/209 (6%)
 Frame = -3

Query  749  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYT  570
            +LD DWALW L GSYYLREG   L+E YGVL   W  PRN S L R+  +Q P RGPG  
Sbjct  341  DLDMDWALWALQGSYYLREGVRDLDEVYGVLDRAWSGPRNASALSRVQALQRPLRGPGLD  400

Query  569  ESRLHKLIFHPMTGLCV-RRVSLFQPLELGPCSESDPWGYTAG-KALTV---EGTYFCLQ  405
            +   + ++FHP+TG CV RR S   PLELGPCSE++ W Y+A  + L V   +G+  CL+
Sbjct  401  QVPPYTVLFHPVTGTCVLRRRS--PPLELGPCSETEAWAYSAQEQRLAVAPRDGSSLCLR  458

Query  404  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHL---SSKLKDGSN-VCLDVDSN-NVIITNT  240
            AE  GKPA LG  C D  ++W ++SDS++H+   SS   DG   +CLDV ++   ++TN 
Sbjct  459  AEGAGKPASLGASCGDAMARWRLVSDSKLHVATSSSAAVDGDGALCLDVGADGRSVVTNP  518

Query  239  CKCLNNDSSCDPASQWFKIIDSTRGTTTK  153
            C+CL+ D+SCDP SQWFK++ STR    +
Sbjct  519  CRCLSADNSCDPQSQWFKLVTSTRSVAAE  547



>ref|XP_010494994.1| PREDICTED: uncharacterized protein LOC104772040 [Camelina sativa]
Length=363

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  155  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  214

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP+TGLC+ +  + +  L LGPC+ S+PW YT  KAL ++    CLQ+ 
Sbjct  215  -PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPCNSSEPWSYTK-KALRIKDRPLCLQSN  272

Query  398  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
                P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  273  GPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAASNNTSLCLDVDATNNNVVANACKCLS  332

Query  224  NDSSCDPASQWFKIIDSTR  168
             DSSC+P SQWFKII +TR
Sbjct  333  KDSSCEPMSQWFKIIKATR  351



>ref|XP_006307168.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
 gb|EOA40066.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
Length=552

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 134/198 (68%), Gaps = 4/198 (2%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VGL E+YGVL  +W   RN SFLQ++S++QSP +GP 
Sbjct  342  AAEHDLDWSLWALTGSYYLRQGVVGLNEYYGVLDKDWISVRNSSFLQKLSLLQSPLQGP-  400

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            + ++  + L+FHP+TGLC VR +     L LGPC+ S+PW YT  KA+ ++    CLQ+ 
Sbjct  401  HPQTDAYNLVFHPLTGLCIVRSLKDTTMLTLGPCNSSEPWSYTK-KAIRIKDQPLCLQSN  459

Query  398  KLGKPAKLGLFCTDDSSK-WEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
                P  L       SS  W+ +S SRMHLSS   + +++CLDVD+ N ++ N CKCL+ 
Sbjct  460  GPKNPVTLTRTSCSTSSSIWQTVSASRMHLSSTTSNKTSLCLDVDATNNVVANACKCLSK  519

Query  221  DSSCDPASQWFKIIDSTR  168
            DS+C+P SQWFKII +TR
Sbjct  520  DSTCEPMSQWFKIIKATR  537



>gb|EEC77494.1| hypothetical protein OsI_16340 [Oryza sativa Indica Group]
Length=554

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  334  VAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQSPFQGP  393

Query  578  GYTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S + + +IFHP++GLCV  V   + LELGPC +S+ W YT G  L ++ T  CLQA
Sbjct  394  GLPNSHQPYNVIFHPLSGLCV-LVKSSEALELGPCDKSNAWNYTKGYELILKQTGQCLQA  452

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ AKLG  C+  SSKW+++S+S MH+S++L  +G+ VCLD   +  I TN CKCL 
Sbjct  453  KSVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLDASPDGNITTNQCKCLT  512

Query  224  NDSSCDPASQWFKIIDSTR  168
             D  C+P SQWFKII S++
Sbjct  513  VDPDCNPESQWFKIILSSK  531



>ref|XP_010240029.1| PREDICTED: uncharacterized protein LOC100839976 [Brachypodium 
distachyon]
Length=562

 Score =   197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 134/201 (67%), Gaps = 6/201 (3%)
 Frame = -3

Query  734  WALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLH  555
            WALWTL GSYYLREG   L+E YGVL  +W  PRN + L+R+  +Q  FRGPG+ E+  +
Sbjct  345  WALWTLQGSYYLREGVRDLDEVYGVLDRSWRNPRNATALRRVRALQRAFRGPGFAEAAPY  404

Query  554  KLIFHPMTGLCV-RRVSLFQPLELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKP  384
              +FHP TGLCV RR S   PLELG C  ++ W Y A +      +    CL+AE  G+P
Sbjct  405  VALFHPSTGLCVARRSSPVSPLELGSCEGAEAWAYDAQRQRLALRDSPLMCLRAEGAGRP  464

Query  383  AKLGLFC-TDDSSKWEIISDSRMHLSSKLKDGSNV-CLDVDSN-NVIITNTCKCLNNDSS  213
             ++G+ C TD+ ++W ++SDS++H+++    G+ + CLDV ++   ++TNTC+CL+ D+S
Sbjct  465  VRVGMACATDEMARWRLVSDSKLHVAANASSGAGMLCLDVGADGRSVVTNTCRCLSADNS  524

Query  212  CDPASQWFKIIDSTRGTTTKS  150
            CDP SQWFK++ STR    +S
Sbjct  525  CDPESQWFKLVSSTRRVGARS  545



>ref|XP_010458756.1| PREDICTED: uncharacterized protein LOC104739968 isoform X2 [Camelina 
sativa]
Length=516

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 138/199 (69%), Gaps = 5/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  308  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  367

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              ++  + L+FHP+TGLC V+ ++    L LGPC+ S+PW YT  +AL ++    CLQ+ 
Sbjct  368  -PQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPCNSSEPWSYTK-QALRIKDQPLCLQSN  425

Query  398  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
                P       C+  SSKW+ +S SR+HLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  426  GPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTASNNTSLCLDVDATNNNVVANACKCLS  485

Query  224  NDSSCDPASQWFKIIDSTR  168
             DSSC+P SQWFKII +TR
Sbjct  486  KDSSCEPMSQWFKIIKATR  504



>emb|CAH66880.1| OSIGBa0158F13.11 [Oryza sativa Indica Group]
Length=554

 Score =   196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 145/199 (73%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  334  VAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQSPFQGP  393

Query  578  GYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  + +IFHP++GLCV  V   + LELGPC +S+ W YT G  L ++ T  CLQA
Sbjct  394  GLPNSQQPYNVIFHPLSGLCV-LVKSSEALELGPCDKSNAWNYTKGYELILKQTGQCLQA  452

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ AKLG  C+  SSKW+++S+S MH+S++L  +G+ VCL+   +  I TN CKCL 
Sbjct  453  KSVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLEASPDGNITTNQCKCLT  512

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +C+P SQWFKII S++
Sbjct  513  VDPNCNPESQWFKIILSSK  531



>ref|NP_001053105.1| Os04g0480900 [Oryza sativa Japonica Group]
 emb|CAD41088.2| OSJNBb0011N17.5 [Oryza sativa Japonica Group]
 dbj|BAF15019.1| Os04g0480900 [Oryza sativa Japonica Group]
 dbj|BAG98948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61201.1| hypothetical protein OsJ_15210 [Oryza sativa Japonica Group]
Length=554

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 145/199 (73%), Gaps = 3/199 (2%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE+D DWA+W L GSYY+REGT+  +E YG+L+W+WC  RN SF++RI+ +QSPF+GP
Sbjct  334  VAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLSWDWCTARNPSFIKRINALQSPFQGP  393

Query  578  GYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
            G   S+  + +IFHP++GLCV  V   + LELGPC +S+ W YT G  L ++ T  CLQA
Sbjct  394  GLPNSQQPYNVIFHPLSGLCV-LVKSSEALELGPCDKSNAWNYTKGYELILKQTGQCLQA  452

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-KDGSNVCLDVDSNNVIITNTCKCLN  225
            + +G+ AKLG  C+  SSKW+++S+S MH+S++L  +G+ VCL+   +  I TN CKCL 
Sbjct  453  KSVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELTNNGTRVCLEASPDGNITTNQCKCLT  512

Query  224  NDSSCDPASQWFKIIDSTR  168
             D +C+P SQWFKII S++
Sbjct  513  VDPNCNPESQWFKIILSSK  531



>ref|XP_010495004.1| PREDICTED: uncharacterized protein LOC104772051 [Camelina sativa]
Length=550

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  342  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  401

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP+TGLC+ +  + +  L LGPC+ S+PW YT  KAL ++    CLQ+ 
Sbjct  402  -PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPCNSSEPWSYTK-KALRIKDRPLCLQSN  459

Query  398  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
                P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  460  GPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAASNNTSLCLDVDATNNNVVANACKCLS  519

Query  224  NDSSCDPASQWFKIIDSTR  168
             DSSC+P SQWFKII +TR
Sbjct  520  KDSSCEPMSQWFKIIKATR  538



>dbj|BAK05121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   196 bits (498),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 129/204 (63%), Gaps = 9/204 (4%)
 Frame = -3

Query  734  WALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLH  555
            WALWTL GSYYLR+G + L+E YGVL   W  PRN + L+R+  +Q P RGPGY E+  +
Sbjct  350  WALWTLQGSYYLRQGVLDLDEVYGVLDRAWSSPRNHTALRRVQPLQRPLRGPGYAEAAPY  409

Query  554  KLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYT--AGKALTVEGTYFCLQAEKLGKPA  381
             ++FHP TGLCV R S  QPLELG C+ ++ W Y    G+    +    CL A+  G P 
Sbjct  410  TVLFHPATGLCVLRRSPTQPLELGACANTEAWEYAPQQGRLALRDSPLMCLHAQGAGLPV  469

Query  380  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNN  222
            + G+ C DD S+W ++SDS++H++       +      +CLDVD++   ++TN C+CL+ 
Sbjct  470  RFGMPCDDDMSRWRLVSDSKLHVAVNASSSGSGSGGGMLCLDVDADGQSVVTNPCRCLSA  529

Query  221  DSSCDPASQWFKIIDSTRGTTTKS  150
            D+SCDP +QWFK++ STR     S
Sbjct  530  DNSCDPENQWFKLVTSTRSVAASS  553



>ref|XP_010476303.1| PREDICTED: uncharacterized protein LOC104755594 [Camelina sativa]
Length=559

 Score =   196 bits (498),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 137/201 (68%), Gaps = 8/201 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  354  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQQISLLQSPLQGPG  413

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP---LELGPCSESDPWGYTAGKALTVEGTYFCLQ  405
               +  + L+FHP+TGLC+ R SL      L LGPC+ S+PW YT  +AL ++    CLQ
Sbjct  414  -PRTDAYNLVFHPLTGLCMVR-SLNDKTMMLTLGPCNSSEPWSYTK-QALRIKDQSLCLQ  470

Query  404  AEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKC  231
            +     P       C+  SSKW+ +S SRMHLSS   + +++CLDVD+ NN ++ N CKC
Sbjct  471  SNGPNNPVTMTRTSCSTSSSKWQTVSASRMHLSSTASNNTSLCLDVDATNNNVVANACKC  530

Query  230  LNNDSSCDPASQWFKIIDSTR  168
            L+ DSSC+P SQWFKII +TR
Sbjct  531  LSKDSSCEPMSQWFKIIKATR  551



>ref|XP_010458755.1| PREDICTED: uncharacterized protein LOC104739968 isoform X1 [Camelina 
sativa]
Length=550

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 138/199 (69%), Gaps = 5/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VG+ E+YGVL  +W   RN SFLQ+IS++QSP +GPG
Sbjct  342  AAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLDSDWISVRNSSFLQKISLLQSPLQGPG  401

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              ++  + L+FHP+TGLC V+ ++    L LGPC+ S+PW YT  +AL ++    CLQ+ 
Sbjct  402  -PQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPCNSSEPWSYTK-QALRIKDQPLCLQSN  459

Query  398  KLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
                P       C+  SSKW+ +S SR+HLSS   + +++CLDVD+ NN ++ N CKCL+
Sbjct  460  GPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTASNNTSLCLDVDATNNNVVANACKCLS  519

Query  224  NDSSCDPASQWFKIIDSTR  168
             DSSC+P SQWFKII +TR
Sbjct  520  KDSSCEPMSQWFKIIKATR  538



>gb|KCW59701.1| hypothetical protein EUGRSUZ_H02460 [Eucalyptus grandis]
Length=262

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 129/185 (70%), Gaps = 5/185 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+LDFDWALWT+ GSYYLR+G VG++E +GVL  ++  PRN SFLQRIS +Q+PF+G 
Sbjct  80   VAAKLDFDWALWTIVGSYYLRKGIVGMDETFGVLNKDFSGPRNASFLQRISALQAPFQG-  138

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              + +   +++FHP+TGLC++R    + L+LG C+ES+ W +T    + + GT  C+QA+
Sbjct  139  ATSSNPTRRILFHPLTGLCIQRKPEQEQLQLGACNESEAWTHTHHHTVRMRGTDLCMQAD  198

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN--VCLDVD-SNNVIITNTCKCL  228
            +L KP KL   C D  S+W+ IS+S MH SS +  GSN  VCLD+D S   +I + CKCL
Sbjct  199  RLEKPVKLSTNCADHGSRWKTISESNMHFSSNIV-GSNVTVCLDIDFSTKTVIASPCKCL  257

Query  227  NNDSS  213
              DS+
Sbjct  258  REDST  262



>ref|XP_006400290.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
 gb|ESQ41743.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
Length=528

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 128/197 (65%), Gaps = 10/197 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  337  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHNVHNYTYLQRLSVIQPPHKGPG  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEG--TYFCL  408
               +  HK +FHP+TGLC+ R S      L LGPC++ +PW Y+ G  L ++G     CL
Sbjct  397  IKHNH-HKKLFHPLTGLCLVRKSPCHESELTLGPCTKDEPWSYSHGGTLEIKGGTQRSCL  455

Query  407  QAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKC  231
            + E + GK  KLG  CT    K + IS ++MHLS K KDGS VCLDVDS+N +  N CKC
Sbjct  456  EGETMVGKSVKLGTRCT----KVKRISATKMHLSFKSKDGSLVCLDVDSDNNVFANRCKC  511

Query  230  LNNDSSCDPASQWFKII  180
            L  DSSC+PASQWFKI 
Sbjct  512  LTGDSSCEPASQWFKIF  528



>emb|CDY16066.1| BnaC08g40570D [Brassica napus]
Length=553

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 128/197 (65%), Gaps = 6/197 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L G+YYLR+G VGL E+YGVL  +W   RN SFLQ+IS++QS  +GPG
Sbjct  341  AAENDVDWSLWALTGTYYLRQGVVGLNEYYGVLDSDWISVRNSSFLQKISLLQSTLQGPG  400

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP+TGLC VR +     L LGPC+ S+PW YT  K L +E    CLQ+ 
Sbjct  401  -PRTDAYNLVFHPLTGLCLVRSLKDTTMLTLGPCNSSEPWSYTK-KTLRIEDQPLCLQSN  458

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
                P           S+W+ IS SRMHL+      +++CLDVD+ N I+ N CKCL+ D
Sbjct  459  ---GPENRVTMSRTGCSRWQTISASRMHLALTTSKNNSLCLDVDATNNILANPCKCLSKD  515

Query  218  SSCDPASQWFKIIDSTR  168
            SSC P SQWFKII++TR
Sbjct  516  SSCQPMSQWFKIINATR  532



>ref|XP_010662248.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=307

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -3

Query  632  NLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY  453
            N  +L++    ++   GP    +R +K++ HP TGLCV R SL +PL+LGPC+ES+ WGY
Sbjct  130  NGEYLEKAVAYKASLTGPDAPHARPYKMVLHPSTGLCVLRGSLSEPLKLGPCTESEAWGY  189

Query  452  TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD  273
            T  K L ++GTY CLQA  LGKPAKL + C++  S WE ISDS+M+LS+KL +G+ VCLD
Sbjct  190  TPQKILIIKGTYLCLQAVGLGKPAKLSVICSNPGSNWESISDSKMYLSTKLGNGTTVCLD  249

Query  272  VDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  159
            VDS++ I+TN+CKCL+ D  CDP SQWFKI +ST  T+
Sbjct  250  VDSSDDIVTNSCKCLSRDDMCDPGSQWFKIANSTDITS  287



>ref|XP_002871770.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48029.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 131/196 (67%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDIDWAVWALTGVYYFREGKRGVLEAYGMLDANWHNVHNYTYLRRLSVIQPPHKGPG  396

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  405
               +  HK IFHP+TGLC VR+ S ++  L LGPC++ +PW Y+ G  L ++G +  CL+
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSSCYESELMLGPCTKGEPWSYSHGGILEIKGGHKSCLE  455

Query  404  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             E  +G+  KLG  CT    K   IS ++MHLS K  DGS VCLDVDS+N ++ N+CKCL
Sbjct  456  GETAVGRSVKLGKKCT----KIMQISATKMHLSLKTNDGSLVCLDVDSDNNVVANSCKCL  511

