BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027M03

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN69940.1|  hypothetical protein VITISV_006128                     325   6e-107   Vitis vinifera
ref|XP_011101432.1|  PREDICTED: uncharacterized protein LOC105179...    325   2e-105   
gb|AFK37074.1|  unknown                                                 315   2e-105   Lotus japonicus
ref|XP_011101430.1|  PREDICTED: uncharacterized protein LOC105179...    327   4e-105   Sesamum indicum [beniseed]
ref|XP_010316842.1|  PREDICTED: uncharacterized protein LOC101268...    324   5e-105   Solanum lycopersicum
ref|XP_011101428.1|  PREDICTED: uncharacterized protein LOC105179...    326   8e-105   
ref|XP_011101426.1|  PREDICTED: uncharacterized protein LOC105179...    326   1e-104   
emb|CDO96854.1|  unnamed protein product                                313   1e-104   Coffea canephora [robusta coffee]
ref|XP_010316841.1|  PREDICTED: uncharacterized protein LOC101268...    325   1e-104   Solanum lycopersicum
ref|XP_011101427.1|  PREDICTED: uncharacterized protein LOC105179...    326   1e-104   Sesamum indicum [beniseed]
ref|XP_011101431.1|  PREDICTED: uncharacterized protein LOC105179...    325   2e-104   Sesamum indicum [beniseed]
ref|XP_011101429.1|  PREDICTED: uncharacterized protein LOC105179...    325   2e-104   Sesamum indicum [beniseed]
ref|XP_006358109.1|  PREDICTED: uncharacterized protein LOC102598...    325   3e-104   Solanum tuberosum [potatoes]
ref|XP_008443516.1|  PREDICTED: uncharacterized protein LOC103487085    325   3e-104   Cucumis melo [Oriental melon]
ref|XP_002265546.1|  PREDICTED: uncharacterized protein LOC100241189    325   4e-104   Vitis vinifera
ref|XP_011101425.1|  PREDICTED: uncharacterized protein LOC105179...    325   5e-104   Sesamum indicum [beniseed]
ref|XP_009783190.1|  PREDICTED: uncharacterized protein LOC104231...    324   6e-104   Nicotiana sylvestris
gb|EYU28112.1|  hypothetical protein MIMGU_mgv1a0046272mg               313   6e-104   Erythranthe guttata [common monkey flower]
ref|XP_004233027.1|  PREDICTED: uncharacterized protein LOC101268...    324   7e-104   Solanum lycopersicum
ref|XP_011101423.1|  PREDICTED: uncharacterized protein LOC105179...    324   1e-103   Sesamum indicum [beniseed]
ref|XP_006358105.1|  PREDICTED: uncharacterized protein LOC102598...    324   1e-103   Solanum tuberosum [potatoes]
gb|KDP21131.1|  hypothetical protein JCGZ_21602                         319   3e-103   Jatropha curcas
ref|XP_010057127.1|  PREDICTED: uncharacterized protein LOC104445...    318   4e-103   Eucalyptus grandis [rose gum]
ref|XP_009783189.1|  PREDICTED: uncharacterized protein LOC104231...    323   4e-103   Nicotiana sylvestris
ref|XP_004147385.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    321   8e-103   
ref|XP_004161197.1|  PREDICTED: uncharacterized LOC101203416            321   2e-102   
ref|XP_009631270.1|  PREDICTED: uncharacterized protein LOC104121...    320   2e-102   Nicotiana tomentosiformis
ref|XP_004504281.1|  PREDICTED: uncharacterized protein LOC101492...    316   5e-102   Cicer arietinum [garbanzo]
ref|XP_003629827.1|  UOS1                                               316   5e-102   Medicago truncatula
ref|XP_007025316.1|  NAD(P)-binding Rossmann-fold superfamily pro...    320   6e-102   
ref|XP_007025318.1|  NAD(P)-binding Rossmann-fold superfamily pro...    320   6e-102   
ref|XP_007159482.1|  hypothetical protein PHAVU_002G241100g             320   6e-102   Phaseolus vulgaris [French bean]
ref|XP_009351587.1|  PREDICTED: uncharacterized protein LOC103943107    320   7e-102   Pyrus x bretschneideri [bai li]
ref|XP_008371503.1|  PREDICTED: uncharacterized protein LOC103434908    319   1e-101   
ref|XP_010242113.1|  PREDICTED: uncharacterized protein LOC104586544    319   1e-101   Nelumbo nucifera [Indian lotus]
ref|XP_009631263.1|  PREDICTED: uncharacterized protein LOC104121...    319   2e-101   Nicotiana tomentosiformis
gb|AAM19355.1|AF369888_1  UOS1                                          319   2e-101   Pisum sativum [garden pea]
gb|KJB66859.1|  hypothetical protein B456_010G161400                    315   2e-101   Gossypium raimondii
gb|KHN48016.1|  hypothetical protein glysoja_015486                     315   3e-101   Glycine soja [wild soybean]
ref|XP_010057126.1|  PREDICTED: uncharacterized protein LOC104445...    318   3e-101   Eucalyptus grandis [rose gum]
ref|XP_006384071.1|  hypothetical protein POPTR_0004s05960g             309   5e-101   
ref|XP_008790013.1|  PREDICTED: uncharacterized protein LOC103707...    317   5e-101   Phoenix dactylifera
ref|XP_003629826.1|  UOS1                                               316   2e-100   
ref|XP_004504280.1|  PREDICTED: uncharacterized protein LOC101492...    316   2e-100   Cicer arietinum [garbanzo]
emb|CDX99423.1|  BnaC01g11290D                                          308   2e-100   
ref|XP_006449545.1|  hypothetical protein CICLE_v10018335mg             317   2e-100   
ref|XP_006467612.1|  PREDICTED: uncharacterized protein LOC102627312    315   3e-100   Citrus sinensis [apfelsine]
gb|AET04302.2|  NAD(P)-binding rossmann-fold protein                    315   3e-100   Medicago truncatula
ref|XP_010686247.1|  PREDICTED: uncharacterized protein LOC104900...    315   3e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004295588.1|  PREDICTED: uncharacterized protein LOC101314642    315   4e-100   Fragaria vesca subsp. vesca
ref|XP_010686246.1|  PREDICTED: uncharacterized protein LOC104900...    315   5e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010686245.1|  PREDICTED: uncharacterized protein LOC104900...    315   6e-100   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB66858.1|  hypothetical protein B456_010G161400                    315   7e-100   Gossypium raimondii
gb|KJB66861.1|  hypothetical protein B456_010G161400                    314   7e-100   Gossypium raimondii
ref|XP_010915482.1|  PREDICTED: uncharacterized protein LOC105040...    314   1e-99    
gb|KHG02784.1|  hypothetical protein F383_26204                         314   2e-99    Gossypium arboreum [tree cotton]
ref|XP_010915481.1|  PREDICTED: uncharacterized protein LOC105040...    313   2e-99    
ref|NP_001242339.1|  uncharacterized protein LOC100815475               313   2e-99    
ref|XP_007214164.1|  hypothetical protein PRUPE_ppa018961mg             313   3e-99    
ref|XP_003524972.1|  PREDICTED: uncharacterized protein LOC100500578    311   2e-98    Glycine max [soybeans]
gb|KHN06420.1|  Putative complex I intermediate-associated protei...    311   2e-98    Glycine soja [wild soybean]
ref|XP_010999786.1|  PREDICTED: uncharacterized protein LOC105107...    308   3e-98    Populus euphratica
emb|CDX99422.1|  BnaC01g11300D                                          310   3e-98    
ref|XP_004161206.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    310   5e-98    
ref|XP_010999785.1|  PREDICTED: uncharacterized protein LOC105107...    309   7e-98    Populus euphratica
emb|CDX78897.1|  BnaA01g09640D                                          310   7e-98    
ref|XP_010529213.1|  PREDICTED: uncharacterized protein LOC104806...    305   8e-98    Tarenaya hassleriana [spider flower]
ref|XP_009381202.1|  PREDICTED: uncharacterized protein LOC103969413    309   9e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_193616.2|  NAD(P)-binding Rossmann-fold superfamily protein      309   9e-98    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD27665.1|  putative UOS1                                          301   1e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004147418.1|  PREDICTED: uncharacterized protein LOC101211769    308   2e-97    
ref|NP_001190764.1|  NAD(P)-binding Rossmann-fold superfamily pro...    309   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|ACN39869.1|  unknown                                                 308   2e-97    Picea sitchensis
gb|ABR17731.1|  unknown                                                 307   2e-97    Picea sitchensis
ref|XP_002867974.1|  transcriptional repressor                          307   3e-97    
gb|KFK28552.1|  hypothetical protein AALP_AA7G011200                    306   7e-97    Arabis alpina [alpine rockcress]