Query  227  NNDSSCDPASQWFKII  180
              D +C+PASQWFKI 
Sbjct  512  TGDITCEPASQWFKIF  527



>ref|XP_009148543.1| PREDICTED: uncharacterized protein LOC103871957 [Brassica rapa]
Length=574

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA  D DW+LW L GSYYLREG VGL E+YGVL  +W   RN SFLQ+I+++QS  +GPG
Sbjct  358  AAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLLQSQLQGPG  417

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP TGLC VR ++    L LGPC+ S+PW YT  + L  +    CLQ+ 
Sbjct  418  -PSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPCNSSEPWSYTK-QTLRSKDQSLCLQSN  475

Query  398  KLGKPAKL-GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
              G    +  + C+   S W+ IS S+MHL+S   + ++VCLDVD+++ ++ N CKCL+ 
Sbjct  476  GPGNRVTMTKMDCSSPGSIWQTISASKMHLASTTSNNTSVCLDVDADDNVLANACKCLSK  535

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSC+P SQWF II +TR
Sbjct  536  DSSCEPMSQWFTIIKATR  553



>ref|XP_006289374.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
 gb|EOA22272.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
Length=527

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 129/196 (66%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDMDWAVWALTGVYYFREGKRGVVEAYGMLDANWHNVHNSTYLRRLSVIQPPHKGPG  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  405
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+ G  L ++G +  CL+
Sbjct  397  IRRNH-HKKIFHPLTGLCLVRKSPCHDSELTLGPCTKDEPWSYSHGGTLEIKGGHKSCLE  455

Query  404  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             E  +GK  KLG  CT    K + IS ++MHLS +  +GS VCLDVDS+N +I N+CKCL
Sbjct  456  GETAVGKSVKLGKRCT----KVKQISATKMHLSFETDEGSLVCLDVDSDNNVIANSCKCL  511

Query  227  NNDSSCDPASQWFKII  180
              D SC+PASQWFKI 
Sbjct  512  TGDVSCEPASQWFKIF  527



>emb|CDY19395.1| BnaC05g09040D [Brassica napus]
Length=527

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 131/198 (66%), Gaps = 4/198 (2%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA  D DW+LW L GSYYLREG VGL E+YGVL  +W   RN SFLQ+I+++QS  +GPG
Sbjct  311  AAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLLQSQLQGPG  370

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP TGLC VR ++    L LGPC+ S+PW YT  + L ++    CLQ+ 
Sbjct  371  -PSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPCNSSEPWSYTK-QTLRIKDQSLCLQSN  428

Query  398  KLGKPAKL-GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
              G    +    C+   S W+ IS S+MHL+S   + ++VCLDV +++ ++ N CKCL+ 
Sbjct  429  GPGNRVTMTKTDCSSPGSIWQTISASKMHLASTTSNNTSVCLDVAADDKVLANACKCLSK  488

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSC+P SQWF II++TR
Sbjct  489  DSSCEPMSQWFTIINATR  506



>ref|NP_197252.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAC01894.1| putative protein [Arabidopsis thaliana]
 gb|AED92434.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 125/196 (64%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W + G YY REG  G+ E YG+L  NW    N ++L+R+S++Q P  GPG
Sbjct  336  AAEKDLDWAVWAVTGVYYFREGKRGVVEAYGMLDANWHNVHNYTYLRRLSVIQPPHTGPG  395

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVE-GTYFCLQ  405
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+ G  L +  G   CL+
Sbjct  396  VKHNH-HKKIFHPLTGLCLVRKSHCHESELTLGPCTKDEPWSYSHGGILEIRRGHKSCLE  454

Query  404  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             E  +GK  KLG  CT    K E IS ++MHLS    DGS VCLDVDS+N ++ N+C CL
Sbjct  455  GETAVGKSVKLGRICT----KIEQISATKMHLSFNTSDGSLVCLDVDSDNNVVANSCNCL  510

Query  227  NNDSSCDPASQWFKII  180
              D++C+PASQWFKI 
Sbjct  511  TGDTTCEPASQWFKIF  526



>ref|XP_009381699.1| PREDICTED: uncharacterized protein LOC103969775 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 130/198 (66%), Gaps = 5/198 (3%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALWTL GSYYLREG V   E YG+LT++W   RN + LQ++  +Q PF+GPG 
Sbjct  279  ADKDVDWALWTLQGSYYLREGVVDKGESYGMLTYDWAGVRNQTVLQKVRAVQQPFQGPGV  338

Query  572  TESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSES-DPWGYTAGKALTVEGTYFCLQAE  399
            +++  + +I HP TGLCVR+ SL    L+ GPC  +   + YT  + LT   +  C+ A 
Sbjct  339  SKTPPYIIILHPSTGLCVRQGSLTSHTLDFGPCDGNMQAFHYTQQQTLTSVDSSLCVSAT  398

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK-DGSNVCLDVDSNNVIITNTCKCLNN  222
              GKP K    C+D  S W+++SDS MH+S+ L  DGS +CLDV  N V +TN CKCL +
Sbjct  399  GSGKPVKFD-SCSDSGSSWDLVSDSGMHVSTTLPGDGSTLCLDVGQNGV-VTNPCKCLRD  456

Query  221  DSSCDPASQWFKIIDSTR  168
            D++CDP SQWFK++ S +
Sbjct  457  DANCDPGSQWFKLVTSAK  474



>emb|CDY38435.1| BnaA10g17230D [Brassica napus]
Length=524

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 129/196 (66%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  334  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVIQPPHKGPG  393

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  405
               +  HK IFHP+TGLC VR+   ++  L LGPC++ +PW Y+ G  L ++G +  C++
Sbjct  394  IKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGPCTKDEPWSYSHGDRLEIKGGHKSCVE  452

Query  404  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             E  +G+  KLG  CT    K + IS ++MHL+ K  DG  VCLDVDS+N I+ N CKCL
Sbjct  453  GETSVGRSVKLGKKCT----KIKRISATKMHLAFKNNDGLLVCLDVDSDNNIVANHCKCL  508

Query  227  NNDSSCDPASQWFKII  180
              D SC+PASQWFKI 
Sbjct  509  TGDISCEPASQWFKIF  524



>ref|XP_009107523.1| PREDICTED: uncharacterized protein LOC103833179 [Brassica rapa]
Length=527

 Score =   187 bits (476),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 129/196 (66%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  337  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVIQPPHKGPG  396

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  405
               +  HK IFHP+TGLC VR+   ++  L LGPC++ +PW Y+ G  L ++G +  C++
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGPCTKDEPWSYSHGDRLEIKGGHKSCVE  455

Query  404  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             E  +G+  KLG  CT    K + IS ++MHL+ K  DG  VCLDVDS+N I+ N CKCL
Sbjct  456  GETSVGRSVKLGKKCT----KIKRISATKMHLAFKNNDGLLVCLDVDSDNNIVANHCKCL  511

Query  227  NNDSSCDPASQWFKII  180
              D SC+PASQWFKI 
Sbjct  512  TGDISCEPASQWFKIF  527



>ref|XP_010492706.1| PREDICTED: uncharacterized protein LOC104770057 [Camelina sativa]
Length=528

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 131/197 (66%), Gaps = 10/197 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY+REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDMDWAVWALTGVYYIREGKRGVVESYGMLDANWHNVHNSTYLRRLSVIQQPHKGPG  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTA-GKALTVEGTY-FCL  408
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+  G  L ++G +  CL
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSPCHESELTLGPCTKDEPWSYSHHGGVLEIKGGHKSCL  455

Query  407  QAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKC  231
            ++E  +GK  KLG  CT    K + IS ++MHLS K  +GS VCLDVDS+N ++ N+CKC
Sbjct  456  ESETAVGKSVKLGKKCT----KIKQISATKMHLSFKTNEGSLVCLDVDSDNNVVANSCKC  511

Query  230  LNNDSSCDPASQWFKII  180
            L  D SC+PASQWFKI 
Sbjct  512  LTGDVSCEPASQWFKIF  528



>emb|CDY16914.1| BnaC09g40410D [Brassica napus]
Length=524

 Score =   187 bits (475),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 128/196 (65%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY REG  G+ E YG+L  NW    N ++LQR+S++Q P +GPG
Sbjct  334  AAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLDANWHHVHNHTYLQRLSVIQPPHKGPG  393

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  405
               +  HK IFHP+TGLC VR+   ++  L LGPC++ +PW Y+ G  L ++G +  C++
Sbjct  394  IKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGPCTKDEPWSYSHGDRLEIKGGHKSCVE  452

Query  404  AE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             E  +G   KLG  CT    K + IS ++MHLS K  DG  VCLDVDS+N ++ N CKCL
Sbjct  453  GETSVGSSVKLGKKCT----KIKRISATKMHLSFKNNDGLLVCLDVDSDNNVVANHCKCL  508

Query  227  NNDSSCDPASQWFKII  180
              D SC+PASQWFKI 
Sbjct  509  TGDISCEPASQWFKIF  524



>ref|XP_004955049.1| PREDICTED: uncharacterized protein LOC101776534 [Setaria italica]
Length=556

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 124/209 (59%), Gaps = 12/209 (6%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AA+ D DWA W L GSY LR+G  G++E YGVL W+W +PRN + L RI  +Q P +GP
Sbjct  337  VAAKHDLDWAYWALQGSYALRQGVAGMDEVYGVLDWSWTKPRNETVLSRIQALQRPIQGP  396

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVE-------GT  420
            GY E+  + ++FHP+TGLC    +    LEL PC+E+D W Y    +  V        G 
Sbjct  397  GYGEALPYTVLFHPLTGLCAAASAAAGTLELRPCNETDAWAYAPPSSTLVRRDAAAAGGL  456

Query  419  YFCLQAEKLGKPAKLGL-FCTDDSSKWEIISDSRMHLSSKLK---DGSNVCLDVDSNN-V  255
              CL+AE  G PA+LG   C D  S W I SDS MH++        G  +CLDV ++   
Sbjct  457  LPCLRAEGRGLPARLGTKACGDALSTWRIASDSGMHVAVDAAPELGGGTLCLDVGADGRS  516

Query  254  IITNTCKCLNNDSSCDPASQWFKIIDSTR  168
            I+TN C CL  D +CDP  QWFK++ STR
Sbjct  517  IVTNPCACLRGDGTCDPERQWFKLVTSTR  545



>ref|XP_010420476.1| PREDICTED: uncharacterized protein LOC104706046 [Camelina sativa]
Length=527

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 126/196 (64%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YY+REG  G+ E YG+L  NW    N ++L+R+S++Q P +GPG
Sbjct  337  AAEKDMDWAVWALTGVYYIREGKRGVVESYGMLDANWHNVHNSTYLRRLSVIQQPHKGPG  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGPCSESDPWGYTAGKALTVEGTY-FCLQ  405
               +  HK IFHP+TGLC+ R S      L LGPC++ +PW Y+ G  L ++G +  CL+
Sbjct  397  IKHNH-HKKIFHPLTGLCLVRKSPCHESELTLGPCTKDEPWSYSHGGVLEIKGGHKSCLE  455

Query  404  AEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
             E   GK  KLG  CT    K   IS ++MHLS K  +GS VCLDVD +N ++ N CKCL
Sbjct  456  GETAEGKSVKLGKRCT----KIMQISATKMHLSFKTNEGSLVCLDVDPDNNVVANPCKCL  511

Query  227  NNDSSCDPASQWFKII  180
              D SC+PASQWFKI 
Sbjct  512  TGDVSCEPASQWFKIF  527



>gb|EMT10461.1| Endoglucanase E1 [Aegilops tauschii]
Length=498

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 134/218 (61%), Gaps = 16/218 (7%)
 Frame = -3

Query  713  GSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPM  534
            GSYYLR+G + L+E YGVL   W  PRN + L+R+  +Q P RGPGY E+  + ++FHP 
Sbjct  284  GSYYLRQGVLDLDEVYGVLDRAWSRPRNDTALRRVQPLQRPLRGPGYAEAAPYTVLFHPA  343

Query  533  TGLCVRRVSLFQPLELGPCSESDPWGYTA--GKALTVEGTYFCLQAEKLGKPAKLGLFCT  360
            TGLCV R SL QPLELG C++++ W Y    G+    +    CL+A+  G+P +LG  C 
Sbjct  344  TGLCVLRRSLTQPLELGACADTEAWEYAPQQGRLALRDSPLMCLRAQGAGRPVRLGTPCD  403

Query  359  DDSSKWEIISDSRMHLSSKLKDGSN-------VCLDVDSN-NVIITNTCKCLNNDSSCDP  204
            DD S+W ++SDS++H++      S+       +CLDV ++   ++TN C+CL+ D+SCDP
Sbjct  404  DDMSRWRLVSDSKLHVAVNTSSSSSSGSGSGMLCLDVGADGQSVVTNPCRCLSADNSCDP  463

Query  203  ASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFASYI  90
             SQWFK++ STR         +   L  L  KL +S I
Sbjct  464  ESQWFKLVSSTRSVA------ANGMLAELPVKLGSSKI  495



>ref|XP_002446675.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
 gb|EES11003.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
Length=586

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 134/211 (64%), Gaps = 23/211 (11%)
 Frame = -3

Query  716  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  537
             GSYYLREG +GL+E YGVL W WC+PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  357  QGSYYLREGVLGLDEVYGVLDWAWCKPRNDTALRRVQALQRPLRGPGLAEAAPYAVLFHP  416

Query  536  MTGLC--VRRVS----LFQPLE--LGPCSESDPWGYTAGK---ALTVEGTYFCLQAEKLG  390
            ++G+C  VRR S    L QP E  LGPCSE+  W Y+A +    L       CL+AE  G
Sbjct  417  VSGMCVVVRRRSPTPTLAQPFELGLGPCSETGAWEYSAQQQRLGLRDTAALLCLRAEGAG  476

Query  389  KPAKLGLFCTDDSSKWEIISDSRMHLS----------SKLKDGSN-VCLDVDSNN-VIIT  246
            +PA LG+ C D  ++W ++SDS++H++              DG+  +CLDV ++   ++T
Sbjct  477  RPATLGVTCGDAMARWSLVSDSKLHVAVNATSSSSAGVSDSDGNGLLCLDVGADGRSVVT  536

Query  245  NTCKCLNNDSSCDPASQWFKIIDSTRGTTTK  153
            N C+CL+ D+SCDP SQWFK++ STR   TK
Sbjct  537  NPCRCLSADNSCDPQSQWFKLVSSTRSVVTK  567



>ref|NP_189245.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 dbj|BAB02434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77125.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=508

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 136/201 (68%), Gaps = 8/201 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++WTL GSYYLREG VG+ EFYG+L  +W   R+ SFLQR+S++ SP +GPG
Sbjct  311  AAENDVDWSIWTLQGSYYLREGVVGMSEFYGILDSDWVRVRSQSFLQRLSLILSPLQGPG  370

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
             ++S+++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    LT++    CL++
Sbjct  371  -SQSKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPQNTLTLKDKSLCLES  428

Query  401  EKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
                 P KL    C+  + S+WE IS S M L++K  + S +CLDVD  N ++ + CKC+
Sbjct  429  TGPNAPVKLSETSCSSPNLSEWETISASNMLLAAKSTNNS-LCLDVDETNNLMASNCKCV  487

Query  227  N-NDSSCDPASQWFKIIDSTR  168
               DSSCDP SQWFKI+  ++
Sbjct  488  KGEDSSCDPISQWFKIVKVSK  508



>gb|ACF85134.1| unknown [Zea mays]
Length=492

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 128/203 (63%), Gaps = 15/203 (7%)
 Frame = -3

Query  716  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  537
             GSYYLREG +GL+E YGVL W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  271  QGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHP  330

Query  536  MTGLCVRRV----SLFQP--LELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPA  381
            ++G+CV R     SL QP  L LGPC+E++ W Y+A +      +    CL+AE  G+PA
Sbjct  331  VSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQRLALRDAALLCLRAEGAGRPA  390

Query  380  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNN  222
             L + C D  ++W  +SDS++H++      +       +CLDV ++   ++TN C+CL+ 
Sbjct  391  SLAVSCGDAMARWGFVSDSKLHVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSA  450

Query  221  DSSCDPASQWFKIIDSTRGTTTK  153
            D+SCDP  QWFK++ STR   TK
Sbjct  451  DNSCDPQGQWFKLVSSTRSVVTK  473



>ref|XP_010549752.1| PREDICTED: uncharacterized protein LOC104820833 [Tarenaya hassleriana]
Length=531

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 126/198 (64%), Gaps = 11/198 (6%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W LAG YYLR+G  GL E YG+L  NW    N +FL+RIS++Q P++GPG
Sbjct  339  AAEKDVDWAIWALAGDYYLRQGKRGLVETYGMLNPNWHHIHNSTFLRRISVIQPPYKGPG  398

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGPCSESDPWGYTAGKALTV---EGTYFC  411
             + ++ H  IFHP+TG CV R S  +   L LGPC   +PW Y       V     +  C
Sbjct  399  VSHNQ-HNRIFHPLTGFCVVRNSRKRRSELTLGPCGRHEPWSYNGHIGTLVMKDHRSVLC  457

Query  410  LQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCK  234
            L+ +   G+  KLG  C    SK E +S S+MHLS K + GS++CLDVDS N ++ N CK
Sbjct  458  LEGDVTGGRRVKLGKKC----SKIERVSASKMHLSFKTRLGSSLCLDVDSMNNVVANPCK  513