ref|XP_006830227.1|  hypothetical protein AMTR_s00130p00051210          306   8e-97    Amborella trichopoda
ref|XP_010106609.1|  hypothetical protein L484_004838                   306   1e-96    
ref|XP_006283354.1|  hypothetical protein CARUB_v10004397mg             301   2e-96    
ref|NP_001288965.1|  uncharacterized LOC103856855                       306   2e-96    Brassica rapa
ref|XP_008679815.1|  PREDICTED: uncharacterized protein LOC103654777    305   2e-96    Zea mays [maize]
ref|XP_007212771.1|  hypothetical protein PRUPE_ppa019705mg             295   2e-96    
ref|XP_010529212.1|  PREDICTED: uncharacterized protein LOC104806...    305   3e-96    Tarenaya hassleriana [spider flower]
ref|XP_002451838.1|  hypothetical protein SORBIDRAFT_04g008450          304   6e-96    Sorghum bicolor [broomcorn]
ref|XP_006414053.1|  hypothetical protein EUTSA_v10024714mg             304   8e-96    Eutrema salsugineum [saltwater cress]
ref|XP_002305056.2|  hypothetical protein POPTR_0004s05960g             304   8e-96    
ref|XP_006414054.1|  hypothetical protein EUTSA_v10024714mg             304   8e-96    Eutrema salsugineum [saltwater cress]
ref|XP_009408895.1|  PREDICTED: uncharacterized protein LOC103991243    294   9e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010439808.1|  PREDICTED: uncharacterized protein LOC104723...    303   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010439809.1|  PREDICTED: uncharacterized protein LOC104723...    303   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010449465.1|  PREDICTED: uncharacterized protein LOC104731...    301   5e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010449464.1|  PREDICTED: uncharacterized protein LOC104731...    301   6e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006283353.1|  hypothetical protein CARUB_v10004397mg             301   9e-95    
ref|XP_010449466.1|  PREDICTED: uncharacterized protein LOC104731...    301   1e-94    
gb|EEC72794.1|  hypothetical protein OsI_06478                          301   1e-94    Oryza sativa Indica Group [Indian rice]
ref|NP_001046381.1|  Os02g0234500                                       301   1e-94    
ref|XP_010434492.1|  PREDICTED: uncharacterized protein LOC104718...    301   1e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010434493.1|  PREDICTED: uncharacterized protein LOC104718...    301   3e-94    
ref|XP_004951358.1|  PREDICTED: uncharacterized protein LOC101762...    300   3e-94    Setaria italica
ref|XP_003571881.1|  PREDICTED: uncharacterized protein LOC100826457    299   5e-94    Brachypodium distachyon [annual false brome]
gb|AFW65984.1|  hypothetical protein ZEAMMB73_939804                    298   1e-93    
ref|XP_006648484.1|  PREDICTED: uncharacterized protein LOC102714621    297   7e-93    
gb|AAG42527.1|  unknown                                                 277   6e-91    Prunus persica
emb|CAB37466.1|  putative protein                                       292   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216112.1|  hypothetical protein PRUPE_ppa018758mg             278   2e-90    
ref|XP_004951357.1|  PREDICTED: uncharacterized protein LOC101762...    285   2e-88    
ref|XP_004951356.1|  PREDICTED: uncharacterized protein LOC101762...    284   6e-88    
ref|XP_002968299.1|  hypothetical protein SELMODRAFT_170011             275   9e-86    
ref|XP_002976078.1|  hypothetical protein SELMODRAFT_175261             275   1e-84    Selaginella moellendorffii
ref|XP_001752746.1|  predicted protein                                  270   1e-82    
ref|XP_007203005.1|  hypothetical protein PRUPE_ppa017382mg             238   4e-75    
ref|XP_008242153.1|  PREDICTED: uncharacterized protein LOC103340512    233   5e-73    
ref|XP_007025317.1|  NAD(P)-binding Rossmann-fold superfamily pro...    242   2e-72    
ref|XP_008790014.1|  PREDICTED: uncharacterized protein LOC103707...    240   1e-71    Phoenix dactylifera
ref|XP_008790015.1|  PREDICTED: uncharacterized protein LOC103707...    238   6e-71    Phoenix dactylifera
ref|XP_008245276.1|  PREDICTED: uncharacterized protein LOC103343393    213   4e-66    Prunus mume [ume]
gb|EMT20673.1|  hypothetical protein F775_52263                         213   2e-61    
gb|AFW65987.1|  hypothetical protein ZEAMMB73_939804                    199   1e-60    
ref|XP_007207983.1|  hypothetical protein PRUPE_ppa015737mg             198   9e-60    
gb|AFW65985.1|  hypothetical protein ZEAMMB73_939804                    201   2e-57    
ref|XP_008241855.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    192   4e-57    
gb|EMS56081.1|  putative complex I intermediate-associated protei...    198   5e-55    Triticum urartu
ref|XP_001700919.1|  protein with predicted nucleoside-diphosphat...    187   3e-52    Chlamydomonas reinhardtii
ref|XP_008245335.1|  PREDICTED: leucine-rich repeat receptor-like...    182   4e-52    Prunus mume [ume]
ref|XP_002522251.1|  conserved hypothetical protein                     184   6e-51    
gb|KIY97781.1|  hypothetical protein MNEG_10183                         176   7e-50    Monoraphidium neglectum
ref|WP_026098965.1|  NADH:ubiquinone oxidoreductase                     180   2e-49    Oscillatoria sp. PCC 10802
gb|EPS64358.1|  hypothetical protein M569_10423                         179   3e-49    Genlisea aurea
ref|WP_026735574.1|  NADH:ubiquinone oxidoreductase                     174   2e-47    Fischerella sp. PCC 9605
ref|WP_015176136.1|  NADH:ubiquinone oxidoreductase complex I int...    174   3e-47    Oscillatoria nigro-viridis
ref|XP_008230832.1|  PREDICTED: uncharacterized protein LOC103330068    163   6e-47    Prunus mume [ume]
ref|WP_026721354.1|  NADH:ubiquinone oxidoreductase                     172   8e-47    Fischerella sp. PCC 9431
ref|WP_015180824.1|  NmrA-like family protein                           172   8e-47    Microcoleus sp. PCC 7113
ref|WP_015116675.1|  NmrA-like family protein                           172   9e-47    Rivularia sp. PCC 7116
ref|WP_015146863.1|  NmrA-like family protein                           172   1e-46    Oscillatoria acuminata
ref|WP_015141536.1|  NmrA-like family protein                           172   1e-46    Nostoc sp. PCC 7524
ref|WP_017323313.1|  NADH:ubiquinone oxidoreductase complex I int...    172   2e-46    cyanobacterium PCC 7702
ref|WP_040937520.1|  NADH:ubiquinone oxidoreductase                     172   2e-46    
ref|WP_027845680.1|  NADH:ubiquinone oxidoreductase                     171   4e-46    Mastigocoleus testarum
ref|WP_007356111.1|  MULTISPECIES: NmrA-like                            170   7e-46    Kamptonema
ref|WP_040943935.1|  NADH:ubiquinone oxidoreductase                     170   9e-46    
ref|WP_009457802.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...    170   1e-45    Fischerella thermalis
ref|WP_039754165.1|  NADH:ubiquinone oxidoreductase                     169   1e-45    
ref|WP_006634404.1|  NADH:ubiquinone oxidoreductase complex I int...    169   2e-45    Microcoleus vaginatus
ref|WP_015205483.1|  NADH:ubiquinone oxidoreductase complex I int...    169   2e-45    Crinalium epipsammum
ref|WP_015206966.1|  NmrA-like family protein                           169   2e-45    Cylindrospermum stagnale
ref|WP_016866205.1|  NADH:ubiquinone oxidoreductase complex I int...    169   2e-45    Fischerella muscicola
ref|XP_008225252.1|  PREDICTED: uncharacterized protein LOC103324917    158   4e-45    
ref|WP_041032572.1|  NADH:ubiquinone oxidoreductase                     168   5e-45    Tolypothrix campylonemoides
ref|WP_017651686.1|  NADH:ubiquinone oxidoreductase complex I int...    168   6e-45    Fortiea contorta
ref|XP_002949080.1|  hypothetical protein VOLCADRAFT_89408              169   8e-45    Volvox carteri f. nagariensis
gb|EWM29347.1|  nadh:ubiquinone oxidoreductase complex i intermed...    167   2e-44    Nannochloropsis gaditana
ref|WP_017312960.1|  NADH:ubiquinone oxidoreductase complex I int...    166   2e-44    Fischerella sp. PCC 9339
ref|WP_044446747.1|  NADH:ubiquinone oxidoreductase                     166   2e-44    Mastigocladus laminosus
ref|WP_016864210.1|  NADH:ubiquinone oxidoreductase complex I int...    166   3e-44    Fischerella muscicola
emb|CBN79682.1|  conserved unknown protein                              166   3e-44    Ectocarpus siliculosus
ref|WP_023067525.1|  short chain dehydrogenase family protein           165   5e-44    Lyngbya aestuarii
ref|WP_006530839.1|  NmrA-like family protein                           164   6e-44    Gloeocapsa sp. PCC 73106
ref|WP_015113169.1|  NADH:ubiquinone oxidoreductase complex I int...    164   9e-44    Nostoc sp. PCC 7107
ref|WP_012412749.1|  NADH:ubiquinone oxidoreductase complex I int...    164   1e-43    Nostoc punctiforme
gb|KIJ84806.1|  NADH:ubiquinone oxidoreductase                          164   1e-43    Scytonema tolypothrichoides VB-61278
ref|WP_019492893.1|  NADH:ubiquinone oxidoreductase complex I int...    164   1e-43    Calothrix sp. PCC 7103
ref|WP_017318111.1|  NADH:ubiquinone oxidoreductase complex I int...    164   1e-43    Mastigocladopsis repens
ref|WP_012599050.1|  NADH:ubiquinone oxidoreductase complex I int...    164   1e-43    Cyanothece sp. PCC 7424
ref|WP_009782432.1|  hypothetical protein                               164   1e-43    Lyngbya sp. PCC 8106
ref|WP_008183365.1|  complex I intermediate-associated protein, N...    164   2e-43    Moorea producens
gb|AHJ26864.1|  hypothetical protein NSP_5140                           163   2e-43    Nodularia spumigena CCY9414
ref|WP_006196301.1|  hypothetical protein                               163   3e-43    Nodularia spumigena
ref|WP_026796563.1|  NADH:ubiquinone oxidoreductase                     163   4e-43    Planktothrix
ref|WP_012626990.1|  NADH:ubiquinone oxidoreductase complex I int...    163   4e-43    Cyanothece sp. PCC 7425
ref|WP_026787787.1|  NADH:ubiquinone oxidoreductase                     162   4e-43    Planktothrix rubescens
ref|WP_027255199.1|  NADH:ubiquinone oxidoreductase                     162   4e-43    Planktothrix agardhii
ref|WP_015216704.1|  NADH:ubiquinone oxidoreductase complex I int...    162   5e-43    Anabaena cylindrica
gb|KIE07000.1|  NADH:ubiquinone oxidoreductase                          162   6e-43    Tolypothrix bouteillei VB521301
ref|WP_011319070.1|  hypothetical protein                               162   7e-43    Trichormus variabilis
ref|WP_015143937.1|  NmrA-like family protein                           162   7e-43    Pleurocapsa minor
gb|EFA71481.1|  conserved hypothetical protein                          157   9e-43    Cylindrospermopsis raciborskii CS-505
ref|XP_005855477.1|  nadh:ubiquinone oxidoreductase complex i int...    165   1e-42    Nannochloropsis gaditana CCMP526
ref|WP_010999152.1|  hypothetical protein                               161   1e-42    Nostocaceae
ref|WP_042154417.1|  NADH:ubiquinone oxidoreductase                     161   1e-42    Planktothrix agardhii
ref|WP_027250028.1|  NADH:ubiquinone oxidoreductase                     161   2e-42    Planktothrix agardhii
ref|WP_026795424.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase       161   2e-42    Planktothrix
ref|WP_006623969.1|  MULTISPECIES: NmrA-like protein                    161   2e-42    Arthrospira
ref|WP_037224336.1|  NADH:ubiquinone oxidoreductase                     161   2e-42    
ref|WP_015131038.1|  NADH:ubiquinone oxidoreductase complex I int...    160   3e-42    Calothrix sp. PCC 7507
ref|WP_035150436.1|  NADH:ubiquinone oxidoreductase                     160   4e-42    Calothrix sp. 336/3
ref|WP_027401452.1|  NADH:ubiquinone oxidoreductase                     160   4e-42    Aphanizomenon flos-aquae
ref|WP_006618043.1|  NmrA-like protein                                  160   5e-42    Arthrospira platensis
ref|WP_015078922.1|  hypothetical protein                               160   5e-42    Anabaena sp. 90
ref|WP_013192562.1|  NADH:ubiquinone oxidoreductase complex I int...    159   6e-42    Trichormus azollae
ref|WP_009344296.1|  hypothetical protein                               159   1e-41    Raphidiopsis brookii
ref|WP_016953583.1|  NADH:ubiquinone oxidoreductase complex I int...    159   1e-41    Anabaena sp. PCC 7108
ref|WP_012594575.1|  NADH:ubiquinone oxidoreductase complex I int...    159   1e-41    Cyanothece sp. PCC 8801
ref|WP_015783548.1|  NADH:ubiquinone oxidoreductase complex I int...    159   1e-41    Cyanothece sp. PCC 8802
ref|WP_009633206.1|  NmrA-like family protein                           158   2e-41    Synechocystis sp. PCC 7509
ref|WP_028084600.1|  NADH:ubiquinone oxidoreductase                     158   3e-41    Dolichospermum circinale
ref|WP_016878104.1|  NADH:ubiquinone oxidoreductase complex I int...    157   3e-41    Chlorogloeopsis fritschii
ref|WP_013325168.1|  NADH:ubiquinone oxidoreductase complex I int...    157   3e-41    Cyanothece sp. PCC 7822
ref|WP_017747824.1|  NADH:ubiquinone oxidoreductase complex I int...    157   3e-41    Scytonema hofmannii
ref|WP_028090688.1|  NADH:ubiquinone oxidoreductase                     157   4e-41    Dolichospermum circinale
ref|WP_008274624.1|  hypothetical protein                               157   7e-41    Cyanothece sp. CCY0110
ref|XP_003606736.1|  UOS1                                               154   1e-40    
ref|WP_039716664.1|  NADH:ubiquinone oxidoreductase                     155   2e-40    
ref|WP_015189798.1|  NADH:ubiquinone oxidoreductase complex I int...    155   2e-40    Gloeocapsa sp. PCC 7428
ref|WP_015200706.1|  NADH:ubiquinone oxidoreductase complex I int...    155   3e-40    Calothrix parietina
gb|ABG52549.1|  NmrA-like                                               155   3e-40    Trichodesmium erythraeum IMS101
ref|WP_044137683.1|  NADH:ubiquinone oxidoreductase                     155   3e-40    Trichodesmium erythraeum
ref|WP_021832890.1|  similar to nucleoside-diphosphate-sugar epim...    154   6e-40    Crocosphaera watsonii
ref|WP_007309137.1|  hypothetical Transposase-like protein, IS200...    154   7e-40    Crocosphaera watsonii
ref|WP_015154354.1|  NADH:ubiquinone oxidoreductase complex I int...    154   9e-40    Chroococcidiopsis thermalis
ref|WP_007304974.1|  similar to nucleoside-diphosphate-sugar epim...    153   1e-39    Crocosphaera watsonii
ref|WP_009545319.1|  MULTISPECIES: NADH:ubiquinone oxidoreductase...    153   1e-39    Cyanothece
ref|WP_036486017.1|  NADH:ubiquinone oxidoreductase                     150   1e-38    
ref|WP_028948544.1|  NADH:ubiquinone oxidoreductase                     150   1e-38    Synechocystis sp. PCC 6714
ref|WP_010873873.1|  hypothetical protein                               149   2e-38    Synechocystis
ref|WP_041235904.1|  NADH:ubiquinone oxidoreductase                     147   2e-37    
gb|AFZ51428.1|  NAD dependent epimerase/dehydratase family protein      147   2e-37    Dactylococcopsis salina PCC 8305
ref|WP_019508481.1|  hypothetical protein                               146   5e-37    Pleurocapsa sp. PCC 7319
ref|WP_015224203.1|  NADH:ubiquinone oxidoreductase complex I int...    145   9e-37    Halothece sp. PCC 7418
ref|WP_017659907.1|  hypothetical protein                               145   9e-37    Geitlerinema sp. PCC 7105
gb|AFA36543.1|  transcriptional repressor                               134   4e-36    Lolium perenne [perennial ryegrass]
ref|WP_006512403.1|  NmrA-like family protein                           140   4e-35    Xenococcus sp. PCC 7305
ref|WP_015194049.1|  NADH:ubiquinone oxidoreductase complex I int...    137   7e-34    Stanieria cyanosphaera
ref|WP_024125545.1|  NmrA family protein                                134   8e-33    Thermosynechococcus sp. NK55a
ref|WP_011055916.1|  hypothetical protein                               130   2e-31    Thermosynechococcus elongatus
ref|WP_041431015.1|  hypothetical protein                               126   5e-30    
gb|AFY59699.1|  NmrA-like family protein                                126   6e-30    Synechococcus sp. PCC 6312
ref|XP_003606730.1|  UOS1                                               115   5e-29    
ref|XP_005539477.1|  hypothetical protein, conserved                    124   7e-29    Cyanidioschyzon merolae strain 10D
gb|KCW74152.1|  hypothetical protein EUGRSUZ_E02785                     117   7e-27    Eucalyptus grandis [rose gum]
emb|CCQ66954.1|  hypothetical protein CWATWH0402_3772                   108   4e-26    Crocosphaera watsonii WH 0402