Query  233  CLNNDSSCDPASQWFKII  180
            CL+ D+SCDP SQWFKI+
Sbjct  514  CLSKDASCDPTSQWFKIL  531



>gb|KFK38059.1| hypothetical protein AALP_AA3G064700 [Arabis alpina]
Length=449

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 125/196 (64%), Gaps = 9/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            A E D DWA+W L G YYLREG   + E +G+L  NW + RN S+LQR+S++Q P +GPG
Sbjct  259  AVEKDIDWAVWVLTGDYYLREGKRNVVEPFGILDTNWHDARNSSYLQRLSVIQQPHKGPG  318

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLE--LGPCSESDPWGYTAGKALTVE-GTYFCLQ  405
               +  HK IFHP+TGLC+ R SL    E  LGPC++ +PW Y     L ++     C++
Sbjct  319  LRHNH-HKKIFHPLTGLCIVRESLCHDSELVLGPCTKEEPWSYNNHGTLMIKTHESICVE  377

Query  404  AEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
              K+ GK  KLG  C    SK E IS S+MH S K +DGS +CLDVDS N ++ + CKCL
Sbjct  378  GGKVAGKVVKLGKEC----SKIERISASKMHFSLKDQDGSLICLDVDSKNKVVWSPCKCL  433

Query  227  NNDSSCDPASQWFKII  180
              D++C+P SQWFKI 
Sbjct  434  TGDATCEPESQWFKIF  449



>ref|XP_006292902.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
 gb|EOA25800.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
Length=511

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 136/204 (67%), Gaps = 11/204 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFR---  585
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   RN+SFLQR+S++QSP +   
Sbjct  311  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRNMSFLQRLSLIQSPLQSLP  370

Query  584  GPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFC  411
            GPG ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    LT++    C
Sbjct  371  GPG-SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPDNTLTLKDKSLC  428

Query  410  LQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTC  237
            L+      P KL    C+  + SKW  IS S M L++K  + S +CLDVD +N +I + C
Sbjct  429  LENTGPNAPVKLSKTSCSSPNLSKWHTISASNMLLAAKSTNNS-LCLDVDESNNLIASNC  487

Query  236  KCLN-NDSSCDPASQWFKIIDSTR  168
            KC+   DSSCDP SQWFKII  ++
Sbjct  488  KCVKGEDSSCDPMSQWFKIIKVSK  511



>ref|NP_001130915.1| hydrolase, hydrolyzing O-glycosyl compound precursor [Zea mays]
 gb|ACF85192.1| unknown [Zea mays]
 gb|ACG23910.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
 gb|ACN27949.1| unknown [Zea mays]
 gb|ACN28477.1| unknown [Zea mays]
 gb|ACN34624.1| unknown [Zea mays]
 gb|ACN34788.1| unknown [Zea mays]
 tpg|DAA37297.1| TPA: hydrolase, hydrolyzing O-glycosyl compound [Zea mays]
Length=576

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 128/203 (63%), Gaps = 15/203 (7%)
 Frame = -3

Query  716  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  537
             GSYYLREG +GL+E YGVL W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  355  QGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHP  414

Query  536  MTGLCVRR----VSLFQP--LELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPA  381
            ++G+CV R     SL QP  L LGPC+E++ W Y+A +      +    CL+AE  G+PA
Sbjct  415  VSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQRLALRDAALLCLRAEGAGRPA  474

Query  380  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSNN-VIITNTCKCLNN  222
             L + C D  ++W  +SDS++H++      +       +CLDV ++   ++TN C+CL+ 
Sbjct  475  SLAVSCGDAMARWGFVSDSKLHVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSA  534

Query  221  DSSCDPASQWFKIIDSTRGTTTK  153
            D+SCDP  QWFK++ STR   TK
Sbjct  535  DNSCDPQGQWFKLVSSTRSVVTK  557



>ref|XP_004975262.1| PREDICTED: uncharacterized protein LOC101779133 [Setaria italica]
Length=595

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 137/226 (61%), Gaps = 18/226 (8%)
 Frame = -3

Query  746  LDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTE  567
            LD DWALW L GSYYLREG  G +E YGVL  +W  PRN + L+R+  +Q PFRGPG  E
Sbjct  361  LDLDWALWALQGSYYLREGVAGHDEAYGVLGHDWLRPRNGTALRRVRALQRPFRGPGLDE  420

Query  566  SRLHKLIFHPMTGLCV---RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYF--CLQA  402
            +  +  +FHP TGLCV   RR SL   LELGPC+E++ W Y     L + G++   CL+A
Sbjct  421  AAPYDALFHPATGLCVVRRRRSSL--TLELGPCNETEAWEYNPEHRLVLRGSWLRPCLRA  478

Query  401  EKLGKPAKLGL---FCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSNN-VI  252
            E  G+P +LG+    C    ++W + S S++H++      S+      +CLDV ++   I
Sbjct  479  EGAGRPVRLGVGRAGCAGAQARWLLESKSKLHVAVHAPPSSSSSRSEILCLDVSADGRSI  538

Query  251  ITNTCKCLNNDSS-CDPASQWFKIIDSTRGTTTKSDFQSTSFLYFL  117
            +TN C+CL+  SS CDP SQWFK++ STR   + S   +   L+ L
Sbjct  539  VTNRCRCLSGGSSRCDPESQWFKLVSSTRKVASGSSVLAQLLLHVL  584



>emb|CDX98009.1| BnaA06g07600D [Brassica napus]
Length=557

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 126/198 (64%), Gaps = 4/198 (2%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA  D DW+LW L G YYLREG VGL E+YGVL  +W   RN SFLQ+I+++QS  +GPG
Sbjct  341  AAGNDVDWSLWALTGRYYLREGKVGLVEYYGVLDSDWISVRNSSFLQKITLLQSQLQGPG  400

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
               +  + L+FHP TGLC VR  +    L LGPC+ S+PW YT  + L  +    CLQ+ 
Sbjct  401  -PSTDAYNLVFHPYTGLCLVRSPNDTTMLTLGPCNSSEPWSYTK-QTLRSKDQSLCLQSN  458

Query  398  KLGKPAKLGLF-CTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNN  222
              G    +    C+   S W+ IS S MHL+S   + ++VCLDVD++N ++ N CKCL+ 
Sbjct  459  GPGNRVTMTKRDCSSPGSIWQTISASNMHLASTTSNNTSVCLDVDADNNVLANDCKCLSK  518

Query  221  DSSCDPASQWFKIIDSTR  168
            DSSC+P SQWF I  +TR
Sbjct  519  DSSCEPMSQWFTITKATR  536



>ref|XP_002876948.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53207.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 135/198 (68%), Gaps = 9/198 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++WTL GSYYLREG VG+ E+YG+L  +W   R+ +FLQR+S++QSP +GPG
Sbjct  311  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGILDSDWVRVRSQNFLQRLSLIQSPLQGPG  370

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKA-LTVEGTYFCLQ  405
             ++S+++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT     LT++    CL+
Sbjct  371  -SQSKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPENTLLTLKDKSLCLE  428

Query  404  AEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKC  231
                  P KL    C+  + SKWE IS S M L++K  + S +CLDVD +N +I + CKC
Sbjct  429  TTGPNAPVKLSEASCSSPNLSKWETISASNMLLAAKSTNNS-LCLDVDESNNLIASNCKC  487

Query  230  LN-NDSSCDPASQWFKII  180
            +   DSSCDP SQWFKI+
Sbjct  488  VKGEDSSCDPISQWFKIV  505



>gb|ACF79301.1| unknown [Zea mays]
Length=576

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 127/203 (63%), Gaps = 15/203 (7%)
 Frame = -3

Query  716  AGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHP  537
             GSYYLREG +GL+E YGVL W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP
Sbjct  355  QGSYYLREGVLGLDEVYGVLDWAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHP  414

Query  536  MTGLCVRR----VSLFQP--LELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPA  381
            ++G+CV R     SL QP  L LGPC+E++ W Y+A +           CL+AE  G+PA
Sbjct  415  VSGMCVVRRSPTPSLTQPFQLSLGPCNETEAWEYSAQQQRLALRNAALLCLRAEGAGRPA  474

Query  380  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN------VCLDVDSNN-VIITNTCKCLNN  222
             L + C D  ++W  +SDS++H++      +       +CLDV ++   ++TN C+CL+ 
Sbjct  475  SLAVSCGDAMARWGFVSDSKLHVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSA  534

Query  221  DSSCDPASQWFKIIDSTRGTTTK  153
            D+SCDP  QWFK++ STR   TK
Sbjct  535  DNSCDPQGQWFKLVSSTRSVVTK  557



>ref|XP_010425288.1| PREDICTED: uncharacterized protein LOC104710406 [Camelina sativa]
Length=555

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 135/197 (69%), Gaps = 8/197 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   R+ SFLQR+S++QSP +GPG
Sbjct  358  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRSFLQRLSLIQSPLQGPG  417

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
             ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    L ++    CL++
Sbjct  418  -SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPDNTLKLKEKSLCLES  475

Query  401  EKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
                 P KL  + C+  + SKW+ IS S M L++K  + S +CLDVD +N ++ + CKC+
Sbjct  476  TGSNVPVKLSKMSCSSPNLSKWQSISASNMLLAAKSSNNS-LCLDVDESNNLMASDCKCV  534

Query  227  N-NDSSCDPASQWFKII  180
               D+SCDP SQWFKI+
Sbjct  535  KGEDTSCDPTSQWFKIV  551



>ref|XP_010502524.1| PREDICTED: uncharacterized protein LOC104779826 [Camelina sativa]
Length=534

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 134/197 (68%), Gaps = 8/197 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   R+  FLQR+S++QSP +GPG
Sbjct  337  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRIFLQRLSLIQSPLQGPG  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
             ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    L ++    CL++
Sbjct  397  -SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESRPWSYTPDNTLKLKEKSLCLES  454

Query  401  EKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
                 P KL  + C+  + SKW+ IS S M L++K  + S +CLDVD +N ++ + CKC+
Sbjct  455  TGSNAPVKLSKMSCSSPNLSKWQTISASNMLLAAKSSNNS-LCLDVDESNNLMASDCKCV  513

Query  227  N-NDSSCDPASQWFKII  180
               D+SCDP SQWFKI+
Sbjct  514  KGEDNSCDPTSQWFKIV  530



>gb|EAY86525.1| hypothetical protein OsI_07905 [Oryza sativa Indica Group]
Length=582

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/226 (43%), Positives = 133/226 (59%), Gaps = 29/226 (13%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALW L GSY LR+G  G +E YGVL W+W +PRN + L RI  +Q P RGP
Sbjct  338  VAAELDLDWALWALQGSYALRQGVAGADEVYGVLDWSWSKPRNATALSRIQSLQRPLRGP  397

Query  578  GYTESRLHKLIFHPMTGLCVRR------VSLFQPLELGPCSESDPWGYTA-GKALTVEGT  420
            GY E+R + ++FHP+TG CV R       +    LELG C ++D W YT     L + G 
Sbjct  398  GYDEARPYTVLFHPLTGRCVVRRAADDAAAAAATLELGRCEDTDAWAYTQPASTLAMRGA  457

Query  419  Y-----FCLQAEKLGKPAKLGLF----CTDDS-SKWEIISDSRMHLS---------SKLK  297
                   CL+AE  G+PA+L       C  D+ S W ++S S MH++         S+  
Sbjct  458  GRGSPPLCLRAEGSGRPARLATSDAGGCRGDALSTWRLVSGSTMHVAVNATTTTTPSRDG  517

Query  296  DGSNVCLDV-DSNNVIITNTCKCLNNDSS--CDPASQWFKIIDSTR  168
             G  +CLDV D    ++TN C+CL++ ++  CDP +QWFK++ STR
Sbjct  518  GGGLLCLDVGDDGRSVVTNPCRCLDDAAAGECDPETQWFKLVTSTR  563



>ref|XP_010266913.1| PREDICTED: plastocyanin, chloroplastic-like [Nelumbo nucifera]
Length=290

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -3

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
            G    R + +IFHP TGLCV R SL +PL+LG C+ES+PW Y+  + L ++GTYFC+QA+
Sbjct  117  GRPRGRPYNMIFHPPTGLCVLRKSLTEPLQLGSCAESEPWKYSPQQILFLKGTYFCMQAD  176

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  219
             LGKPAKLG+ CTD  S W++ISD  MHLSS L DG+ VCLDVDSNN I+TN+CK  + D
Sbjct  177  GLGKPAKLGIMCTDPGSNWDVISDGNMHLSSNLVDGTAVCLDVDSNNNIVTNSCKYSSED  236

Query  218  SSCDPASQWFKIIDSTR  168
             + D ASQWF+I+ +++
Sbjct  237  HTPDSASQWFEIVRNSK  253



>ref|XP_002452393.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
 gb|EES05369.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
Length=570

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 125/222 (56%), Gaps = 25/222 (11%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D DWA W L GSY LR+G VG++E YGVL W+W +PRN + L RI  +Q P +GP
Sbjct  339  VAAEHDVDWAYWALQGSYALRQGVVGMDEVYGVLDWSWSKPRNQTVLPRIQALQRPLQGP  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQ---PLELGPCSESDPWGYTA--------GKALT  432
            GY E+  + ++FHP+TGLC  R +       LELGPC+E+D W Y            A  
Sbjct  399  GYGEALPYTVLFHPLTGLCAVRRASAAAATTLELGPCNETDAWAYAPPSSTLVLRDAAAA  458

Query  431  VEGTYFCLQAEKLGKPAKLGL-FCTDDSSKWEIISDSRMHLS------------SKLKDG  291
              G   CL+AE  G+PA+LG   C D  S W + +DS MH++                  
Sbjct  459  AGGLPTCLRAEGRGQPARLGTNACGDPLSTWRLATDSAMHVAVDAAALGLGGGEDGGGGS  518

Query  290  SNVCLDVDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
              +CLDV ++   I+TN C C   D +CDP  QWFK++ STR
Sbjct  519  GMLCLDVGTDGRSIVTNPCACQRGDGACDPEGQWFKLVTSTR  560



>ref|XP_008678768.1| PREDICTED: uncharacterized protein LOC100501654 isoform X2 [Zea 
mays]
 gb|AFW62834.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=548

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 129/217 (59%), Gaps = 20/217 (9%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D DWA W L GSY LR+G  G++E YGVL W+W +PRN + L RI  +Q P +GP
Sbjct  322  VAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQALQRPLQGP  381

Query  578  GYTESRLHKLIFHPMTGLC-VRR-VSLFQPLELGPCSESDPWGYTAGKALTV-----EGT  420
            GY E+  + ++FHP+TGLC VRR  ++   LELGPC+E+D W Y    +  V        
Sbjct  382  GYGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGPCNETDAWAYAPPSSTLVLRDAAAAG  441

Query  419  YFCLQAEKLGKPAKLGLF-CTDDSSKWEIISDSRMHLS-----------SKLKDGSNVCL  276
              CL+AE  G+PA+LG+  C D  S W + +DS MH++                G  +CL
Sbjct  442  LPCLRAEGPGQPARLGIRDCGDPMSTWRLATDSGMHVAVDAALGLGGGEDGGGGGGMLCL  501

Query  275  DVDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
            DV ++   I+TN C C   D +CDP  QWFK++ STR
Sbjct  502  DVGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTSTR  538



>ref|XP_008678767.1| PREDICTED: uncharacterized protein LOC100501654 isoform X1 [Zea 
mays]
Length=564

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 129/217 (59%), Gaps = 20/217 (9%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAE D DWA W L GSY LR+G  G++E YGVL W+W +PRN + L RI  +Q P +GP
Sbjct  338  VAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLDWSWSKPRNETVLPRIQALQRPLQGP  397

Query  578  GYTESRLHKLIFHPMTGLC-VRR-VSLFQPLELGPCSESDPWGYTAGKALTV-----EGT  420
            GY E+  + ++FHP+TGLC VRR  ++   LELGPC+E+D W Y    +  V        
Sbjct  398  GYGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGPCNETDAWAYAPPSSTLVLRDAAAAG  457

Query  419  YFCLQAEKLGKPAKLGLF-CTDDSSKWEIISDSRMHLS-----------SKLKDGSNVCL  276
              CL+AE  G+PA+LG+  C D  S W + +DS MH++                G  +CL
Sbjct  458  LPCLRAEGPGQPARLGIRDCGDPMSTWRLATDSGMHVAVDAALGLGGGEDGGGGGGMLCL  517

Query  275  DVDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
            DV ++   I+TN C C   D +CDP  QWFK++ STR
Sbjct  518  DVGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTSTR  554



>emb|CDY13614.1| BnaA06g33090D [Brassica napus]
Length=460

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 126/202 (62%), Gaps = 6/202 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++W L GSYYLREG VG+ E+YGVL  +W   RN SF+QR+S++QS  +GP 
Sbjct  258  AAENDIDWSIWALQGSYYLREGVVGMTEYYGVLDSDWISVRNNSFMQRLSLIQSTLQGPD  317

Query  575  YTESRLHKLIFHPMTGLCVRRVSL-FQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  +  LIFHP+TGLC+ + SL    + LG C++S PW YT    L ++    CL   
Sbjct  318  -PQPEVSNLIFHPLTGLCMLQSSLDLTKVNLGRCNQSQPWDYTTDNTLKLKNIPLCLANT  376