ref|XP_005716821.1|  unnamed protein product                            112   8e-25    Chondrus crispus [carageen]
emb|CCH67772.1|  hypothetical protein RINTHH_16170                    98.6    2e-20    Richelia intracellularis HH01
emb|CCH64716.1|  hypothetical protein RINTHM_2400                     89.0    2e-18    Richelia intracellularis HM01
ref|WP_044258135.1|  NADH:ubiquinone oxidoreductase                   88.6    8e-18    
emb|CBJ28796.1|  conserved unknown protein                            88.6    2e-16    Ectocarpus siliculosus
ref|XP_005850646.1|  hypothetical protein CHLNCDRAFT_140649           86.3    1e-15    Chlorella variabilis
ref|XP_005647522.1|  CIA30-domain-containing protein                  84.0    5e-15    Coccomyxa subellipsoidea C-169
ref|WP_019072611.1|  hypothetical protein                             81.3    5e-15    Streptomyces
ref|XP_005706763.1|  NADH:ubiquinone oxidoreductase complex I int...  83.6    6e-15    Galdieria sulphuraria
ref|WP_042393447.1|  hypothetical protein                             79.3    2e-14    Streptacidiphilus carbonis
ref|WP_030262252.1|  hypothetical protein                             78.6    4e-14    Streptacidiphilus jeojiense
ref|WP_012505715.1|  epimerase                                        78.2    6e-14    Prosthecochloris aestuarii
ref|WP_037737932.1|  hypothetical protein                             78.2    6e-14    Streptomyces mirabilis
ref|WP_033279106.1|  hypothetical protein                             77.8    7e-14    Streptomyces sp. NRRL F-525
ref|WP_035847875.1|  hypothetical protein                             77.4    8e-14    Kitasatospora azatica
ref|XP_002294504.1|  predicted protein                                79.3    9e-14    Thalassiosira pseudonana CCMP1335
ref|XP_002176753.1|  predicted protein                                77.0    5e-13    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_030921505.1|  hypothetical protein                             74.7    7e-13    Streptomyces sp. NRRL S-384
ref|WP_019060063.1|  hypothetical protein                             74.3    9e-13    Streptomyces prunicolor
ref|WP_030167945.1|  hypothetical protein                             74.3    1e-12    Streptomyces sp. NRRL S-813
ref|WP_030462625.1|  hypothetical protein                             73.9    1e-12    Kitasatospora sp. NRRL B-11411
ref|XP_002948891.1|  hypothetical protein VOLCADRAFT_58555            76.3    2e-12    Volvox carteri f. nagariensis
ref|WP_012508070.1|  epimerase                                        73.6    2e-12    Pelodictyon phaeoclathratiforme
ref|XP_005649198.1|  NAD(P)-binding protein                           73.2    2e-12    Coccomyxa subellipsoidea C-169
ref|XP_002522250.1|  hypothetical protein RCOM_1251030                70.1    2e-12    
ref|XP_002880564.1|  predicted protein                                71.6    5e-12    
ref|WP_010932754.1|  epimerase                                        72.0    6e-12    Chlorobaculum tepidum
ref|XP_001693554.1|  predicted protein                                74.7    7e-12    Chlamydomonas reinhardtii
ref|XP_005836769.1|  hypothetical protein GUITHDRAFT_104752           73.6    8e-12    Guillardia theta CCMP2712
ref|XP_001782300.1|  predicted protein                                73.9    8e-12    
gb|KIZ02606.1|  hypothetical protein MNEG_5355                        73.9    1e-11    Monoraphidium neglectum
ref|WP_033176917.1|  hypothetical protein                             70.9    1e-11    
ref|XP_002946204.1|  hypothetical protein VOLCADRAFT_102805           73.2    2e-11    Volvox carteri f. nagariensis
ref|WP_012466155.1|  epimerase                                        70.5    2e-11    Chlorobium limicola
ref|XP_002966481.1|  hypothetical protein SELMODRAFT_439518           71.6    2e-11    
ref|XP_003063297.1|  enhancer of polycomb-like protein group          73.2    2e-11    Micromonas pusilla CCMP1545
ref|WP_028800574.1|  hypothetical protein                             70.5    2e-11    Streptomyces sp. 142MFCol3.1
ref|XP_002982038.1|  hypothetical protein SELMODRAFT_445069           71.6    3e-11    
ref|XP_004966359.1|  PREDICTED: uncharacterized protein LOC101756...  72.8    3e-11    
ref|XP_003604109.1|  hypothetical protein MTR_4g005070                72.4    4e-11    Medicago truncatula
ref|XP_010696149.1|  PREDICTED: uncharacterized protein LOC104908702  72.0    5e-11    Beta vulgaris subsp. vulgaris [field beet]
ref|WP_018535254.1|  hypothetical protein                             69.3    6e-11    Streptomyces sp. HmicA12
ref|XP_007023557.1|  High chlorophyll fluorescence phenotype 173 ...  71.6    6e-11    Theobroma cacao [chocolate]
ref|XP_004140814.1|  PREDICTED: uncharacterized protein LOC101205259  71.6    7e-11    Cucumis sativus [cucumbers]
dbj|BAJ85367.1|  predicted protein                                    71.6    7e-11    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY13439.1|  BnaA03g51570D                                        70.5    7e-11    Brassica napus [oilseed rape]
ref|WP_012502283.1|  epimerase                                        68.9    7e-11    Chlorobaculum parvum
dbj|BAJ97006.1|  predicted protein                                    70.9    8e-11    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006488626.1|  PREDICTED: uncharacterized protein LOC102624935  71.2    8e-11    
ref|XP_006425202.1|  hypothetical protein CICLE_v10028057mg           71.2    8e-11    
gb|ACN33495.1|  unknown                                               70.9    8e-11    
ref|XP_008456192.1|  PREDICTED: uncharacterized protein LOC103496202  71.2    9e-11    
ref|XP_002451510.1|  hypothetical protein SORBIDRAFT_04g003040        71.2    9e-11    
gb|KDO67099.1|  hypothetical protein CISIN_1g0075872mg                70.9    9e-11    
gb|EMT22970.1|  hypothetical protein F775_32042                       70.9    1e-10    
ref|XP_004966361.1|  PREDICTED: uncharacterized protein LOC101756...  70.9    1e-10    
gb|EEE66322.1|  hypothetical protein OsJ_22562                        70.9    1e-10    
gb|AAO72612.1|  unknown                                               70.9    1e-10    
ref|XP_005536071.1|  hypothetical protein, conserved                  70.9    1e-10    
ref|XP_004951946.1|  PREDICTED: uncharacterized protein LOC101760180  70.9    1e-10    
gb|AGT16951.1|  hypothetical protein SHCRBa_028_D11_R_320             70.9    1e-10    
gb|AGT17112.1|  hypothetical protein SHCRBa_170_G03_R_920             70.9    1e-10    
ref|XP_002438974.1|  hypothetical protein SORBIDRAFT_10g029280        70.9    1e-10    
dbj|BAJ91376.1|  predicted protein                                    70.9    1e-10    
gb|AFW69392.1|  hypothetical protein ZEAMMB73_242683                  70.9    1e-10    
ref|NP_001058511.1|  Os06g0704700                                     70.9    1e-10    
gb|EAZ02285.1|  hypothetical protein OsI_24385                        70.9    1e-10    
ref|XP_003581685.1|  PREDICTED: uncharacterized protein LOC100843331  70.9    1e-10    
ref|WP_007542726.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  68.6    1e-10    
ref|XP_003529380.1|  PREDICTED: uncharacterized protein LOC100811...  70.5    1e-10    
ref|XP_007135880.1|  hypothetical protein PHAVU_010G165800g           70.5    1e-10    
ref|WP_008326014.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  68.6    1e-10    
gb|KHN39390.1|  Hypothetical protein glysoja_018162                   70.5    1e-10    
ref|XP_003531784.1|  PREDICTED: uncharacterized protein LOC100779...  70.5    1e-10    
ref|XP_001768836.1|  predicted protein                                70.5    1e-10    
ref|XP_010278412.1|  PREDICTED: uncharacterized protein LOC104612623  70.5    1e-10    
gb|KHN38115.1|  Hypothetical protein glysoja_007157                   70.5    1e-10    
ref|XP_007199548.1|  hypothetical protein PRUPE_ppb020334mg           67.4    1e-10    
ref|XP_006307056.1|  hypothetical protein CARUB_v10008646mg           70.5    1e-10    
gb|KJB56488.1|  hypothetical protein B456_009G121600                  70.5    1e-10    
ref|XP_009410231.1|  PREDICTED: uncharacterized protein LOC103992310  70.5    1e-10    
ref|XP_004488919.1|  PREDICTED: uncharacterized protein LOC101509457  70.5    1e-10    