Query  398  KLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
                P KL    C+  S S+W+ IS S M L++K  + S +CLDVD +N ++   CKC+N
Sbjct  377  GPNAPVKLSEASCSIPSLSQWQPISASNMLLAAKSTNNS-LCLDVDGDNNVVATNCKCVN  435

Query  224  -NDSSCDPASQWFKIIDSTRGT  162
              D+SCDP SQWFKI+   +  
Sbjct  436  GEDTSCDPMSQWFKIVKVNKAN  457



>ref|XP_009152075.1| PREDICTED: uncharacterized protein LOC103875317 [Brassica rapa]
Length=538

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 126/201 (63%), Gaps = 6/201 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++W L GSYYLREG VG+ E+YGVL  +W   RN SF+QR+S++QS  +GP 
Sbjct  336  AAENDIDWSIWALQGSYYLREGVVGMTEYYGVLNSDWISVRNNSFMQRLSLIQSTLQGPD  395

Query  575  YTESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  +  LIFHP+TGLC+ + SL    + LG C++S PW YT    L ++    CL   
Sbjct  396  -PQPEVSNLIFHPLTGLCMLQSSLDPTKVNLGRCNQSQPWDYTTDNTLKLKNIPLCLANT  454

Query  398  KLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
                P KL    C+  S S+W+ IS S M L++K  + S +CLDVD +N ++   CKC+N
Sbjct  455  GPNAPVKLSEASCSTPSLSQWQPISASNMLLAAKSTNNS-LCLDVDGDNNVVATNCKCVN  513

Query  224  -NDSSCDPASQWFKIIDSTRG  165
              DSSCDP SQWFKI+   + 
Sbjct  514  GEDSSCDPMSQWFKIVKVNKA  534



>ref|XP_006378255.1| hypothetical protein POPTR_0010s05970g [Populus trichocarpa]
 gb|ERP56052.1| hypothetical protein POPTR_0010s05970g [Populus trichocarpa]
Length=120

 Score =   164 bits (414),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  506  LFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISD  327
            +  PL LG C+ES+ W YT  K L+V+GTYFCLQ +   KPAKLG+ CTD +SKWE ISD
Sbjct  1    MLAPLRLGRCTESEAWSYTPQKILSVKGTYFCLQTDDAAKPAKLGIICTDSNSKWETISD  60

Query  326  SRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  159
            S+MHLSS    G  VCLD+DSNN I+TNTCKCL+ D++CDP SQWFK+++STR +T
Sbjct  61   SKMHLSSNASSGITVCLDIDSNNTIVTNTCKCLSKDNACDPESQWFKLVNSTRSST  116



>emb|CDX83591.1| BnaC07g23310D [Brassica napus]
Length=460

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 126/202 (62%), Gaps = 6/202 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++W L GSYY+REG VG+ E+YGVL  +W   RN SF+QR+S++QS  +GP 
Sbjct  258  AAENDIDWSIWGLQGSYYIREGVVGMTEYYGVLDSDWISVRNNSFMQRLSLIQSTLQGPD  317

Query  575  YTESRLHKLIFHPMTGLCVRRVSLF-QPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              +  +  LIFHP+TGLC+ + SL    + LG C++S PW YT    L ++    CL   
Sbjct  318  -PQPDVSNLIFHPLTGLCMLQSSLDPTKVNLGRCNQSQPWDYTTENTLKLKNIPLCLANT  376

Query  398  KLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
                P KL    C+  S S+W+ IS S M L++K  + S +CLDVD +N ++   CKC+N
Sbjct  377  GPNAPLKLSETSCSIPSLSQWQPISASNMLLAAKSTNNS-LCLDVDGDNNVVATNCKCVN  435

Query  224  -NDSSCDPASQWFKIIDSTRGT  162
              DSSCDP SQWFKI+   +  
Sbjct  436  GEDSSCDPMSQWFKIVKVNKAN  457



>gb|KEH20758.1| cellulase (glycosyl hydrolase family 5), putative [Medicago truncatula]
Length=154

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = -3

Query  590  FRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFC  411
            F GPG T    HKL+FHP TGLCV R SL +PL+L PCS SD W YT  K L+V+GTYFC
Sbjct  35   FTGPGITVGNPHKLLFHPSTGLCVIRKSLLEPLKLDPCSLSDGWNYTPQKILSVKGTYFC  94

Query  410  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGS-NVCLDVDSNNVIITNTCK  234
            +QA K G PA L + C++ +SKW++ISDS++HLSSK+  GS NVCLDV+ NN+I+TN CK
Sbjct  95   IQAVKEGMPATLSILCSNPNSKWDMISDSKLHLSSKINSGSTNVCLDVNDNNIIVTNACK  154



>gb|KFK25904.1| hypothetical protein AALP_AA8G177600 [Arabis alpina]
Length=523

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 122/198 (62%), Gaps = 14/198 (7%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W LAG YYLR G   + E YGVL  NW + RN SFLQ++S +Q PFRGPG
Sbjct  334  AAENDLDWAVWALAGDYYLRTGDTNMVETYGVLDANWIDVRNTSFLQQLSGIQLPFRGPG  393

Query  575  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                    L+FHP+TGLC+    S   P L LGPC++S+P  Y   K   +     C++A
Sbjct  394  LQS---KNLLFHPLTGLCISNNPSANSPTLRLGPCAKSEPSTYNP-KEGNLWINKMCVEA  449

Query  401  EK-LGKPAKL--GLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCK  234
               +G+  KL  G  C    SK   IS ++MHLS K  +G  +CLDVD  +N I+ N CK
Sbjct  450  PNVVGQKVKLRVGTRC----SKLGQISATKMHLSFKTSNGLLLCLDVDQRDNSIVANPCK  505

Query  233  CLNNDSSCDPASQWFKII  180
            CL  D+SCDPASQWFK++
Sbjct  506  CLTRDASCDPASQWFKVL  523



>gb|KFK43579.1| hypothetical protein AALP_AA1G144700 [Arabis alpina]
Length=646

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 8/180 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW+LW L GSYYLR+G VGL E+YG L  +W   RN SFLQ++ ++QS  +GPG
Sbjct  318  AAENDVDWSLWALTGSYYLRQGVVGLNEYYGALDTDWNSVRNSSFLQKLYLLQSSLQGPG  377

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
                  + L+ HP+TGLC VR ++    L LGPC+ S+PW YT  K L ++    CLQ+ 
Sbjct  378  -PRIDAYNLVLHPLTGLCLVRSLNDKTMLTLGPCNSSEPWSYTK-KTLKIKDQSLCLQSN  435

Query  398  KLGKPAKLGLF---CTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
              G   ++ +    C+   SKWE IS SRMHL+S   + +++CLDVD+ N ++ N CKCL
Sbjct  436  --GPKNRITMTRTSCSRPDSKWETISASRMHLASTTSNKTSLCLDVDATNNVVANACKCL  493



>emb|CDY26627.1| BnaA09g46500D [Brassica napus]
Length=337

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 118/196 (60%), Gaps = 28/196 (14%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA+ D DW+LW L G+YYLR G VGL E+YGVL  +W   RN SFLQ+I ++QS  +GPG
Sbjct  149  AAKNDVDWSLWALTGTYYLRLGVVGLNEYYGVLDSDWISVRNSSFLQKIYLLQSTLQGPG  208

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEK  396
               +  + L+FHP+TGLC+             CS  D    TA   L  +        +K
Sbjct  209  -PRTDAYNLVFHPLTGLCL------------VCSLKD----TAMLTLVTD--------QK  243

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDS  216
            +G P  LG    +  S+W+ IS SRMHL+      +++CLDVD+ N I+ N CKCL+ DS
Sbjct  244  IGLPC-LGRVVRE--SRWQTISASRMHLALTTSKNNSLCLDVDATNNILANPCKCLSKDS  300

Query  215  SCDPASQWFKIIDSTR  168
            SC P SQWFKII++TR
Sbjct  301  SCQPMSQWFKIINATR  316



>emb|CDY38093.1| BnaC02g06800D [Brassica napus]
Length=415

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 112/195 (57%), Gaps = 8/195 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YYLR GT  + E YGVL   W   RN ++LQ++S +Q PFRGPG
Sbjct  226  AAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPG  285

Query  575  YTESRLHKLIFHPMTGLCV--RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
              E    KLI HP TGLCV          L L  C++S+P  +   + +           
Sbjct  286  LQEK---KLILHPHTGLCVTNNHSGNVPTLRLELCTKSEPSTFDPKEGILWINKMCVETP  342

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
            +  G+  KLG+      SK   IS ++MHLS K  +G  +CLDVD  +N I+ N CKCL 
Sbjct  343  DVAGQKVKLGV--GTKCSKLGQISATKMHLSFKTSNGLLLCLDVDERDNSIVANPCKCLT  400

Query  224  NDSSCDPASQWFKII  180
             D+SCDPA+QWFK++
Sbjct  401  KDASCDPANQWFKVL  415



>ref|XP_006395580.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32866.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=534

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 121/201 (60%), Gaps = 7/201 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++W L GSYY+REG  G+ E+YG+L  +    R++ FL R+S++Q+  +GP 
Sbjct  336  AAENDVDWSIWALTGSYYIREGVAGMVEYYGMLDSDGISIRSIGFLLRLSLIQTLLQGP-  394

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
              + +++ L+FHP+TGLC V+  S    + LG C+ S  W YT    L ++    CL+  
Sbjct  395  VPQPKVYNLVFHPLTGLCMVQTSSDPNKVTLGTCNTSPQWSYTLDNTLKIKDKSLCLENT  454

Query  398  KLGKPAKLGLFC--TDDSSKWEIISDS-RMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
               +  KL      + + SKW+ IS S  M L+SK  D S +CLDVD +  I+   CKC+
Sbjct  455  GPNQRVKLSETSCWSPNLSKWQTISGSINMLLASKSSDNS-LCLDVDGHKNIVATNCKCV  513

Query  227  N-NDSSCDPASQWFKIIDSTR  168
               DSSCDP SQWFKI+  +R
Sbjct  514  KGEDSSCDPTSQWFKIVKVSR  534



>emb|CDX89335.1| BnaA01g15580D [Brassica napus]
Length=523

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 112/195 (57%), Gaps = 8/195 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YYLR GT  + E YGVL   W   RN ++LQ++S +Q PFRGPG
Sbjct  334  AAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPG  393

Query  575  YTESRLHKLIFHPMTGLCV--RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
              E    KL+ HP TGLCV          L L  C++S+   +   + +           
Sbjct  394  LQEK---KLVLHPHTGLCVTTNHSGNVPTLRLELCTQSESSTFNPKEGILWVNKMCVETP  450

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
            +  G+  KLG+      SK   IS ++MHLS K  +G  +CLDVD  +N+I+ N CKCL 
Sbjct  451  DVAGQKVKLGV--GSKCSKLGQISATKMHLSFKTSNGLLLCLDVDERDNIIVANPCKCLT  508

Query  224  NDSSCDPASQWFKII  180
             D+SCDPASQWFK++
Sbjct  509  KDASCDPASQWFKVL  523



>ref|XP_009387704.1| PREDICTED: uncharacterized protein LOC103974573 [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -3

Query  584  GPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQ  405
            G  Y   R   +IFHP TG CV R S+  PL LGPC++SD W YT  K L V+GTYFCLQ
Sbjct  41   GQVYASRRPSNVIFHPPTGSCVLRKSVTDPLRLGPCNQSDDWNYTPQKFLVVKGTYFCLQ  100

Query  404  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  225
            +   GKPAKLG+ C++  S W+I S S+  +S +L DG+ +CLDVD  N +ITN C CL 
Sbjct  101  SVDSGKPAKLGIVCSESDSSWDITSKSKAQISKELPDGTALCLDVDPENTLITNPCLCL-  159

Query  224  NDSSCDPASQWFK  186
            +  +CD  SQWF+
Sbjct  160  SIGTCDRESQWFE  172



>ref|XP_002272386.2| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera]
Length=536

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 117/198 (59%), Gaps = 5/198 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             A+ D DWALWTL GSYY REG  G EE Y VL +NW +PR+  +L+R++I+Q   + P 
Sbjct  339  VADKDLDWALWTLQGSYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQQTIQDPN  398

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
                  + L+ HP +G CV  V     +    C E   W ++  G  + + G+  CL+A 
Sbjct  399  SIALSYYVLV-HPESGFCV-NVEGQDNVHGSSCRERSKWSHSGDGSPIQLVGSELCLKAV  456

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  225
              G P  L   C    + W+++SDS +H+++  + G+++CL+  S+N   I+T +C CLN
Sbjct  457  GDGVPVALSTDCKSPWATWKLVSDSMLHIAAMDEQGNSLCLESTSSNYSSILTRSCACLN  516

Query  224  NDSSCDPASQWFKIIDST  171
            N+++CDP SQWF+++ S 
Sbjct  517  NETNCDPQSQWFRLVPSN  534



>ref|XP_010932263.1| PREDICTED: uncharacterized protein LOC105052971 [Elaeis guineensis]
Length=194

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = -3

Query  563  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  384
            R + +IFHP T  CV R SL +PL+LGPC++SD W YT  K L V+GTYFCLQA   GKP
Sbjct  47   RPNNIIFHPSTNSCVLRQSLNEPLKLGPCNQSDGWTYTPQKLLMVKGTYFCLQAVDSGKP  106

Query  383  AKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDP  204
            A+LG+ C+ D S+WE+ S  + HLS+K  DGS +CLDVD  N +ITN C CL+N+  C+ 
Sbjct  107  ARLGIVCSSD-SEWEVTSSGKPHLSTKKADGSFLCLDVDPGNTLITNPCLCLSNE-RCEA  164

Query  203  ASQWFKI  183
             +QWF+I
Sbjct  165  DNQWFEI  171



>emb|CDY38091.1| BnaC02g06820D [Brassica napus]
Length=523

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 111/195 (57%), Gaps = 8/195 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YYLR GT  + E YGVL   W   RN ++LQ++S +Q PFRGPG
Sbjct  334  AAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPG  393

Query  575  YTESRLHKLIFHPMTGLCV--RRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
              E    KLI HP TGLCV          L L  C++S+   +   + +           
Sbjct  394  LQEK---KLILHPHTGLCVTNNHSGNVPTLRLELCTQSESSTFNPKEGILWVNKMCVETP  450

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLN  225
            +  G+  KLG+      SK   IS ++MHLS K  +G  +CLDVD  +N I+ N CKCL 
Sbjct  451  DVAGQKVKLGV--GSKCSKLGPISATKMHLSFKTSNGLLLCLDVDERDNSIVANPCKCLT  508

Query  224  NDSSCDPASQWFKII  180
             D+SCDPASQWFK++
Sbjct  509  KDASCDPASQWFKVL  523



>ref|XP_008807477.1| PREDICTED: uncharacterized protein LOC103719832 [Phoenix dactylifera]
Length=175

 Score =   142 bits (357),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = -3

Query  551  LIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG  372
            +IFHP T  CV R SL +PL+LGPC++SD W YT  K L V GTYFCLQA   GKPA+LG
Sbjct  49   VIFHPSTRSCVLRKSLNEPLKLGPCNQSDAWSYTPQKILMVRGTYFCLQAVDSGKPARLG  108

Query  371  LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQW  192
            + C+ D S+WE+ S ++ HLS+K  DGS +CLDVD  N +ITN C CL+N   C+  +QW
Sbjct  109  VVCSSD-SEWEVTSSAKPHLSTKRADGSLLCLDVDPGNTLITNPCLCLSNQ-RCEADNQW  166

Query  191  FKI  183
            F+I
Sbjct  167  FEI  169



>ref|XP_010437042.1| PREDICTED: uncharacterized protein LOC104720845 isoform X1 [Camelina 
sativa]
 ref|XP_010437060.1| PREDICTED: uncharacterized protein LOC104720858 isoform X1 [Camelina 
sativa]
Length=523

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA+ D DWA+W L G YYLR G   + E +G+L  NW + RN ++LQ++S +Q PF+GPG
Sbjct  334  AAQNDLDWAVWALTGDYYLRTGKTDMVETFGILDANWKDVRNATYLQQLSGIQYPFKGPG  393

Query  575  YTESRLHKLIFHPMTGLCVRR--VSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                     IFHP++GLCV          L LGPC ++D   +   + + +     C++A
Sbjct  394  LQSK---NAIFHPLSGLCVTHNPSDKLPTLRLGPCPKADTSTFNPNEGI-LWINKMCVEA  449

Query  401  EKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
              + G+  KLG+      SK   I+ ++MHL+ K  +G  +CLDVD  +N ++ N CKCL
Sbjct  450  PNVAGQKVKLGV--GTKCSKLGQIAATKMHLAFKTSNGLLLCLDVDERDNSVVANPCKCL  507

Query  227  NNDSSCDPASQWFKII  180
              D+SCDPASQWFK++
Sbjct  508  TKDASCDPASQWFKVL  523



>emb|CBI34407.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 114/198 (58%), Gaps = 5/198 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             AE D DWALWTL  SYY REG  G EE Y VL +NW +PR+  +L+R++I+Q   + P 
Sbjct  280  VAEKDLDWALWTLQASYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQQTIQDPN  339

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
             T +  + LI H  +G CV  V     +    C E   W +   G  + + G   CL+A 
Sbjct  340  ST-TLSYYLIVHTESGFCV-NVEGEDNVHGSSCRERSKWSHGGDGWPIRLVGGELCLKAV  397

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  225
              G P  L   C    + W+++SDSR+H+++  + G+++CL+  S+N   I+T  C C+ 
Sbjct  398  GDGVPVTLSTDCKSPRATWKLVSDSRLHVAAMDEQGNSLCLEATSSNYSSILTRRCACVK  457

Query  224  NDSSCDPASQWFKIIDST  171
            N+++CDP SQWFK++ S 
Sbjct  458  NEANCDPQSQWFKLVPSN  475



>ref|XP_009121460.1| PREDICTED: uncharacterized protein LOC103846306 [Brassica rapa]
Length=524

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P RGPG
Sbjct  335  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVRGPG  394

Query  575  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                   KL+FHP TGLCV   +S   P L L  C +++P  +   + + +     C++A
Sbjct  395  LQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGI-LWSNKMCVEA  450

Query  401  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
             + +G+  KLG       SK    S + MHLS K  +GS +CLDVD  +N I+ N CKCL
Sbjct  451  PDAVGQKVKLG--AGTKCSKLGQTSATHMHLSFKTNNGSLICLDVDELDNSIVANPCKCL  508

Query  227  NNDSSCDPASQWFKII  180
              D+SCDPASQWFK++
Sbjct  509  TMDASCDPASQWFKVL  524



>ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera]
Length=530

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 114/197 (58%), Gaps = 5/197 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             AE D DWALWTL  SYY REG  G EE Y VL +NW +PR+  +L+R++I+Q   + P 
Sbjct  333  VAEKDLDWALWTLQASYYYREGKAGPEEVYSVLDYNWDKPRDPKYLERLTILQQTIQDPN  392

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
             T +  + LI H  +G CV  V     +    C E   W +   G  + + G   CL+A 
Sbjct  393  ST-TLSYYLIVHTESGFCV-NVEGEDNVHGSSCRERSKWSHGGDGWPIRLVGGELCLKAV  450

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  225
              G P  L   C    + W+++SDSR+H+++  + G+++CL+  S+N   I+T  C C+ 
Sbjct  451  GDGVPVTLSTDCKSPRATWKLVSDSRLHVAAMDEQGNSLCLEATSSNYSSILTRRCACVK  510

Query  224  NDSSCDPASQWFKIIDS  174
            N+++CDP SQWFK++ S
Sbjct  511  NEANCDPQSQWFKLVPS  527



>ref|XP_002272534.1| PREDICTED: uncharacterized protein LOC100257079 [Vitis vinifera]
Length=545

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 114/207 (55%), Gaps = 12/207 (6%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
              A+ D DWALWTL GSYY R+G VG EE YGVL +NW +PRN  FL+RI I+Q   + P
Sbjct  338  FVAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLDYNWDKPRNPKFLKRIRILQDILQDP  397

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGP-CSESDPWGYTA-GKALTVEGTYFCLQ  405
                 + H LIFHP +G CV      Q    G  C +   W +   G A+ + G+  CL+
Sbjct  398  NSNVPKYH-LIFHPRSGRCVSVKGEGQDQIHGRNCKKGSRWSHDGNGGAIRLMGSGLCLK  456

Query  404  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKC  231
            A   G PAKL   C+   ++W++IS S++H+++  + G  +CLD  ++N   I+T TC C
Sbjct  457  AVGDGLPAKLSTDCSSPQARWKLISKSKLHIAAMDEQGKPLCLDGKNSNSSSILTRTCIC  516

Query  230  LNNDSS-------CDPASQWFKIIDST  171
               D          +P  QWFK + S 
Sbjct  517  ALQDGDGSDLDCLTNPQRQWFKFVPSN  543



>ref|XP_010492588.1| PREDICTED: uncharacterized protein LOC104769956 isoform X1 [Camelina 
sativa]
Length=523

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA+ D DWA+W L G YYLR G   + E YG+L  NW + RN ++LQ++S +Q PFRGPG
Sbjct  334  AAQNDLDWAVWALTGDYYLRSGKTDMAETYGILNPNWKDVRNATYLQKLSGIQQPFRGPG  393

Query  575  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                +   ++FHP +GLCV    S   P L LGPC ++D   +   + + +     C++ 
Sbjct  394  L---QTKNVLFHPSSGLCVTNNPSDRSPTLRLGPCPKADTSAFNINEGI-LWVNKMCVKI  449

Query  401  EKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
                G+  +LG+    + SK   I+ ++MH S K  +G  +CLDVD  +N ++ N CKCL
Sbjct  450  PSFAGQKVELGV--GTNCSKLGQIAATKMHWSFKTSNGLLLCLDVDERDNSVVVNPCKCL  507

Query  227  NNDSSCDPASQWFKII  180
              D SCDPASQWFK++
Sbjct  508  TKDGSCDPASQWFKVL  523



>emb|CBI34404.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 114/207 (55%), Gaps = 12/207 (6%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
              A+ D DWALWTL GSYY R+G VG EE YGVL +NW +PRN  FL+RI I+Q   + P
Sbjct  354  FVAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLDYNWDKPRNPKFLKRIRILQDILQDP  413

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGP-CSESDPWGYTA-GKALTVEGTYFCLQ  405
                 + H LIFHP +G CV      Q    G  C +   W +   G A+ + G+  CL+
Sbjct  414  NSNVPKYH-LIFHPRSGRCVSVKGEGQDQIHGRNCKKGSRWSHDGNGGAIRLMGSGLCLK  472

Query  404  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKC  231
            A   G PAKL   C+   ++W++IS S++H+++  + G  +CLD  ++N   I+T TC C
Sbjct  473  AVGDGLPAKLSTDCSSPQARWKLISKSKLHIAAMDEQGKPLCLDGKNSNSSSILTRTCIC  532

Query  230  LNNDSS-------CDPASQWFKIIDST  171
               D          +P  QWFK + S 
Sbjct  533  ALQDGDGSDLDCLTNPQRQWFKFVPSN  559



>emb|CDX69429.1| BnaA10g17780D [Brassica napus]
Length=524

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 117/196 (60%), Gaps = 10/196 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P RGPG
Sbjct  335  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVRGPG  394

Query  575  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                   KL+FHP TGLCV   +S   P L L  C +++P  +   + + +     C++A
Sbjct  395  LQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGI-LWSNKMCVEA  450

Query  401  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCL  228
             + +G+  KLG       SK    S + MHLS K  +GS +CLDVD  +N I+ N CKCL
Sbjct  451  PDAVGQKVKLG--AGTKCSKLGQTSATHMHLSFKTNNGSLICLDVDERDNSIVANPCKCL  508

Query  227  NNDSSCDPASQWFKII  180
              D+SCDPA+QWFK++
Sbjct  509  TMDASCDPATQWFKVL  524



>emb|CDY21995.1| BnaC09g01010D [Brassica napus]
Length=178

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = -3

Query  611  ISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-  435
            +S +QSP +GPG  E++  K++FHP TGLC+ R SLFQ L+L  C+  + +  ++   L 
Sbjct  2    LSSIQSPLQGPGLMETQPKKIMFHPATGLCIVRNSLFQ-LKLSSCNGPERFILSSHGVLS  60

Query  434  -TVEGTYFCLQAEKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-  264
             T E  +FCL+  + GK  KL LF ++ +SSKW+++S+S+M LS   KDG +VCLDVDS 
Sbjct  61   RTEEHVFFCLKVYEEGKSVKLRLFSSESNSSKWKVLSESKMQLSLVTKDGESVCLDVDSG  120

Query  263  NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  168
            +  I+T +CKCL  + SCDP SQWFK++ +TR
Sbjct  121  SGNIVTKSCKCLEGNGSCDPTSQWFKLVTNTR  152



>emb|CBI16819.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 77/95 (81%), Gaps = 3/95 (3%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            LAAELDFDWALWTL GSYY REG +GLEEFYG+L WNWCE RN SFLQRIS +QSPF+GP
Sbjct  210  LAAELDFDWALWTLVGSYYTREGVIGLEEFYGLLNWNWCEVRNSSFLQRISALQSPFQGP  269

Query  578  GYTESRLHKLIFHPMTGLCV---RRVSLFQPLELG  483
              +++R HK+IFHP TGLC+   +R+S F+ +  G
Sbjct  270  DLSDARPHKVIFHPATGLCIVWKKRISAFKQMGQG  304



>ref|XP_010514260.1| PREDICTED: uncharacterized protein LOC104790246 [Camelina sativa]
Length=511

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 104/155 (67%), Gaps = 6/155 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++WTL GSYYLREG VG+ E+YGVL  +W   R+ SFLQR+S++QSP +GPG
Sbjct  359  AAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLDSDWDRVRSRSFLQRLSLIQSPLQGPG  418

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQP--LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
             ++ +++ L+FHP+TGLC+ + S+  P  + LG C+ES PW YT    L ++    CL++
Sbjct  419  -SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGLCNESQPWSYTPDNTLRLKDKSLCLES  476

Query  401  EKLGKPAKL-GLFCTDDS-SKWEIISDSRMHLSSK  303
                 P KL  + C+  + SKW+  S S M L++K
Sbjct  477  TGSNAPVKLSNMSCSSPNLSKWQTTSASNMLLAAK  511



>gb|KGN50360.1| hypothetical protein Csa_5G168960 [Cucumis sativus]
Length=343

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 112/198 (57%), Gaps = 8/198 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
             E D DWALW   GSYY R+G VG EE +GVL +NW + RN  F Q   ++Q+  + P  
Sbjct  142  VEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLNYNWSDVRNPHFSQMFQLLQTMLQDPNS  201

Query  572  TESRLHKLIFHPMTGLCVRRVSL-FQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
              S  + +++HP +G CV    +    + L  CS +  W Y   G  + +  T FCL+A 
Sbjct  202  NSSNTY-VMYHPQSGQCVLVQDMKHMQIYLNDCSNASHWSYEGDGTPIMLASTNFCLKAS  260

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN-VCLDVDSNNV--IITNTCKCL  228
              G P  L   C  + S W  ISDS++HL++  K G+N +CL+ +S+N   I+  +C C+
Sbjct  261  GDGLPPSLSRDCFGEQSVWTAISDSKLHLATLTKQGNNGMCLEKESSNSSRILMRSCVCV  320

Query  227  NNDSSC--DPASQWFKII  180
             NDS+C  D  +QWF+++
Sbjct  321  GNDSNCLQDTQAQWFQLV  338



>emb|CDX69431.1| BnaA10g17800D [Brassica napus]
Length=418

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 117/197 (59%), Gaps = 11/197 (6%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P RGPG
Sbjct  228  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVRGPG  287

Query  575  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                   KL+FHP +GLCV   +S   P L L  C +++P  +   +   +     C++A
Sbjct  288  LQSK---KLLFHPTSGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGF-LWSNKLCVEA  343

Query  401  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK-LKDGSNVCLDVDS-NNVIITNTCKC  231
             + +G+  KLG+      SK    S + MHLS K   +GS +CLDVD  +N I+ N CKC
Sbjct  344  PDAVGQKVKLGV--GTKCSKLGQTSATHMHLSFKTTSNGSLLCLDVDERDNSIVANPCKC  401

Query  230  LNNDSSCDPASQWFKII  180
            L  D+SCDPASQWFK++
Sbjct  402  LTMDASCDPASQWFKVL  418



>ref|XP_008467306.1| PREDICTED: uncharacterized protein LOC103504686 [Cucumis melo]
Length=539

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 114/198 (58%), Gaps = 8/198 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
             E D DWALW   GSYY R+G V LEE +GVL +NW + RN  F Q   ++Q+  + P  
Sbjct  338  VEKDLDWALWGWQGSYYYRQGKVELEEVFGVLNYNWSDVRNPRFSQMFQLLQTMLQDPNS  397

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQP-LELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
              S  + L++HP +G CV+   + Q  + L  CS +  W Y   G  + +  T FCL+A 
Sbjct  398  NSSNTY-LMYHPQSGQCVQVHDMKQKEIFLNNCSNASHWSYEGDGTPIMLASTNFCLKAN  456

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN-VCLDVDSNNV--IITNTCKCL  228
              G P  L   C  + S W  ISDS++HL++  K G+N +CL+ +S+N   I+  +C C+
Sbjct  457  GNGLPPSLSRDCFGEQSVWTAISDSKLHLATLTKQGNNGMCLEKESSNSSRILMRSCVCV  516

Query  227  NNDSSC--DPASQWFKII  180
             +DS+C  D  +QWF+++
Sbjct  517  GSDSNCLQDTQAQWFQLV  534



>emb|CDY16991.1| BnaC09g41180D [Brassica napus]
Length=495

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 117/197 (59%), Gaps = 11/197 (6%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWA+W L G YYLR G   + E +GVL  NW +  N ++LQ++S +Q P  GPG
Sbjct  305  AAENDLDWAVWALTGDYYLRTGQKHMVETFGVLAPNWKDVANSTYLQKLSGIQLPVTGPG  364

Query  575  YTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGPCSESDPWGYTAGKALTVEGTYFCLQA  402
                   KL+FHP TGLCV   +S   P L L  C +++P  +   + + +     C++A
Sbjct  365  LQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQCRKAEPSTFNPSEGI-LWSNKMCVEA  420

Query  401  -EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK-LKDGSNVCLDVDS-NNVIITNTCKC  231
             + +G+  KLG+      SK    S + MHLS K   +GS +CLDVD  +N I+ N CKC
Sbjct  421  PDAVGQKVKLGV--GTKCSKLGQTSATHMHLSFKTTSNGSLLCLDVDERDNSIVANPCKC  478

Query  230  LNNDSSCDPASQWFKII  180
            L  D+SCDPASQWFK++
Sbjct  479  LTMDASCDPASQWFKVL  495



>ref|XP_009403630.1| PREDICTED: uncharacterized protein LOC103987145 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 91/136 (67%), Gaps = 5/136 (4%)
 Frame = -3

Query  548  IFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGL  369
            IFHP TGLCV R ++  PL+LGPCS SD W YT  + L V GTYFCL+A  LG P +LG+
Sbjct  47   IFHPPTGLCVTRRTMADPLKLGPCSASDSWRYTPQEFLMVTGTYFCLRAVGLGAPVRLGI  106

Query  368  FCTDDSSKWEIISDS-RMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN--NDSSCDPAS  198
             C    S+W+++S S + HL++KL DG+ VCLDVDS+  +++N+C   +  +D      S
Sbjct  107  ICDPSDSRWQLVSGSEKTHLATKLTDGTEVCLDVDSDGCLVSNSCDGFHGGDDEHLQVDS  166

Query  197  QWFKIIDSTRGTTTKS  150
            QWFK++  T G T +S
Sbjct  167  QWFKLV--TAGFTKQS  180



>ref|XP_004143723.1| PREDICTED: uncharacterized protein LOC101213113 [Cucumis sativus]
Length=539

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 112/198 (57%), Gaps = 8/198 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
             E D DWALW   GSYY R+G VG EE +GVL +NW + RN  F Q   ++Q+  + P  
Sbjct  338  VEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLNYNWSDVRNPHFSQMFQLLQTMLQDPNS  397

Query  572  TESRLHKLIFHPMTGLCVRRVSL-FQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
              S  + +++HP +G CV    +    + L  CS +  W Y   G  + +  T FCL+A 
Sbjct  398  NSSNTY-VMYHPQSGQCVLVQDMKHMQIYLNDCSNASHWSYEGDGTPIMLASTNFCLKAS  456

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSN-VCLDVDSNNV--IITNTCKCL  228
              G P  L   C  + S W  ISDS++HL++  K G+N +CL+ +S+N   I+  +C C+
Sbjct  457  GDGLPPSLSRDCFGEQSVWTAISDSKLHLATLTKQGNNGMCLEKESSNSSRILMRSCVCV  516

Query  227  NNDSSC--DPASQWFKII  180
             NDS+C  D  +QWF+++
Sbjct  517  GNDSNCLQDTQAQWFQLV  534



>ref|XP_003608279.1| Endoglucanase [Medicago truncatula]
 gb|ABD32354.1| Glycoside hydrolase, family 5; Ricin B-related lectin [Medicago 
truncatula]
 gb|AES90476.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=536

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 112/200 (56%), Gaps = 6/200 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA +D DW+LW+  GSYY REG+VG  E Y V+ ++W   R+  F Q+  ++Q   + P 
Sbjct  336  AASVDLDWSLWSFGGSYYFREGSVGAGETYAVMDYDWKNYRDPKFPQKFQLLQKKIQDPT  395

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
               S+ H ++FHP+TG C         L LG C     W +   G  + +  +  CL+AE
Sbjct  396  SNLSKSH-IMFHPLTGKCAHANGSNNELVLGDCKSHSEWSFEGDGSPIRLMDSAMCLKAE  454

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCLN-  225
              G PA L   C    S W+ +S + +HL++   +G   CL+++S++  I+T  C C++ 
Sbjct  455  GEGLPATLSEHCLSPQSSWKSVSKTGLHLATSHGNGPLFCLEMESDSSKIVTRKCICIDE  514

Query  224  NDSSC--DPASQWFKIIDST  171
            NDSSC  +P SQWF++I + 
Sbjct  515  NDSSCLDNPQSQWFQLISTN  534



>ref|XP_010053198.1| PREDICTED: uncharacterized protein LOC104441706 [Eucalyptus grandis]
 gb|KCW77462.1| hypothetical protein EUGRSUZ_D01800 [Eucalyptus grandis]
Length=538