ref|XP_010539594.1|  PREDICTED: uncharacterized protein LOC104813622  70.5    1e-10    
gb|KHG25191.1|  putative ycf39                                        70.5    2e-10    
ref|XP_008776756.1|  PREDICTED: uncharacterized protein LOC103696815  70.5    2e-10    
gb|KJB56487.1|  hypothetical protein B456_009G121600                  70.5    2e-10    
gb|EJK46858.1|  hypothetical protein THAOC_34458                      70.1    2e-10    
ref|XP_010927120.1|  PREDICTED: uncharacterized protein LOC105049239  70.5    2e-10    
ref|XP_004303782.1|  PREDICTED: uncharacterized protein LOC101302958  70.5    2e-10    
ref|XP_011011663.1|  PREDICTED: uncharacterized protein LOC105116159  70.1    2e-10    
gb|ABK95912.1|  unknown                                               70.1    2e-10    
ref|XP_002890185.1|  oxidoreductase/ transcriptional repressor        70.1    2e-10    
ref|XP_010476791.1|  PREDICTED: uncharacterized protein LOC104755994  70.1    2e-10    
ref|XP_006851047.1|  hypothetical protein AMTR_s00025p00232880        70.1    2e-10    
ref|XP_010497996.1|  PREDICTED: uncharacterized protein LOC104775774  70.1    2e-10    
ref|XP_010459216.1|  PREDICTED: uncharacterized protein LOC104740352  70.1    2e-10    
ref|NP_173116.1|  high chlorophyll fluorescence phenotype 173 pro...  70.1    2e-10    
gb|KDP37789.1|  hypothetical protein JCGZ_06691                       70.1    2e-10    
gb|AAG09086.1|AC026237_7  Unknown Protein                             70.1    2e-10    
ref|XP_009627832.1|  PREDICTED: uncharacterized protein LOC104118315  70.1    2e-10    
gb|EYU18468.1|  hypothetical protein MIMGU_mgv1a003244mg              70.1    2e-10    
ref|XP_006364261.1|  PREDICTED: uncharacterized protein LOC102591205  70.1    2e-10    
ref|XP_004244793.1|  PREDICTED: uncharacterized protein LOC101263137  70.1    2e-10    
ref|XP_010087083.1|  hypothetical protein L484_010455                 70.1    2e-10    
ref|XP_002274181.1|  PREDICTED: uncharacterized protein LOC100256501  70.1    2e-10    
ref|XP_009773624.1|  PREDICTED: uncharacterized protein LOC104223818  70.1    2e-10    
emb|CDP19666.1|  unnamed protein product                              69.7    2e-10    
ref|XP_005854158.1|  nadh:ubiquinone oxidoreductase complex i int...  70.1    2e-10    
ref|XP_002987602.1|  hypothetical protein SELMODRAFT_183274           69.7    2e-10    
gb|EWM24901.1|  nadh:ubiquinone oxidoreductase complex i intermed...  70.1    2e-10    
ref|XP_011087899.1|  PREDICTED: uncharacterized protein LOC105169238  69.7    2e-10    
ref|XP_001419247.1|  predicted protein                                65.9    2e-10    
emb|CBI18357.3|  unnamed protein product                              69.7    3e-10    
ref|WP_009375747.1|  3-beta hydroxysteroid dehydrogenase              67.8    3e-10    
ref|NP_001183295.1|  uncharacterized protein LOC100501691             69.7    3e-10    
ref|XP_002987650.1|  hypothetical protein SELMODRAFT_158946           69.3    3e-10    
ref|WP_007976887.1|  3-beta hydroxysteroid dehydrogenase              67.4    3e-10    
ref|NP_194881.2|  NAD(P)-binding Rossmann-fold superfamily protein    68.6    3e-10    
ref|XP_002310899.2|  hypothetical protein POPTR_0007s15080g           69.3    3e-10    
ref|XP_006657318.1|  PREDICTED: LOW QUALITY PROTEIN: probable his...  69.7    3e-10    
ref|XP_001755254.1|  predicted protein                                67.4    4e-10    
ref|NP_001190881.1|  NAD(P)-binding Rossmann-fold superfamily pro...  68.6    4e-10    
emb|CDY40037.1|  BnaC05g12780D                                        69.3    4e-10    
ref|XP_005828710.1|  hypothetical protein GUITHDRAFT_112146           67.8    4e-10    
ref|XP_011031274.1|  PREDICTED: uncharacterized protein LOC105130450  68.9    4e-10    
ref|WP_012474786.1|  epimerase                                        67.0    4e-10    
emb|CDY35114.1|  BnaA06g11240D                                        68.9    4e-10    
dbj|BAJ33598.1|  unnamed protein product                              68.9    4e-10    
gb|KFK43876.1|  hypothetical protein AALP_AA1G185500                  68.9    4e-10    
ref|XP_009149110.1|  PREDICTED: uncharacterized protein LOC103872461  68.9    4e-10    
ref|XP_005853902.1|  hypothetical protein NGA_0463500                 68.6    5e-10    
emb|CDY68555.1|  BnaCnng59510D                                        68.2    5e-10    
ref|XP_009344999.1|  PREDICTED: uncharacterized protein LOC103936847  68.6    5e-10    
ref|XP_006416787.1|  hypothetical protein EUTSA_v10007626mg           68.6    5e-10    
ref|XP_009138019.1|  PREDICTED: protein TIC 62, chloroplastic         67.8    5e-10    
gb|EWM22245.1|  NAD(P)-binding domain protein                         68.6    6e-10    
ref|XP_002513289.1|  dihydroflavonal-4-reductase, putative            68.6    6e-10    
ref|XP_008245062.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.6    6e-10    
ref|XP_008380704.1|  PREDICTED: uncharacterized protein LOC103443604  68.6    6e-10    
ref|XP_010063699.1|  PREDICTED: uncharacterized protein LOC104450722  68.6    6e-10    
gb|KCW70946.1|  hypothetical protein EUGRSUZ_F04061                   68.6    6e-10    
ref|XP_007215432.1|  hypothetical protein PRUPE_ppa006154mg           68.2    7e-10    
ref|WP_037859254.1|  hypothetical protein                             66.2    7e-10    
ref|WP_018568049.1|  MULTISPECIES: hypothetical protein               66.2    7e-10    
ref|XP_003080990.1|  Predicted dehydrogenase (ISS)                    67.0    8e-10    
gb|ABR17993.1|  unknown                                               68.2    8e-10    
emb|CEG01640.1|  NAD(P)-binding domain                                67.4    8e-10    
emb|CBJ33213.1|  conserved unknown protein                            67.0    1e-09    
ref|XP_008787591.1|  PREDICTED: uncharacterized protein At2g37660...  67.4    1e-09    
ref|WP_010872727.1|  epimerase                                        65.5    1e-09    
ref|XP_006412584.1|  hypothetical protein EUTSA_v10025684mg           67.0    1e-09    
ref|WP_006366806.1|  epimerase                                        65.9    1e-09    
ref|XP_005845666.1|  hypothetical protein CHLNCDRAFT_53733            65.9    1e-09    
dbj|BAD10524.1|  putative UOS1                                        67.8    1e-09    
ref|WP_028949158.1|  epimerase                                        65.5    1e-09    
gb|EAZ21675.1|  hypothetical protein OsJ_05306                        67.4    1e-09    
ref|XP_002506310.1|  predicted protein                                67.4    1e-09    
ref|WP_005553412.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  65.5    2e-09    
ref|WP_008414848.1|  3-beta hydroxysteroid dehydrogenase              64.7    2e-09    
ref|XP_008363430.1|  PREDICTED: uncharacterized protein At2g37660...  65.1    2e-09    
ref|XP_007508712.1|  predicted protein                                66.6    3e-09    
ref|WP_013440495.1|  3-beta hydroxysteroid dehydrogenase              65.1    3e-09    
ref|WP_006053612.1|  nmra-like family protein                         65.1    3e-09    
ref|XP_005714921.1|  unnamed protein product                          66.2    3e-09    
ref|XP_002869322.1|  catalytic/ coenzyme binding protein              65.9    3e-09    
ref|WP_017712237.1|  hypothetical protein                             64.3    3e-09    
ref|XP_010447507.1|  PREDICTED: uncharacterized protein At5g02240...  65.9    3e-09    
ref|XP_010432852.1|  PREDICTED: uncharacterized protein At5g02240...  65.9    3e-09    
ref|XP_006284070.1|  hypothetical protein CARUB_v10005196mg           65.5    4e-09    
gb|ADE76005.1|  unknown                                               64.3    4e-09    
ref|XP_010438027.1|  PREDICTED: uncharacterized protein At5g02240...  65.5    4e-09    
gb|KFK29734.1|  hypothetical protein AALP_AA7G171700                  65.5    4e-09    
ref|XP_009337040.1|  PREDICTED: protein TIC 62, chloroplastic-like    65.1    5e-09    
ref|WP_036496666.1|  hypothetical protein                             62.4    5e-09    
ref|XP_009342603.1|  PREDICTED: protein TIC 62, chloroplastic-like    65.1    6e-09    