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 114/197 (58%), Gaps = 7/197 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA  D DWALW L GSYY R+G VG EE +GVL +NW   RN  F +R  ++Q+  + P 
Sbjct  340  AAGKDLDWALWALQGSYYYRQGVVGPEETFGVLDFNWDGLRNPKFKERFQLVQTMVQDPS  399

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPW-GYTAGKALTVEGTYFCLQAE  399
             + S +  +++HP +GLC+R  +  + +    C     W  Y  G  + + GT  CL+A 
Sbjct  400  -SNSPMSYIMYHPQSGLCIRANNNHE-IGTAECQHWSRWIHYRDGSPIRLMGTPLCLKAL  457

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN--NVIITNTCKCLN  225
              G P  L   C++  S W  IS+S++H+++  + G+ +CL+  SN  +VI+T  C C++
Sbjct  458  GDGLPPVLSNDCSNRRSAWRSISNSKLHVAATDEHGNRLCLEKKSNESSVILTRKCICVD  517

Query  224  NDSSC--DPASQWFKII  180
            +DS C  +P  QWFK +
Sbjct  518  DDSGCTENPQGQWFKFV  534



>ref|XP_008445780.1| PREDICTED: uncharacterized protein LOC103488703 [Cucumis melo]
Length=448

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 114/199 (57%), Gaps = 6/199 (3%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P  
Sbjct  249  AQKDLDWALWTWQGSYYYREGQAELPETFGVLESNWTQIKNPNFVQKFQLLQTMLQDPN-  307

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  396
            + +    +I+HP +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  308  SNASFSYVIYHPQSGQCIEVSNDNKDIFLTNCSTSSRWSHDNDSTPIKMSNTGLCLKASG  367

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNN  222
             G  A L   C    S W  IS+S++HL++  ++G ++CL ++S+N   I+TN+C C  +
Sbjct  368  EGLAASLSNDCLGKQSVWSAISNSKLHLATVTENGKSLCLQIESSNSSKIVTNSCICTTD  427

Query  221  DSSC--DPASQWFKIIDST  171
            D +C  D  SQWF+++++ 
Sbjct  428  DPTCLQDTQSQWFELVETN  446



>ref|XP_006439449.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
 gb|ESR52689.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
Length=538

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 109/202 (54%), Gaps = 14/202 (7%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWALW L GSYYLR G  G EE +G L   W  PRN +FL+R+  +Q+    P 
Sbjct  333  AAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQRPRNPNFLERLRFLQTKTHVPT  392

Query  575  YTESRLHKLIFHPMTGLCVR---RVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCL  408
             + +R   +IFHP++G CV    R  L+     GP S    W Y   G  + +     CL
Sbjct  393  TSRTRTSYIIFHPLSGNCVNANARNELYAS-NRGPFSR---WSYGGDGTPIRLMDRSLCL  448

Query  407  QAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD--GSNVCLDVDSNNV--IITNT  240
            +    G P  L   C  + S W ++S S++HL++K  +  G  +CL V   N   ++T  
Sbjct  449  KVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQVSPTNSSQVVTTK  508

Query  239  CKCLNNDSSC--DPASQWFKII  180
            C C+ +DSSC  +P SQWFK++
Sbjct  509  CICVGDDSSCLQNPQSQWFKLV  530



>ref|XP_004151386.1| PREDICTED: uncharacterized protein LOC101207450 [Cucumis sativus]
Length=364

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (56%), Gaps = 7/197 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P Y
Sbjct  163  AQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTMLQDP-Y  221

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  396
            + +    +I+H  +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  222  SNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLCLKASG  281

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD-VDSNNV--IITNTCKCLN  225
             G  A L   C    S W  IS+S +HL +  +DG ++CL  ++S+N   I+TN+C C  
Sbjct  282  EGLEASLSTDCIGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTNSCICTT  341

Query  224  NDSSC--DPASQWFKII  180
            ND +C  D  SQWF+++
Sbjct  342  NDPTCLQDTQSQWFELV  358



>gb|KGN45940.1| hypothetical protein Csa_6G028440 [Cucumis sativus]
Length=539

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 110/197 (56%), Gaps = 7/197 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P Y
Sbjct  338  AQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTMLQDP-Y  396

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  396
            + +    +I+H  +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  397  SNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLCLKASG  456

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD-VDSNNV--IITNTCKCLN  225
             G  A L   C    S W  IS+S +HL +  +DG ++CL  ++S+N   I+TN+C C  
Sbjct  457  EGLEASLSTDCIGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTNSCICTT  516

Query  224  NDSSC--DPASQWFKII  180
            ND +C  D  SQWF+++
Sbjct  517  NDPTCLQDTQSQWFELV  533



>ref|XP_011080895.1| PREDICTED: uncharacterized protein LOC105164045 [Sesamum indicum]
Length=535

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 111/201 (55%), Gaps = 11/201 (5%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            + AE D DWALWT  GSY LREGTV LEE YGV   NW  PRN +FL R+ +++   + P
Sbjct  334  VVAETDIDWALWTFQGSYMLREGTVNLEEVYGVNDLNWDRPRNPAFLDRLQLIRQLNQEP  393

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWG-YTAGKALTVEGTYFCLQA  402
              T    + ++FHP +G CVR       + L  C  +  W  +  G  + V G+  CL  
Sbjct  394  -KTNRPTYYIMFHPQSGQCVRIGK--TNIVLANCKTASHWDQHQDGGTIKVAGSPQCLGV  450

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD-SNNVIITNTCKCLN  225
               GK A +   C+ + SKW+ +S S +HL ++  +G  +CL+   SN+ ++T  C C+ 
Sbjct  451  AGDGKVAGVSDDCSSNGSKWKHVSSSGLHLGAQDGEGKYLCLERSASNSTLVTKKCLCVG  510

Query  224  ND----SSCD--PASQWFKII  180
            ++     +CD  P  QWFK++
Sbjct  511  DNLVDFPTCDDNPEVQWFKLV  531



>ref|XP_006584934.1| PREDICTED: uncharacterized protein LOC100811735 [Glycine max]
Length=337

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 111/196 (57%), Gaps = 7/196 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A +D DW+LW   GSYY R+G VGL E Y V+  +W   R+ +F Q+  ++Q   + P  
Sbjct  140  ASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMDDDWKSYRDPNFTQKFELLQRMVQDPTS  199

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  396
              S+   +IFHP+TG C   V+  + L +G C  +  W Y   G  + +  +  CL+A  
Sbjct  200  NVSK-SNIIFHPLTGYCA-HVNNSKELVMGDCKSNSLWSYEGDGSPIRLMNSAKCLKAVG  257

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCL-NN  222
               P  L   C    S W+ +S + +HL++  KDG  +CL+ DSN+  I+T+ C C+ ++
Sbjct  258  ERLPPSLSEDCLSPQSSWKTVSMTGLHLATFDKDGDLLCLEKDSNSSKIVTSKCICISDD  317

Query  221  DSSC--DPASQWFKII  180
            DSSC  +P SQWFK++
Sbjct  318  DSSCLDNPQSQWFKLV  333



>ref|XP_004170746.1| PREDICTED: endoglucanase E1-like [Cucumis sativus]
Length=539

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 109/197 (55%), Gaps = 7/197 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALWT  GSYY REG   L E +GVL  NW + +N +F+Q+  ++Q+  + P  
Sbjct  338  AQKDLDWALWTWQGSYYYREGQAELAETFGVLDSNWTQIKNPNFVQKFQLLQTMLQDPN-  396

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY-TAGKALTVEGTYFCLQAEK  396
            + +    +I+H  +G C+   +  + + L  CS S  W +      + +  T  CL+A  
Sbjct  397  SNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCSTSSRWSHDNDSTPIKMSSTGLCLKASG  456

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD-VDSNNV--IITNTCKCLN  225
             G  A L   C    S W  IS+S +HL +  +DG ++CL  ++S+N   I+TN+C C  
Sbjct  457  EGLEASLSTDCVGKQSLWSAISNSNLHLGTVTEDGKSLCLQIIESSNSSKIVTNSCICTA  516

Query  224  NDSSC--DPASQWFKII  180
            ND +C  D  SQWF+++
Sbjct  517  NDPTCLQDTQSQWFELV  533



>gb|ABR17494.1| unknown [Picea sitchensis]
Length=543

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/206 (38%), Positives = 113/206 (55%), Gaps = 11/206 (5%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
             AAE DFDWALWTL GSYYLR G  G EE YG+    W + R+  F+ R+  +Q PF+  
Sbjct  335  FAAEGDFDWALWTLQGSYYLRNGQPGFEETYGIFNGRWDDLRDPPFVSRLKSLQKPFQES  394

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA--GKALTVEGTYFCLQ  405
              +   L+K ++HP TGLC+   S    L+L  C     + Y +  G     + +  C+ 
Sbjct  395  FSSSEPLYKTLYHPATGLCL-ATSGEGGLKLDSCDSPTLFEYKSPQGAFTLSDESSTCIA  453

Query  404  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK-DGSN--VCLDVDSNNVIITNTCK  234
            A+  G  A+L   C   +SKW+ +S S + +S  L  +G++  +CLD  S+  ++TN C 
Sbjct  454  AKGPGLAAELSTQCAASNSKWQRVSSSNLQVSVTLSVNGTSQMLCLDGKSSPQVLTNDCI  513

Query  233  CLNNDSSC----DPASQWFKIIDSTR  168
            CL  DS C    +P  QWFK+I + R
Sbjct  514  CL-KDSDCRKDENPEMQWFKLITTNR  538



>ref|XP_002272454.2| PREDICTED: uncharacterized protein LOC100267356 isoform X1 [Vitis 
vinifera]
Length=575

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 111/202 (55%), Gaps = 9/202 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             AE D DWALWTL  SY+ R+G  G  E Y VL ++W +PR   FL+R+ I+Q+  + P 
Sbjct  374  VAEKDLDWALWTLQASYHYRQGHAGGGESYSVLDYSWSKPRYPQFLERMVILQNLLQDPN  433

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPC---SESDPWGYTAGKA-LTVEGTYFCL  408
               S  + L+ H  +G CV  V     + +  C   S +  W +   ++ +   G   CL
Sbjct  434  SNVSPYY-LLVHAQSGFCV-NVKHNDVVSVSSCRKNSRNSRWNHEGDRSPIKKLGRKHCL  491

Query  407  QAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDV--DSNNV-IITNTC  237
            +A   G P  L   C+   + W+++SDS + +++  + G+ +CLD    SN+  I+T  C
Sbjct  492  KAVGDGVPLTLSDDCSSPRATWQLVSDSMLQIAAMDEQGNPLCLDATPSSNSTPILTRAC  551

Query  236  KCLNNDSSCDPASQWFKIIDST  171
             CLNN++ CDP SQWFK++ S 
Sbjct  552  ACLNNEAGCDPLSQWFKLVPSN  573



>ref|XP_007159232.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
 gb|ESW31226.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
Length=529

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 108/194 (56%), Gaps = 8/194 (4%)
 Frame = -3

Query  746  LDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTE  567
            +D +W+LW   GSYYLR+G VG  E YGV+ + W   R+ +F Q+  ++Q   + P    
Sbjct  335  VDLEWSLWAFQGSYYLRQGNVGPGESYGVMDFEWENYRDPNFTQKFQLLQRIIQDPNSKA  394

Query  566  SRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEKLG  390
            S+ H +IFHP TG C       + L +G C  +  W +   G  + +  +  CL+A   G
Sbjct  395  SKSH-IIFHPSTGYCAHVND--KELVMGDCKSNSLWSFEGDGSPIRLMNSAMCLKAVGEG  451

Query  389  KPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCL-NNDS  216
             P  L   C    S W+ +S S +HL+S  K+G  +CL+ DSN+  ++T  C C+ N+DS
Sbjct  452  LPPTLSEDCLSAQSSWKAVSMSGLHLASFDKNGDLLCLEKDSNSTKLVTRKCICIENDDS  511

Query  215  SC--DPASQWFKII  180
            SC   P +QWF+++
Sbjct  512  SCLDSPLNQWFRLV  525



>gb|KHN45741.1| Endoglucanase [Glycine soja]
Length=531

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 112/199 (56%), Gaps = 7/199 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A +D DW+LW   GSYY R+G VGL E Y V+  +W   R+ +F Q+  ++Q   + P  
Sbjct  334  ASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMDDDWKSYRDPNFTQKFELLQRMVQDPTS  393

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  396
              S+   +IFHP+TG C   V+  + L +G C  +  W Y   G  + +  +  CL+A  
Sbjct  394  NVSK-SNIIFHPLTGYCA-HVNNSKELVMGDCKSNSLWSYEGDGSPIRLMNSAKCLKAVG  451

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV-IITNTCKCL-NN  222
               P  L   C    S W+ +S + +HL++  KDG  +CL+ DSN+  I+T+ C C+ ++
Sbjct  452  ERLPPSLSEDCLSPQSSWKTVSMTGLHLATFDKDGDLLCLEKDSNSSKIVTSKCICISDD  511

Query  221  DSSC--DPASQWFKIIDST  171
            DSSC  +P SQWFK++ + 
Sbjct  512  DSSCLDNPQSQWFKLVSTN  530



>ref|XP_006395579.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32865.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=507

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 104/201 (52%), Gaps = 34/201 (17%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW++W L GSYY+REG  G+ E+YG                       P   P 
Sbjct  336  AAENDVDWSIWALTGSYYIREGVAGMVEYYG-----------------------PVPQP-  371

Query  575  YTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  399
                +++ L+FHP+TGLC V+  S    + LG C+ S  W YT    L ++    CL+  
Sbjct  372  ----KVYNLVFHPLTGLCMVQTSSDPNKVTLGTCNTSPQWSYTLDNTLKIKDKSLCLENT  427

Query  398  KLGKPAKLGLFC--TDDSSKWEIISDS-RMHLSSKLKDGSNVCLDVDSNNVIITNTCKCL  228
               +  KL      + + SKW+ IS S  M L+SK  D S +CLDVD +  I+   CKC+
Sbjct  428  GPNQRVKLSETSCWSPNLSKWQTISGSINMLLASKSSDNS-LCLDVDGHKNIVATNCKCV  486

Query  227  N-NDSSCDPASQWFKIIDSTR  168
               DSSCDP SQWFKI+  +R
Sbjct  487  KGEDSSCDPTSQWFKIVKVSR  507



>emb|CDX94332.1| BnaC01g18520D [Brassica napus]
Length=165

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 99/171 (58%), Gaps = 10/171 (6%)
 Frame = -3

Query  680  LEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV--RRVS  507
            + E YGVL   W   RN ++LQ++S +Q PFRGPG  E    KL+ HP TGLCV      
Sbjct  1    MVETYGVLDATWKNVRNSTYLQKLSGIQHPFRGPGLQEK---KLLLHPHTGLCVTNNHSG  57

Query  506  LFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKL-GKPAKLGLFCTDDSSKWEIIS  330
                L L  C++S+P  +   + + +     C++   + G+  KLG+      SK   IS
Sbjct  58   NVPTLRLELCTKSEPSTFNPKEGI-LWINKMCVETPNVAGQKVKLGV--GTKCSKLGQIS  114

Query  329  DSRMHLSSKLKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  180
             ++MHLS K  +G  +CLDVD  +N I+ N CKCL  D+SCDPASQWFK++
Sbjct  115  ATKMHLSFKTSNGLLLCLDVDERDNSIVANPCKCLTKDASCDPASQWFKVL  165



>ref|XP_004151560.1| PREDICTED: uncharacterized protein LOC101211788 [Cucumis sativus]
Length=341

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 108/199 (54%), Gaps = 6/199 (3%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALW   GSYY REG     E +GVL  NW + +N +F+Q+  ++Q+    P  
Sbjct  142  AQRDLDWALWAWQGSYYFREGQAEPGESFGVLDSNWTQIKNPNFVQKFQLLQTMLHDPN-  200

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  396
            + +    +I+HP +  C++  +  + + L  CS    W +   G  + +  T   L+A  
Sbjct  201  SNASFSYVIYHPQSSQCIQVSNDNKEIFLTNCSTPTRWSHNNDGTPIEMSSTGLYLKASG  260

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNN  222
             G  A L        S W  IS+S++HL++  + G ++CL +DS+N   ++TN+C C N 
Sbjct  261  EGLEASLSTDTLSQQSVWSAISNSKLHLATFTQGGKSLCLQMDSSNSSKVVTNSCICTNG  320

Query  221  DSSC--DPASQWFKIIDST  171
            D +C  D  SQWF+++++ 
Sbjct  321  DPNCLQDTRSQWFELVETN  339



>ref|XP_006378254.1| hypothetical protein POPTR_0010s059501g, partial [Populus trichocarpa]
 gb|ERP56051.1| hypothetical protein POPTR_0010s059501g, partial [Populus trichocarpa]
Length=97

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -3

Query  380  KLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPA  201
            KLG+ CTD +SKWE ISDS+MH SS   +G  VCLDVDSNN I+TNTCKCL+ D++CDP 
Sbjct  1    KLGIICTDSNSKWETISDSKMHFSSTAANGIAVCLDVDSNNTIVTNTCKCLSKDNACDPE  60

Query  200  SQWFKIIDSTRGTT-TKSDFQSTSFLYFLAKKLFASY  93
            SQWFK+++STR +T TK   +  S L F AK    S+
Sbjct  61   SQWFKLVNSTRSSTMTKPLSRMNSILNFPAKDFHGSF  97



>ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus]
Length=535

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 106/195 (54%), Gaps = 7/195 (4%)
 Frame = -3

Query  743  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  564
            DFDW LW L GSYY REG    EE +GVL   +   +N  FLQ+  +MQ+  + P  +  
Sbjct  340  DFDWGLWALQGSYYYREGVKNDEETFGVLDSKFTNVKNPKFLQKFQLMQTKLQDPS-SNL  398

Query  563  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAEKLGK  387
                +++HP++G CVR    +Q L +  C  S+ W +      + + G+  CLQA   G 
Sbjct  399  TTSFIMYHPLSGECVRMNKKYQ-LGVSSCKTSNRWSHEQDDTPIKLAGSILCLQAVGDGL  457

Query  386  PAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNNDSSC  210
            P  L   C+   S W+  S++++ L++  ++G  +CL   S+ + I+TN C C  NDS C
Sbjct  458  PPILSKDCSSQQSAWKYASNAKLQLATVDEEGQALCLQRASHSHQILTNKCMC-PNDSEC  516

Query  209  --DPASQWFKIIDST  171
              DP SQWF ++ S 
Sbjct  517  QGDPQSQWFTLVPSN  531



>ref|XP_002272491.1| PREDICTED: uncharacterized protein LOC100262188 [Vitis vinifera]
Length=541

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 111/202 (55%), Gaps = 9/202 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             A  D DWALWTL  SYY R+G++ LEE Y VL +NW +PRN  FL++++I+Q   + P 
Sbjct  340  VAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLDFNWEKPRNPQFLEKLTILQEMLQDPN  399

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
             +E+  + +I H  +GLCV  V   + +    C     W ++  G  + + G+  CL+A 
Sbjct  400  -SEASPYYVIVHAKSGLCV-NVDGEKKVHGSGCRHRTKWTHSGDGWPIELMGSNLCLKAV  457

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG--SNVCLDVDSNN--VIITNTCKC  231
              G+P K+   C    S+W  +S  ++HL+ + +     ++CLD  S++   I+T  C C
Sbjct  458  GDGRPVKVSTDCRSQQSRWRRVSKEKLHLAVRDEHDHTESLCLDASSSDPSSIVTRKCAC  517

Query  230  LNNDSSC--DPASQWFKIIDST  171
               D +C  +  S WF+++ S 
Sbjct  518  KEGDLNCHHEEQSNWFQLVPSN  539



>gb|KEH18775.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=538

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 108/192 (56%), Gaps = 7/192 (4%)
 Frame = -3

Query  743  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  564
            D DW LW   G YY+RE  V L+E +GV+   W + R  +F  +  ++Q   + P    S
Sbjct  346  DLDWGLWAFHGGYYVREDKVQLDETFGVVDATWHKLRYPNFTDKFQLLQRKNQDPTSKRS  405

Query  563  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  384
            + + +++HP+TG CV +V+    LE+G C     W Y  G  + ++ +  CL A   G P
Sbjct  406  KAY-IMYHPLTGKCV-QVNENNKLEIGSCENQKRWTY-KGSQIFLKESQKCLTASGEGLP  462

Query  383  AKLGLFCTDDSSKWEIISDSRMHLSSKLKDG-SNVCLDVDSN-NVIITNTCKCLNNDSSC  210
              +   C   +S W+  S S++HL++  +DG   +CL  D+N + ++T+ C C+++DS C
Sbjct  463  VSVSDDCESKNSSWKTASPSKLHLATVNQDGKQQLCLQKDTNSSAVVTSKCICIHDDSLC  522

Query  209  --DPASQWFKII  180
              DP SQWF+++
Sbjct  523  LDDPQSQWFQLV  534



>ref|XP_004510834.1| PREDICTED: uncharacterized protein LOC101496378 [Cicer arietinum]
Length=540

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/195 (38%), Positives = 111/195 (57%), Gaps = 12/195 (6%)
 Frame = -3

Query  743  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  564
            D DW LW   GSYY+RE  V L+E +GVL   W   R  +F  +  ++Q   + P    S
Sbjct  347  DLDWGLWAFHGSYYVREDKVQLDESFGVLDATWHNLRYPNFTDKFQLLQRMNQDP---TS  403

Query  563  RLHK--LIFHPMTGLCVRRVSLFQPLELGPCSES-DPWGYTAGKALTVEGTYFCLQAEKL  393
            +L K  +++HP+TG C  +V+    LE+G C E+ + W Y  G  +   GT  CL A   
Sbjct  404  KLPKAYIMYHPLTGKCA-QVNEKNELEIGSCGENKNRWIYD-GSQILWNGTKKCLTASGE  461

Query  392  GKPAKLGLFCTDDSSKWEIISDSRMHLS-SKLKDGSNVCLDVDSN-NVIITNTCKCLNND  219
              P  +   C   +S W+ +S SR+HL+ S  ++G  +CL  DSN +V++T+ C C+N+D
Sbjct  462  DLPVSVSDDCKSKNSSWKPVSLSRLHLATSHDQNGKQLCLHKDSNSSVVVTSKCICINDD  521

Query  218  SSC--DPASQWFKII  180
            S C  DP SQWF+++
Sbjct  522  SLCLDDPQSQWFQLV  536



>gb|KGN57440.1| hypothetical protein Csa_3G186670 [Cucumis sativus]
Length=348

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 107/196 (55%), Gaps = 6/196 (3%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALW   GSYY REG     E +GVL  NW + +N +F+++  ++Q+  + P  
Sbjct  149  AQRDLDWALWAWQGSYYFREGQAEPGESFGVLDSNWTQIKNPNFVRKFQLLQTMLQDPN-  207

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  396
            + +    +I+HP +  C++  +  + + L  CS    W +   G  + +  T   L+A  
Sbjct  208  SNASFSYVIYHPQSSQCIQVSNDNKEIFLTNCSTPTRWSHNNDGTPIEMSSTGLYLKASG  267

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNN  222
             G  A L        S W  IS+S++HL++  + G ++CL +DS+N   ++TN+C C N 
Sbjct  268  KGLEASLSSDTLSQQSVWSAISNSKLHLATFTQGGKSLCLQIDSSNSSKVVTNSCICTNG  327

Query  221  DSSC--DPASQWFKII  180
            D +C  D  SQWF+++
Sbjct  328  DPNCLQDTRSQWFELV  343



>ref|XP_008810943.1| PREDICTED: uncharacterized protein LOC103722247 [Phoenix dactylifera]
Length=554

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 106/208 (51%), Gaps = 14/208 (7%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWALW L GSYYLR G  G  E YGVL  NW  P+N  F ++  ++Q   +   
Sbjct  346  AAERDLDWALWALQGSYYLRNGIPGFNETYGVLDANWDRPKNPRFREKFRLIQDTLQDKY  405

Query  575  YT-----ESRL----HKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGK-ALTVE  426
             T     + RL    +++I+HP +G CV  V     + L  C +   W Y   + A+ + 
Sbjct  406  PTKYSNPDPRLSVAAYQIIYHPHSGQCV-SVDDSSNVVLSDCKKRKRWSYNGNRTAVWLM  464

Query  425  GTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVI  252
            G+  CL+ E  G P  L   C D+ S W  +S S   +S     G ++CL+ +S  +N I
Sbjct  465  GSAQCLRVEGEGLPVLLSAECDDNRSVWGPVSSSWFQISGMDAQGRHLCLERNSSNSNSI  524

Query  251  ITNTCKCLNN-DSSCDPASQWFKIIDST  171
             T  C CL+N   S +P +QWF  I S 
Sbjct  525  FTKKCLCLDNLGCSKNPQTQWFHFIPSN  552



>emb|CBI34405.3| unnamed protein product [Vitis vinifera]
Length=970

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 111/202 (55%), Gaps = 9/202 (4%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             A  D DWALWTL  SYY R+G++ LEE Y VL +NW +PRN  FL++++I+Q   + P 
Sbjct  769  VAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLDFNWEKPRNPQFLEKLTILQEMLQDPN  828

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
             +E+  + +I H  +GLCV  V   + +    C     W ++  G  + + G+  CL+A 
Sbjct  829  -SEASPYYVIVHAKSGLCV-NVDGEKKVHGSGCRHRTKWTHSGDGWPIELMGSNLCLKAV  886

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG--SNVCLDVDSNN--VIITNTCKC  231
              G+P K+   C    S+W  +S  ++HL+ + +     ++CLD  S++   I+T  C C
Sbjct  887  GDGRPVKVSTDCRSQQSRWRRVSKEKLHLAVRDEHDHTESLCLDASSSDPSSIVTRKCAC  946

Query  230  LNNDSSC--DPASQWFKIIDST  171
               D +C  +  S WF+++ S 
Sbjct  947  KEGDLNCHHEEQSNWFQLVPSN  968


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             AE D DWALWTL  SY+ R+G  G  E Y VL ++W +PR   FL+R+ I+Q+  +  G
Sbjct  336  VAEKDLDWALWTLQASYHYRQGHAGGGESYSVLDYSWSKPRYPQFLERMVILQNLLQESG  395

Query  575  YTESRLHKLIFH  540
              + ++    FH
Sbjct  396  GKKKKIFN--FH  405



>gb|KGN50395.1| hypothetical protein Csa_5G171770 [Cucumis sativus]
Length=538

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 110/201 (55%), Gaps = 13/201 (6%)
 Frame = -3

Query  749  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGP--  579
            E DFDW LW L GSYY REG    EE +GVL   + + +N   FLQR  +MQ+  + P  
Sbjct  339  ENDFDWGLWALQGSYYYREGVKNAEENFGVLDSTFAKAKNSKLFLQRFQLMQTKLQDPSS  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQA  402
             +T S    +++HP++G CVR    +Q L +  C  S+ W +    + + + G+  CL+A
Sbjct  399  NFTTSL---IMYHPLSGGCVRMNKKYQ-LGISSCKTSNRWIHEQDSSPIKLAGSVLCLKA  454

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD--VDSNNVIITNTCKCL  228
              +G P  L   C+   S W+  S +++ L++  + G  +CL      ++ I+TN C C 
Sbjct  455  IGVGLPPILSQDCSSQQSIWKYGSSAKLQLATVDEQGQALCLQRAASHSHQIVTNKCLC-  513

Query  227  NNDSSC--DPASQWFKIIDST  171
            +NDS C  DP SQWF ++ S 
Sbjct  514  SNDSQCQEDPQSQWFTLVPSN  534



>ref|XP_008467257.1| PREDICTED: uncharacterized protein LOC103504654 [Cucumis melo]
Length=539

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 107/198 (54%), Gaps = 8/198 (4%)
 Frame = -3

Query  749  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGPGY  573
            E DFDW LW L GSYY + G    EE +GVL  N+ + +N   FLQR  +MQ+  + P  
Sbjct  340  ENDFDWGLWALQGSYYYKVGVKNAEENFGVLDSNFTKAKNSKLFLQRFQLMQTKLQDPSS  399

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  396
              +    +++HP++G CVR    +Q L +  C  S+ W +   G  + + G+  CL+A  
Sbjct  400  NFTTTF-IMYHPLSGGCVRMNKKYQ-LGISSCKTSNRWSHEQDGAPIKLAGSILCLKAIG  457

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNND  219
            +G P  L   C+   S W   S++++ L++  + G  +CL   S+ + I+TN C C   D
Sbjct  458  VGLPPILSQDCSSQQSIWRYASNAKLQLATVDEQGQALCLQRASHSHQIVTNKCLC-TID  516

Query  218  SSC--DPASQWFKIIDST  171
            S C  DP SQWF ++ S 
Sbjct  517  SQCQEDPQSQWFTLVPSN  534



>ref|XP_010916958.1| PREDICTED: uncharacterized protein LOC105041671 [Elaeis guineensis]
Length=485

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 105/199 (53%), Gaps = 6/199 (3%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DWALW L GSYY+R+G  G +E YGVL  NW + +N  F ++  ++Q   + P 
Sbjct  287  AAERDLDWALWALQGSYYMRDGIPGSKETYGVLDSNWDQAKNPRFQEKFRLIQEMLQEP-  345

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGK-ALTVEGTYFCLQAE  399
             + +  +++I+HP +G CV  V     + L  C     W Y   + A+ + G+  CL+ E
Sbjct  346  RSSTATNQIIYHPHSGQCV-SVDDDNNVVLSDCKNRKWWSYDGNRTAIWLAGSTHCLRVE  404

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKCLN  225
              G    L   C D+ S W  +S S   +S     G N+CL+ +S+N   I T  C C +
Sbjct  405  GEGLSVLLSAECNDNQSFWGPVSSSWFQISGMDAQGRNLCLERNSSNSDSIWTKECLCSD  464

Query  224  N-DSSCDPASQWFKIIDST  171
            N   S +P +QWF+ I S 
Sbjct  465  NLGCSKNPQTQWFRFIPSN  483



>gb|EYU23411.1| hypothetical protein MIMGU_mgv1a004205mg [Erythranthe guttata]
Length=539

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 107/208 (51%), Gaps = 25/208 (12%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSP----  591
            + AE+D DWALWT  GSY LREGT+ LEE YGV+  NW  PRN  +L R+ I++      
Sbjct  337  VVAEIDIDWALWTFQGSYILREGTLNLEEVYGVMDLNWDGPRNPQYLDRLQILRQKNQEL  396

Query  590  -FRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPW--GYTAGKALTVEGT  420
              + P Y       ++FHP +G C   +  +  + L  C  +  W      G      G+
Sbjct  397  ESKNPNYY------IMFHPQSGKCA-HIYKYGDIILATCETATRWEQHQDGGPIKLAGGS  449

Query  419  YFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIIT  246
              CL     G  A +   C   SSKW+I+S S +HL+++   G  +CL++++  N  I+T
Sbjct  450  SRCLTVAGDGGAASVSGDC---SSKWKIVSSSGLHLAAQDGKGKYLCLEMNATDNFTIVT  506

Query  245  NTCKCLNND------SSCDPASQWFKII  180
              C C+ +D       S +P  QWFK++
Sbjct  507  KKCLCVGDDLRDFPTCSDNPQGQWFKLV  534



>emb|CDP12092.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 125/229 (55%), Gaps = 26/229 (11%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
              AE D DWALWTL GSY LR+G V LEE YG+   NW   RN +  +R+ +++     P
Sbjct  716  FVAEHDLDWALWTLQGSYILRQGVVELEEVYGMFDVNWDHIRNSTLSRRLQLVKQIIWDP  775

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYT-AGKALTV----EGTYF  414
              + +  H  ++HP +GLC  ++     +    C     W    AG ++ +    EGT+ 
Sbjct  776  K-SNNTTHSKLYHPQSGLCA-QIGNNGSVRGSDCQSPGRWKQQEAGSSIQLEAEAEGTFG  833

Query  413  CLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD-SNNVIITNTC  237
            CL+A   G+PA +   C + ++ W+++S S++H++++   G  +CL+++ S++V++T  C
Sbjct  834  CLRAVGDGQPATVSSDCGNQTTLWKLVSSSQLHIAAQ---GGYLCLEMNSSDSVVVTRKC  890

Query  236  KCLNNDS----SC--DPASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKK  108
             CL+ +S    +C  +P  QWFK++ +          +S  F +F  KK
Sbjct  891  LCLDENSNDVPNCAENPEGQWFKLVPTN---------ESLIFFFFGDKK  930


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AE D DWALW L GSYYLR+G    EE YG+   +W   RN  F  ++ ++Q      G
Sbjct  281  AENDLDWALWALQGSYYLRDGKHDPEETYGLFNSSWGPLRNPQFHTKLQLIQRTLIATG  339



>gb|KGN50394.1| hypothetical protein Csa_5G171760 [Cucumis sativus]
Length=538

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 111/201 (55%), Gaps = 13/201 (6%)
 Frame = -3

Query  749  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGP--  579
            E DFDW LW L GSYY REG    EE +GVL   + + +N   FLQR  +MQ+  + P  
Sbjct  339  ENDFDWGLWALQGSYYYREGVKNAEENFGVLDSTFAKAKNSKLFLQRFQLMQTKLQDPSS  398

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQA  402
             +T S    +++HP++G CVR    +Q L +  C  S+ W +    + + + G+  CL+A
Sbjct  399  NFTTSL---IMYHPLSGGCVRMNKKYQ-LGISSCKTSNRWIHEQDSSPIKLAGSVLCLKA  454

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD--VDSNNVIITNTCKCL  228
              +G P  L   C+   S W+  S++++ L++  + G  +CL      ++ ++TN C C 
Sbjct  455  IGVGLPPILSQDCSSQQSIWKYGSNAKLQLATIDEQGQALCLQRAASHSHQLVTNKCLC-  513

Query  227  NNDSSC--DPASQWFKIIDST  171
            ++DS C  DP SQWF ++ S 
Sbjct  514  SSDSQCQEDPQSQWFTLVPSN  534



>ref|XP_011026965.1| PREDICTED: uncharacterized protein LOC105127394 [Populus euphratica]
Length=535