ref|XP_010045043.1|  PREDICTED: protein TIC 62, chloroplastic iso...  64.7    6e-09    
gb|EYU46213.1|  hypothetical protein MIMGU_mgv1a009560mg              64.7    7e-09    
ref|WP_011362043.1|  epimerase                                        63.5    7e-09    
ref|WP_035402602.1|  NAD-dependent epimerase                          63.5    7e-09    
ref|XP_008225464.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  62.8    7e-09    
gb|EWM25690.1|  nad-dependent epimerase dehydratase                   64.7    8e-09    
ref|WP_030730416.1|  hypothetical protein                             61.2    9e-09    
ref|XP_010045040.1|  PREDICTED: protein TIC 62, chloroplastic iso...  64.7    9e-09    
ref|WP_030605952.1|  hypothetical protein                             63.9    9e-09    
ref|WP_013861827.1|  epimerase                                        62.8    9e-09    
ref|WP_027403423.1|  epimerase                                        63.5    1e-08    
ref|WP_014781007.1|  NAD dependent epimerase/dehydratase              62.4    1e-08    
ref|XP_005704007.1|  hypothetical protein Gasu_49370                  63.5    1e-08    
ref|XP_010045042.1|  PREDICTED: uncharacterized protein At2g34460...  64.3    1e-08    
ref|XP_002508414.1|  hypothetical protein MICPUN_108991               63.9    1e-08    
ref|WP_039200621.1|  epimerase                                        63.5    1e-08    
ref|XP_007212665.1|  hypothetical protein PRUPE_ppa018331mg           63.9    1e-08    
ref|WP_006181168.1|  3-beta hydroxysteroid dehydrogenase              62.8    2e-08    
ref|XP_010921929.1|  PREDICTED: uncharacterized protein At2g37660...  63.5    2e-08    
ref|XP_005650305.1|  NAD(P)-binding protein                           63.9    2e-08    
ref|XP_007015192.1|  NAD(P)-binding Rossmann-fold superfamily pro...  63.2    2e-08    
ref|WP_017742815.1|  epimerase                                        62.4    3e-08    
emb|CEG00464.1|  NADH:ubiquinone oxidoreductase intermediate-asso...  63.5    3e-08    
gb|ACN29227.1|  unknown                                               62.4    3e-08    
ref|XP_003083745.1|  putative UOS1 (ISS)                              63.5    3e-08    
ref|XP_010666597.1|  PREDICTED: uncharacterized protein At2g34460...  62.8    3e-08    
ref|WP_011745132.1|  epimerase                                        62.0    3e-08    
ref|XP_007015191.1|  NAD(P)-binding Rossmann-fold superfamily pro...  62.8    3e-08    
gb|KHG20046.1|  hypothetical protein F383_25097                       59.7    3e-08    
ref|XP_002185853.1|  predicted protein                                63.2    3e-08    
ref|WP_012936311.1|  NAD-dependent dehydratase                        61.2    4e-08    
ref|WP_026933148.1|  NAD-dependent dehydratase                        61.2    4e-08    
ref|XP_007515782.1|  predicted protein                                62.4    4e-08    
gb|EJK67043.1|  hypothetical protein THAOC_11969                      61.2    4e-08    
ref|XP_009596108.1|  PREDICTED: uncharacterized protein At2g34460...  62.0    5e-08    
emb|CAB45912.1|  putative protein                                     62.4    5e-08    
gb|KIE08161.1|  epimerase                                             62.0    5e-08    
ref|XP_004293566.2|  PREDICTED: uncharacterized protein At2g34460...  62.4    5e-08    
ref|XP_002445636.1|  hypothetical protein SORBIDRAFT_07g023080        62.0    5e-08    
ref|XP_009759028.1|  PREDICTED: uncharacterized protein At2g34460...  62.0    5e-08    
ref|XP_002968769.1|  hypothetical protein SELMODRAFT_170290           61.2    5e-08    
ref|XP_008225459.1|  PREDICTED: uncharacterized protein At2g34460...  62.0    6e-08    
tpg|DAA48447.1|  TPA: 3-beta hydroxysteroid dehydrogenase/isomerase   61.6    6e-08    
ref|NP_001151520.1|  3-beta hydroxysteroid dehydrogenase/isomerase    61.6    6e-08    
ref|WP_006649444.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  61.2    6e-08    
ref|WP_008426499.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  61.2    6e-08    
gb|KJB35730.1|  hypothetical protein B456_006G125600                  62.0    7e-08    
ref|XP_001693527.1|  predicted protein                                60.8    7e-08    
ref|WP_044137007.1|  hypothetical protein                             61.2    8e-08    
gb|ABG53559.1|  Male sterility-like                                   61.2    8e-08    
ref|XP_001421664.1|  predicted protein                                62.0    8e-08    
gb|KJB34972.1|  hypothetical protein B456_006G093300                  58.5    9e-08    
ref|XP_007211570.1|  hypothetical protein PRUPE_ppa008365mg           61.6    9e-08    
ref|XP_004293153.1|  PREDICTED: uncharacterized protein At5g02240     61.6    9e-08    
ref|XP_006362745.1|  PREDICTED: uncharacterized protein At2g37660...  61.6    9e-08    
ref|XP_002992894.1|  hypothetical protein SELMODRAFT_272296           60.8    9e-08    
ref|XP_008227247.1|  PREDICTED: uncharacterized protein At5g02240...  61.6    9e-08    
ref|WP_011357820.1|  epimerase                                        60.5    9e-08    
ref|WP_024960777.1|  epimerase                                        60.8    1e-07    
ref|XP_004982642.1|  PREDICTED: uncharacterized protein At2g34460...  61.2    1e-07    
emb|CAN70158.1|  hypothetical protein VITISV_030015                   60.5    1e-07    
ref|WP_015320312.1|  NmrA family protein                              60.5    1e-07    
gb|EJK64673.1|  hypothetical protein THAOC_14571                      61.2    1e-07    
ref|WP_008591040.1|  NAD-dependent epimerase/dehydratase              60.1    1e-07    
ref|XP_004228880.2|  PREDICTED: uncharacterized protein At2g37660...  61.2    1e-07    
ref|WP_040939321.1|  oxidoreductase                                   60.5    1e-07    
ref|XP_002276135.1|  PREDICTED: uncharacterized protein At2g34460...  61.2    1e-07    
ref|XP_010111004.1|  DNA replication licensing factor MCM3-like p...  62.0    1e-07    
emb|CBN74033.1|  conserved unknown protein                            61.2    1e-07    
ref|XP_011080386.1|  PREDICTED: protein TIC 62, chloroplastic         61.2    1e-07    
ref|WP_006194223.1|  epimerase                                        60.8    1e-07    
gb|KDO78135.1|  hypothetical protein CISIN_1g021838mg                 60.8    1e-07    
ref|WP_038017391.1|  epimerase                                        60.5    1e-07    
ref|WP_027846858.1|  epimerase                                        60.5    1e-07    
ref|WP_011056872.1|  epimerase                                        60.1    1e-07    
ref|XP_006467493.1|  PREDICTED: uncharacterized protein At2g34460...  60.8    1e-07    
gb|EDX84458.1|  NmrA-like family                                      60.8    1e-07    
ref|WP_017318915.1|  epimerase                                        60.5    1e-07    
ref|WP_017716921.1|  hypothetical protein                             60.5    1e-07    
gb|ADE75995.1|  unknown                                               60.1    1e-07    
gb|KDO78136.1|  hypothetical protein CISIN_1g021838mg                 60.8    2e-07    
gb|ADE77194.1|  unknown                                               60.1    2e-07    
ref|XP_009774268.1|  PREDICTED: uncharacterized protein At2g37660...  60.8    2e-07    
ref|WP_024124178.1|  NAD-dependent epimerase/dehydratase family p...  59.7    2e-07    
ref|XP_006843414.1|  hypothetical protein AMTR_s00053p00136190        58.9    2e-07    
ref|XP_006365558.1|  PREDICTED: uncharacterized protein At2g34460...  60.5    2e-07    
ref|XP_004233107.1|  PREDICTED: uncharacterized protein At2g34460...  60.5    2e-07    
ref|WP_034893404.1|  NAD-dependent dehydratase                        59.3    2e-07    
ref|XP_006449666.1|  hypothetical protein CICLE_v10016368mg           60.1    2e-07    
ref|XP_005837703.1|  hypothetical protein GUITHDRAFT_103314           60.5    2e-07    
ref|WP_040944459.1|  oxidoreductase                                   59.7    2e-07    
emb|CBI30853.3|  unnamed protein product                              60.5    2e-07    
ref|XP_009360869.1|  PREDICTED: uncharacterized protein At2g34460...  60.5    2e-07    
ref|WP_006989306.1|  NAD dependent epimerase/dehydratase              59.3    2e-07    