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 109/200 (55%), Gaps = 9/200 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW LW L GSYYLR+    +EE++GVL  +W   +N +  +R+ +++     P 
Sbjct  337  AAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLEIDWDRVKNPAVERRLGLLKQTLLDPK  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAE  399
             + + L+ +++HP +G CV    +   +  G C     W +   +  L ++GT  CL+A 
Sbjct  397  -SMAPLNYIMYHPQSGACVGE-GMDGQIRAGNCKGLTRWTHNGHEGPLELKGTGLCLKAI  454

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLN  225
              G P  L   C+   + W+ IS S++HL+SK   G  +CL +       I+T  C C+ 
Sbjct  455  GDGLPPILTPDCS--QTTWKPISASKLHLASKDHKGEYLCLHLAPPFAGNIVTKKCICVG  512

Query  224  NDSSC--DPASQWFKIIDST  171
            +D +C  +P SQWFK++++ 
Sbjct  513  DDPTCKDNPTSQWFKLVETN  532



>gb|KDP25367.1| hypothetical protein JCGZ_20523 [Jatropha curcas]
Length=483

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 104/204 (51%), Gaps = 11/204 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D +W LW   GSY+ RE  +G+EE YGV+ +NW   RN  + +R+ +++   + P 
Sbjct  280  AAEFDLEWGLWAWQGSYHYRENQIGMEETYGVMDYNWDRVRNPEYQRRMELIKLKLQDPS  339

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAE  399
              +S++ +++FHP +G C+      + +  G C     W +T  G  + ++G   C++  
Sbjct  340  -LKSQVSRIMFHPQSGTCISADGT-EGISAGDCKAPSHWVHTRDGDPIRLKGKRLCIKVV  397

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLN  225
              G    L   C+ + S W+ +S ++ H +S    G  VCL  +S     IIT  C  + 
Sbjct  398  SNGWEPMLSEDCSSEQSSWKKLSKTKFHFASVDDKGQQVCLQKESPYTRKIITRNCTLML  457

Query  224  NDSSC------DPASQWFKIIDST  171
             D+        +P +QWFK +++ 
Sbjct  458  EDAEYLKSPLNEPVAQWFKFVETN  481



>gb|EYU23409.1| hypothetical protein MIMGU_mgv1a004243mg [Erythranthe guttata]
Length=538

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/205 (33%), Positives = 109/205 (53%), Gaps = 24/205 (12%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRG---  582
            AE+D DW+LW + GSY LREG   +EE YGV+ +NW  P+N +F+ R+ I++   +G   
Sbjct  340  AEIDIDWSLWAIQGSYILREGNADVEETYGVMNFNWDGPKNPAFVDRLQILKQVNQGANS  399

Query  581  --PGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWG-YTAGKALTVEGTYFC  411
              PGY       ++ HP +G CV ++     + L  C  +  W  +  G  L + G+  C
Sbjct  400  KNPGYY------IMLHPQSGKCV-QIGNNNSVRLADCKTASRWDQHQDGGPLKLSGSSLC  452

Query  410  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTC  237
            L     G    +   CT   SKW+ +S S + L+++   G   CL+++ ++   +IT  C
Sbjct  453  LAVAGDGGATSVSDNCT---SKWKYVSSSGLQLAAQDGMGKYFCLEMNGSDHSTVITKKC  509

Query  236  KCLNND----SSC--DPASQWFKII  180
             C+ +D    S+C  +P  QWFK++
Sbjct  510  LCVGDDLGDFSTCADNPQVQWFKLV  534



>ref|XP_003621369.1| Endoglucanase E1 [Medicago truncatula]
 gb|AES77587.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 104/193 (54%), Gaps = 7/193 (4%)
 Frame = -3

Query  746  LDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTE  567
            +D DWALW   G+YY+R+  + + E +G+ ++++   R + F QR  +M      P    
Sbjct  337  VDLDWALWAAQGAYYIRKNEIIVSETFGIWSYDFRTLRYIEFPQRFQLMHKKLLEPSSNS  396

Query  566  SRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGK  387
            S+ + +I+HP++G CV +V+    L LG C     W    G+ + + G   C++A K G 
Sbjct  397  SKSY-IIYHPLSGQCV-KVNKRNKLVLGDCDGKSKWN-QVGQQIKLVGNDACIEAIKDGS  453

Query  386  PAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLNNDSS  213
              KL   C    S W+ +S + +HL +    G N+CL   S  +  I+T  C C++++ +
Sbjct  454  QVKLSNDCRSKQSFWKTLSATNLHLGTLDSQGQNLCLQRKSPTSPKIVTKKCICIDDNPA  513

Query  212  C--DPASQWFKII  180
            C  DP SQWF+++
Sbjct  514  CLEDPQSQWFQLV  526



>ref|XP_002298005.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
 gb|EEE82810.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
Length=535

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 108/200 (54%), Gaps = 9/200 (5%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AAE D DW LW L GSYYLR+    +EE++GVL  +W   +N    +R+ +++     P 
Sbjct  337  AAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLEIDWDRVKNPEVERRLGLLKQTLLDPK  396

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAE  399
             T + L+ +++HP +G CV    +   +  G C     W +   +  L ++ T  CL+A 
Sbjct  397  ST-APLNYIMYHPQSGACVGE-GMDGQIRAGNCKGLTRWTHNGHEGPLELKRTGLCLKAI  454

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLN  225
              G P  L   C+   + W+ IS S++HL+SK   G  +CL ++      I+T  C C+ 
Sbjct  455  GDGLPPILTPDCS--QTTWKPISASKLHLASKDHRGEYLCLHLEPPFAGNIVTKKCICVG  512

Query  224  NDSSC--DPASQWFKIIDST  171
            +D +C  +P SQWFK++++ 
Sbjct  513  DDPTCKDNPTSQWFKLVETN  532



>gb|AES77604.2| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=530

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 104/195 (53%), Gaps = 7/195 (4%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A +D DWALWT  GSYY+RE    + E YG+   ++   R   F QR  ++Q     P  
Sbjct  335  AGVDLDWALWTAQGSYYIREKESNVSEHYGLWNIDFKSLRYPDFPQRFQLVQKKLLEPSS  394

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKL  393
              S+ + +I+HP++G CV +V+    LELG C  +  W    G+ + + G    ++A   
Sbjct  395  NSSKSY-VIYHPLSGQCV-KVNTNNELELGDCEWASKWN-QEGQQIKLVGNGTYIEAVSD  451

Query  392  GKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLNND  219
            G   K+   C    S W+ +S + +HL +  + G N+CL  +S     I+T  C C++++
Sbjct  452  GSQVKVSNDCKSKQSFWKTLSATNLHLGTLDEQGQNLCLQRESTTSPKIVTKKCICIDDN  511

Query  218  SSC--DPASQWFKII  180
             +C  DP SQWF+++
Sbjct  512  PACLDDPQSQWFQLV  526



>ref|XP_009605826.1| PREDICTED: uncharacterized protein LOC104100317 [Nicotiana tomentosiformis]
Length=526

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 105/200 (53%), Gaps = 9/200 (5%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            L AELD DWA+W L G+YY REG  G+EE YG+    W   R+  +  ++ ++Q   + P
Sbjct  331  LLAELDLDWAVWALQGNYYTREGQQGMEEMYGMFNSTWNSLRSPEYHAKLQLIQQKLQDP  390

Query  578  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQA  402
               +   H L+FHP +G C+   +    L    C  +  W Y      + + GT  CL  
Sbjct  391  KSKQPMYH-LLFHPQSGKCLHAAA-NNVLYASDCIGASRWSYDGDDTPIRLTGTSLCLTT  448

Query  401  EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD---SNNVIITNTCKC  231
             + G P  L   C++ S+ W+ +S+ +  LS+  ++G+ +CLD D   S++ ++   C  
Sbjct  449  SREGLPVTLSTDCSEQST-WKFVSNYQ--LSNHDENGTELCLDFDTYYSSSKVLVRKCIG  505

Query  230  LNNDSSCDPASQWFKIIDST  171
            L+  S+ +P +QWFK + + 
Sbjct  506  LDEKSNDNPQTQWFKFVSAN  525



>gb|EYU23408.1| hypothetical protein MIMGU_mgv1a020519mg [Erythranthe guttata]
Length=538

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 109/201 (54%), Gaps = 14/201 (7%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
             A+ D DWALWT  GSY LREG V  EE YGV+  NW  PRN +FL ++ +++       
Sbjct  339  VADRDIDWALWTFQGSYILREGKVNSEEAYGVMDLNWDRPRNPAFLDKLQLIRQ-MNQEL  397

Query  575  YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWG-YTAGKALTVEGTYFCLQAE  399
             ++   + ++FHP +G CV +V     + L  C  +  W  +  G  + + G+  C+   
Sbjct  398  ESKKPTNYIMFHPQSGQCV-QVGKNNNIILSNCKTASRWDQHQDGGPIKLAGSPQCIGVA  456

Query  398  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNN--VIITNTCKCLN  225
              G  A++   C   SSKW+I S S +HL+++   G  +CL++++++   I+T  C C+ 
Sbjct  457  GDGGAARVSGDC---SSKWKIASTSGLHLAAQDGKGKYLCLEMNASDHSTIVTKKCLCVG  513

Query  224  ND------SSCDPASQWFKII  180
            +D       S +P  QWFK++
Sbjct  514  DDLVDFPTCSDNPQVQWFKLV  534



>gb|EAZ23667.1| hypothetical protein OsJ_07369 [Oryza sativa Japonica Group]
Length=583

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  758  LAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGP  579
            +AAELD DWALW L GSY LR+G  G +E YGVL W+W +PRN + L RI  +Q P RGP
Sbjct  338  VAAELDLDWALWALQGSYALRQGVAGADEVYGVLDWSWSKPRNATALSRIQSLQRPLRGP  397

Query  578  GYTESRLHKLIFHPMTGLCVRR  513
            GY E+R + ++FHP+TG CV R
Sbjct  398  GYDEARPYTVLFHPLTGRCVVR  419



>ref|XP_008459280.1| PREDICTED: uncharacterized protein LOC103498458 [Cucumis melo]
Length=719

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/206 (34%), Positives = 111/206 (54%), Gaps = 15/206 (7%)
 Frame = -3

Query  749  ELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLS-FLQRISIMQSPFRGPG-  576
            E DFDW LW L GSYY + G     E +GVL  N+ + +N   FLQR  +MQ+  +    
Sbjct  511  ENDFDWGLWALQGSYYYKVGVKNAGENFGVLDSNFTKAKNSKLFLQRFQLMQTKLQESQR  570

Query  575  ---YTESRLH----KLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGT  420
               YT+   +     +++HP++G C+R    +Q L +  C  S+ W +   G  + + G+
Sbjct  571  LLFYTDPSSNFTTSFIMYHPLSGGCMRMNKKYQ-LGISSCKTSNRWSHEQDGAPIKLAGS  629

Query  419  YFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITN  243
              CL+A  +G P  L   C+   S W+  S++++ L++  + G  +CL   S+ + I+TN
Sbjct  630  ILCLKAIGVGLPPILSQDCSSQQSIWKYGSNAKLQLATVDEQGQALCLQRASHSHQIVTN  689

Query  242  TCKCLNNDSSC--DPASQWFKIIDST  171
             C C +NDS C  DP SQWF ++ S 
Sbjct  690  KCLC-SNDSQCQEDPQSQWFTLVPSN  714



>gb|KGN57438.1| hypothetical protein Csa_3G185670 [Cucumis sativus]
Length=427

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 96/180 (53%), Gaps = 5/180 (3%)
 Frame = -3

Query  743  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  564
            DFDW LW L GSYY REG    EE +GVL   +   +N  FLQ+  +MQ+  + P  +  
Sbjct  251  DFDWGLWALQGSYYYREGVKNDEETFGVLDSKFTNVKNPKFLQKFQLMQTKLQDPS-SNL  309

Query  563  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAEKLGK  387
                +++HP++G CVR    +Q L +  C  S+ W +      + + G+  CLQA   G 
Sbjct  310  TTSFIMYHPLSGECVRMNKKYQ-LGVSSCKTSNRWSHEQDDTPIKLAGSILCLQAVGDGL  368

Query  386  PAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNNDSSC  210
            P  L   C+   S W+  S++++ L++  + G  +CL   S+ + I+TN C C  NDS C
Sbjct  369  PPILSKDCSSQQSAWKYASNAKLQLATVDEQGQALCLQRASHSHQILTNKCICP-NDSDC  427



>ref|XP_004168759.1| PREDICTED: uncharacterized protein LOC101223591 [Cucumis sativus]
Length=522

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 95/179 (53%), Gaps = 4/179 (2%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            A+ D DWALW   GSYY REG     E +GVL  NW + +N +F+Q+  ++Q+  + P  
Sbjct  246  AQRDLDWALWAWQGSYYFREGQAEPGESFGVLDSNWTQIKNPNFVQKFQLLQTMLQDPNS  305

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEK  396
              S    +I+HP +  C++  +  + + L  CS    W +   G  + +  T   L+A  
Sbjct  306  NAS-FSYVIYHPQSSQCIQVSNDNKEIFLTNCSTPTRWSHNNDGTPIEMSSTGLYLKASG  364

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNV--IITNTCKCLN  225
             G  A L        S W  IS+S++HL++  + G N+CL +DS+N   ++TN+C C N
Sbjct  365  EGLEASLSSDTLSQQSVWSAISNSKLHLATFTQGGKNLCLQIDSSNSSKVVTNSCICTN  423



>ref|XP_009773950.1| PREDICTED: uncharacterized protein LOC104224082 [Nicotiana sylvestris]
Length=526

 Score =   110 bits (275),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 101/198 (51%), Gaps = 9/198 (5%)
 Frame = -3

Query  752  AELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGY  573
            AELD DWA+W L G+YY REG  G+EE YG+    W   RN  +  ++ ++Q   + P  
Sbjct  333  AELDLDWAVWALQGNYYTREGQQGMEEMYGMFNSTWKTLRNPEYHAKLQLIQQTLQDPKS  392

Query  572  TESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKA-LTVEGTYFCLQAEK  396
             +   H L+FHP +G C+        +    C  +  W Y      + + GT  CL   +
Sbjct  393  KQPMYH-LLFHPQSGKCLHAAD-NNVVYASDCIGASRWSYDGDDTPIRLTGTSLCLTTSR  450

Query  395  LGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVD---SNNVIITNTCKCLN  225
             G P  L   C++ S+ W+  S+ +  LS+  ++GS +CLD D   S++ ++   C  L+
Sbjct  451  EGLPVALSTDCSEQST-WKFASNYQ--LSNHDENGSELCLDFDTYYSSSKVLVRKCIGLD  507

Query  224  NDSSCDPASQWFKIIDST  171
              S  +P +QWFK + + 
Sbjct  508  EKSIDNPQNQWFKFVSAN  525



>ref|XP_002509877.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF51264.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=547

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 104/215 (48%), Gaps = 21/215 (10%)
 Frame = -3

Query  755  AAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPG  576
            AA+ D DW  W   GSYY RE   G EE +GV+ +NW   RN  F  R+ ++    + P 
Sbjct  332  AADTDVDWGFWAWQGSYYYRENQTGTEETFGVMNFNWNRVRNPEFQNRMQLITKKLQDPS  391

Query  575  YTESRLHKLIFHPMTGLCVR---RVSLFQPLELGPCSESDPWGYTA---------GKALT  432
             + S    ++FH ++G C+       ++      P   SDP G            G  + 
Sbjct  392  -SNSSTSYIMFHALSGSCIHTDGNKEIYATSCKAPRRWSDPAGDVIPMKWLHDGDGAPIR  450

Query  431  VEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDS--NN  258
            ++GT  CL+A   G    L   C+   S W+ +S +++HL++  ++G  +CL  +S   +
Sbjct  451  LKGTKLCLKALGEGLAPILSEDCSSPQSSWKFLSKTKLHLAATDENGEYLCLQKESPYTS  510

Query  257  VIITNTCKCLNNDSSC------DPASQWFKIIDST  171
             I+TN C  +N +  C      DP +QWFK++ + 
Sbjct  511  KILTNACIFMNEEPECGKDPQKDPVTQWFKLVKTN  545



>ref|XP_004170742.1| PREDICTED: uncharacterized protein LOC101225189, partial [Cucumis 
sativus]
Length=337

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 101/190 (53%), Gaps = 5/190 (3%)
 Frame = -3

Query  743  DFDWALWTLAGSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTES  564
            D DWA W   GSY  R+G   ++E +G++  +W + R+    Q + + +   + P  ++ 
Sbjct  146  DIDWAYWAFQGSYMYRQGQQDVDESFGIMDSSWTKDRSPRLQQMLQLAKRINQDPN-SKG  204

Query  563  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  384
             +  ++ HP++G CV ++     +ELG C     W +T   +        CL++   GKP
Sbjct  205  PMSYIMLHPVSGQCV-KLDGKGGIELGDCETPTLWDHTGDGSPMKLWNGQCLKSAGDGKP  263

Query  383  AKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSC--  210
              +   C+ D S W + S +++ LS+K   G N+CL+ +S+  I+   C CL ++ +C  
Sbjct  264  PVVSAECSGDGSSWTVASKAKLQLSTK-SGGENICLEKESDTSIVVKKCICLKDEWNCFD  322

Query  209  DPASQWFKII  180
            DP SQWFK++
Sbjct  323  DPQSQWFKLV  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470