>emb|CAN69940.1| hypothetical protein VITISV_006128 [Vitis vinifera]
Length=360

 Score =   325 bits (833),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  188  FQLPVSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  247

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+PY IVRPCALTEEPAGADLIFDQGDNITGK+SREE+ARIC+AALESPYAC
Sbjct  248  GEDLIRESGVPYAIVRPCALTEEPAGADLIFDQGDNITGKVSREEIARICIAALESPYAC  307

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +KTFEVKSVIPFSEP+TVDPENPPPEKDY++YFKTLK+GITGKE LE +PV
Sbjct  308  BKTFEVKSVIPFSEPFTVDPENPPPEKDYNLYFKTLKDGITGKEMLEQSPV  358



>ref|XP_011101432.1| PREDICTED: uncharacterized protein LOC105179488 isoform X9 [Sesamum 
indicum]
Length=478

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  306  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  365

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  366  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  425

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  426  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  476



>gb|AFK37074.1| unknown [Lotus japonicus]
Length=192

 Score =   315 bits (807),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELG ILTFKLK
Sbjct  20   FELPVSSIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGSILTFKLK  79

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIF+QGDNITGKISREE+AR+CVAALESPYAC
Sbjct  80   GEDLIRESGIPYAIVRPCALTEEPAGADLIFEQGDNITGKISREEIARLCVAALESPYAC  139

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSV+PFSEP+T+DP NPPPEKDY+VYFK LKEGITGKE+L+  PV
Sbjct  140  DKTFEVKSVVPFSEPFTLDPANPPPEKDYNVYFKDLKEGITGKEALQQNPV  190



>ref|XP_011101430.1| PREDICTED: uncharacterized protein LOC105179488 isoform X7 [Sesamum 
indicum]
Length=553

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  381  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  440

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  441  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  500

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  501  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  551



>ref|XP_010316842.1| PREDICTED: uncharacterized protein LOC101268540 isoform X3 [Solanum 
lycopersicum]
Length=477

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAY+KDPITPRFVHV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  305  FELPVSCIRAYLKDPITPRFVHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  364

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  365  GEDEIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  424

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY+ +FKTLK+GITGKESLE TP++
Sbjct  425  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNEFFKTLKDGITGKESLEKTPIS  476



>ref|XP_011101428.1| PREDICTED: uncharacterized protein LOC105179488 isoform X5 [Sesamum 
indicum]
Length=564

 Score =   326 bits (836),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  392  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  451

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  452  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  511

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  512  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  562



>ref|XP_011101426.1| PREDICTED: uncharacterized protein LOC105179488 isoform X3 [Sesamum 
indicum]
Length=568

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  396  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  455

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  456  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  515

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  516  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  566



>emb|CDO96854.1| unnamed protein product [Coffea canephora]
Length=192

 Score =   313 bits (802),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S I+ ++K+P+TPRFVHV SAGV RPERPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  20   FQLPVSSIKTFMKEPVTPRFVHVSSAGVARPERPGLDLSKQPPAVRLNKELGFILTFKLK  79

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+TIVRPCALTEEPAGADLIFDQGDNITGKISREE+ARIC+AALESPYAC
Sbjct  80   GEDLIRESGIPHTIVRPCALTEEPAGADLIFDQGDNITGKISREEIARICIAALESPYAC  139

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEPYTVDP NPPPEKDY+ YFK+LK+GITGKESLE +P  
Sbjct  140  DKTFEVKSVIPFSEPYTVDPANPPPEKDYNQYFKSLKDGITGKESLEKSPAA  191



>ref|XP_010316841.1| PREDICTED: uncharacterized protein LOC101268540 isoform X2 [Solanum 
lycopersicum]
Length=553

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAY+KDPITPRFVHV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  381  FELPVSCIRAYLKDPITPRFVHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  440

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  441  GEDEIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  500

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY+ +FKTLK+GITGKESLE TP++
Sbjct  501  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNEFFKTLKDGITGKESLEKTPIS  552



>ref|XP_011101427.1| PREDICTED: uncharacterized protein LOC105179488 isoform X4 [Sesamum 
indicum]
Length=565

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  393  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  452

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  453  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  512

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  513  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  563



>ref|XP_011101431.1| PREDICTED: uncharacterized protein LOC105179488 isoform X8 [Sesamum 
indicum]
Length=550

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  378  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  437

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  438  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  497

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  498  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  548



>ref|XP_011101429.1| PREDICTED: uncharacterized protein LOC105179488 isoform X6 [Sesamum 
indicum]
Length=554

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  382  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  441

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  442  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  501

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  502  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  552



>ref|XP_006358109.1| PREDICTED: uncharacterized protein LOC102598210 isoform X5 [Solanum 
tuberosum]
Length=554

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AY+KDPITPRFVHV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  382  FELPVSCIQAYLKDPITPRFVHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  441

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  442  GEDEIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  501

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY+ YFKTLK+GITGKESLE TP++
Sbjct  502  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNEYFKTLKDGITGKESLEKTPIS  553



>ref|XP_008443516.1| PREDICTED: uncharacterized protein LOC103487085 [Cucumis melo]
Length=597

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  425  FQLPLSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDFILTFKLK  484

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGK+SREE+ARIC+AALESPYAC
Sbjct  485  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKVSREEIARICIAALESPYAC  544

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY+VYFKTLK+GITGKE LE TP
Sbjct  545  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNVYFKTLKDGITGKELLEQTP  594



>ref|XP_002265546.1| PREDICTED: uncharacterized protein LOC100241189 [Vitis vinifera]
 emb|CBI30719.3| unnamed protein product [Vitis vinifera]
Length=605

 Score =   325 bits (834),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  433  FQLPVSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  492

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+PY IVRPCALTEEPAGADLIFDQGDNITGK+SREE+ARIC+AALESPYAC
Sbjct  493  GEDLIRESGVPYAIVRPCALTEEPAGADLIFDQGDNITGKVSREEIARICIAALESPYAC  552

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY++YFKTLK+GITGKE LE +PV
Sbjct  553  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNLYFKTLKDGITGKEMLEQSPV  603



>ref|XP_011101425.1| PREDICTED: uncharacterized protein LOC105179488 isoform X2 [Sesamum 
indicum]
Length=583

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  411  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  470

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  471  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  530

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  531  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  581



>ref|XP_009783190.1| PREDICTED: uncharacterized protein LOC104231828 isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAY+KDPITPRF+HV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  390  FELPVSCIRAYLKDPITPRFIHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  449

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  450  GEDEIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  509

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY+ YFKTLK+GITGKESLE TP+
Sbjct  510  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNEYFKTLKDGITGKESLEKTPI  560



>gb|EYU28112.1| hypothetical protein MIMGU_mgv1a0046272mg, partial [Erythranthe 
guttata]
 gb|EYU28113.1| hypothetical protein MIMGU_mgv1a0046272mg, partial [Erythranthe 
guttata]
Length=259

 Score =   313 bits (803),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 4/175 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+P+TPRFVHVGSAGVTRP+RPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  85   FQLPVSAIRAYLKEPVTPRFVHVGSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTYKLK  144

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTI+RPCALTEEPAGADLI +QGDNITGKISR+EVAR+C+AALESPYAC
Sbjct  145  GEDLIRESGIPYTIIRPCALTEEPAGADLIVEQGDNITGKISRDEVARMCIAALESPYAC  204

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLE----PTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY+VYF+TLK+GITGKESLE    P PV
Sbjct  205  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNVYFQTLKDGITGKESLEQSAPPVPV  259



>ref|XP_004233027.1| PREDICTED: uncharacterized protein LOC101268540 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010316840.1| PREDICTED: uncharacterized protein LOC101268540 isoform X1 [Solanum 
lycopersicum]
Length=592

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAY+KDPITPRFVHV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  420  FELPVSCIRAYLKDPITPRFVHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  479

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  480  GEDEIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  539

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY+ +FKTLK+GITGKESLE TP++
Sbjct  540  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNEFFKTLKDGITGKESLEKTPIS  591



>ref|XP_011101423.1| PREDICTED: uncharacterized protein LOC105179488 isoform X1 [Sesamum 
indicum]
Length=588

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 167/171 (98%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAY+K+PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLN+ELGFILT+KLK
Sbjct  416  FQLPISTIRAYMKEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNRELGFILTYKLK  475

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAA+ESPYAC
Sbjct  476  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAIESPYAC  535

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY++YF+TLKEGITGKESL  TPV
Sbjct  536  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNLYFQTLKEGITGKESLGQTPV  586



>ref|XP_006358105.1| PREDICTED: uncharacterized protein LOC102598210 isoform X1 [Solanum 
tuberosum]
 ref|XP_006358106.1| PREDICTED: uncharacterized protein LOC102598210 isoform X2 [Solanum 
tuberosum]
 ref|XP_006358107.1| PREDICTED: uncharacterized protein LOC102598210 isoform X3 [Solanum 
tuberosum]
 ref|XP_006358108.1| PREDICTED: uncharacterized protein LOC102598210 isoform X4 [Solanum 
tuberosum]
Length=593

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 167/172 (97%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AY+KDPITPRFVHV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  421  FELPVSCIQAYLKDPITPRFVHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  480

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  481  GEDEIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  540

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEPYTVDPENPPPEKDY+ YFKTLK+GITGKESLE TP++
Sbjct  541  DKTFEVKSVIPFSEPYTVDPENPPPEKDYNEYFKTLKDGITGKESLEKTPIS  592



>gb|KDP21131.1| hypothetical protein JCGZ_21602 [Jatropha curcas]
Length=478

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S I+A+IKDPITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  306  FQLPVSSIKAFIKDPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTFKLK  365

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+PY IVRPCALTEEPAGADLIFDQGDNITGK+SREE+ARICVAALESPYAC
Sbjct  366  GEDLIRESGMPYAIVRPCALTEEPAGADLIFDQGDNITGKVSREEIARICVAALESPYAC  425

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVDP+NPPPEKDY+ YFKTLK+GITGKE LE +PV
Sbjct  426  DKTFEVKSVIPFSEPFTVDPQNPPPEKDYNEYFKTLKDGITGKEYLERSPV  476



>ref|XP_010057127.1| PREDICTED: uncharacterized protein LOC104445030 isoform X2 [Eucalyptus 
grandis]
 gb|KCW74151.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
Length=435

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAYIKDP+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  263  FQLPISNIRAYIKDPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTFKLK  322

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIP+ IVRPCALTEEPAGADLIFDQGDNITGK+SREE+ARICVAALESPYAC
Sbjct  323  GEDLIRDSGIPFAIVRPCALTEEPAGADLIFDQGDNITGKVSREEIARICVAALESPYAC  382

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY  YFK LK+GITGKE L+ +PV 
Sbjct  383  DKTFEVKSVVPFSEPFTVDPENPPPEKDYSEYFKNLKDGITGKEFLQKSPVA  434



>ref|XP_009783189.1| PREDICTED: uncharacterized protein LOC104231828 isoform X1 [Nicotiana 
sylvestris]
Length=601

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAY+KDPITPRF+HV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  429  FELPVSCIRAYLKDPITPRFIHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  488

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  489  GEDEIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  548

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY+ YFKTLK+GITGKESLE TP+
Sbjct  549  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNEYFKTLKDGITGKESLEKTPI  599



>ref|XP_004147385.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101203416 
[Cucumis sativus]
Length=572

 Score =   321 bits (823),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  400  FQLPLSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDFILTFKLK  459

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGK+SREE+ARIC+AALESPYAC
Sbjct  460  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKVSREEIARICIAALESPYAC  519

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY++YF+ LK+GITGKE LE TP
Sbjct  520  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNIYFENLKDGITGKELLEQTP  569



>ref|XP_004161197.1| PREDICTED: uncharacterized LOC101203416 [Cucumis sativus]
Length=597

 Score =   321 bits (822),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  425  FQLPLSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDFILTFKLK  484

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGK+SREE+ARIC+AALESPYAC
Sbjct  485  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKVSREEIARICIAALESPYAC  544

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY++YF+ LK+GITGKE LE TP
Sbjct  545  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNIYFENLKDGITGKELLEQTP  594



>ref|XP_009631270.1| PREDICTED: uncharacterized protein LOC104121071 isoform X2 [Nicotiana 
tomentosiformis]
Length=563

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAY+KD ITPRF+HV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  391  FELPVSCIRAYLKDTITPRFIHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  450

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTI+RPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  451  GEDEIRESGIPYTIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  510

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY+ YFKTLK+GITGKESLE TP+
Sbjct  511  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNEYFKTLKDGITGKESLEKTPI  561



>ref|XP_004504281.1| PREDICTED: uncharacterized protein LOC101492899 isoform X2 [Cicer 
arietinum]
Length=478

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILTFKLK
Sbjct  306  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTFKLK  365

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKI+REE+AR+CVAALESP AC
Sbjct  366  GEDLIRESGIPYVIVRPCALTEEPAGADLIFDQGDNITGKIAREEIARMCVAALESPDAC  425

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSV+PFSEP+TVDPENPPPEKDYD+YFK LKEGITGKE+L+  P+
Sbjct  426  DKTFEVKSVVPFSEPFTVDPENPPPEKDYDIYFKNLKEGITGKEALQQNPL  476



>ref|XP_003629827.1| UOS1 [Medicago truncatula]
 gb|AET04303.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=478

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AYI DPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILT+KLK
Sbjct  306  FELPVSSIKAYINDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTYKLK  365

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREEVAR+CVAALESPYAC
Sbjct  366  GEDLIRESGIPYVIVRPCALTEEPAGADLIFDQGDNITGKISREEVARMCVAALESPYAC  425

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLE--PTPV  204
            DKTFEVKSVIPFSEP+TVDPENPP EKDYD+YFK LKEGITGKE+L+  PTPV
Sbjct  426  DKTFEVKSVIPFSEPFTVDPENPPSEKDYDIYFKNLKEGITGKEALQQSPTPV  478



>ref|XP_007025316.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY27938.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=603

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNK+LGF+LTFKLK
Sbjct  431  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKDLGFVLTFKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNI GKISREE+ARIC+AALESPYAC
Sbjct  491  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNIMGKISREEIARICIAALESPYAC  550

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY++YFKTLK+G TGKESLE + + 
Sbjct  551  DKTFEVKSVVPFSEPFTVDPENPPPEKDYNIYFKTLKDGFTGKESLEQSAIA  602



>ref|XP_007025318.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY27940.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=604

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNK+LGF+LTFKLK
Sbjct  432  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKDLGFVLTFKLK  491

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNI GKISREE+ARIC+AALESPYAC
Sbjct  492  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNIMGKISREEIARICIAALESPYAC  551

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY++YFKTLK+G TGKESLE + + 
Sbjct  552  DKTFEVKSVVPFSEPFTVDPENPPPEKDYNIYFKTLKDGFTGKESLEQSAIA  603



>ref|XP_007159482.1| hypothetical protein PHAVU_002G241100g [Phaseolus vulgaris]
 gb|ESW31476.1| hypothetical protein PHAVU_002G241100g [Phaseolus vulgaris]
Length=600

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  428  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDFILTFKLK  487

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+AR+CVAAL+SPYAC
Sbjct  488  GEDLLRESGIPYLIVRPCALTEEPAGADLIFDQGDNITGKISREEIARMCVAALDSPYAC  547

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEP+TVDP NPPPEKDYD+YFK LKEGITGKE+L+  PV+
Sbjct  548  DKTFEVKSVIPFSEPFTVDPANPPPEKDYDIYFKNLKEGITGKEALQQDPVS  599



>ref|XP_009351587.1| PREDICTED: uncharacterized protein LOC103943107 [Pyrus x bretschneideri]
Length=603

 Score =   320 bits (819),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAY+K+PITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  431  FQLPLSSIRAYLKEPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA+ICVAALESPYA 
Sbjct  491  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVAQICVAALESPYAT  550

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKSVIPFS+P+TVDPENPPPEKDYDVYFKTLK+GITGKE LE  PV
Sbjct  551  GKTFEVKSVIPFSQPFTVDPENPPPEKDYDVYFKTLKDGITGKEILEQDPV  601



>ref|XP_008371503.1| PREDICTED: uncharacterized protein LOC103434908 [Malus domestica]
Length=603

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAY+K+PITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  431  FQLPLSSIRAYLKEPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA+ICVAALESPYA 
Sbjct  491  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVAQICVAALESPYAT  550

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKSVIPFS+P+TVDPENPPPEKDYDVYFKTLK+GITGKE LE  PV
Sbjct  551  GKTFEVKSVIPFSQPFTVDPENPPPEKDYDVYFKTLKDGITGKEILEQDPV  601



>ref|XP_010242113.1| PREDICTED: uncharacterized protein LOC104586544 [Nelumbo nucifera]
Length=602

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYI+D ITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  430  FELPVSSIRAYIQDRITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTFKLK  489

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTI+RPCALTEEPAGADLIFDQGDNITGKISREEVARIC+AALESPYAC
Sbjct  490  GEDLIRESGIPYTIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICIAALESPYAC  549

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSV+PFSEP+TVDPENPP EKDY++YFK LK+GITGKE+LE +P+
Sbjct  550  DKTFEVKSVVPFSEPFTVDPENPPQEKDYNIYFKNLKDGITGKEALEQSPL  600



>ref|XP_009631263.1| PREDICTED: uncharacterized protein LOC104121071 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631268.1| PREDICTED: uncharacterized protein LOC104121071 isoform X1 [Nicotiana 
tomentosiformis]
Length=602

 Score =   319 bits (817),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAY+KD ITPRF+HV SAGVTRPERPG+DLSKQPPAVRLNKELGFILTFKLK
Sbjct  430  FELPVSCIRAYLKDTITPRFIHVSSAGVTRPERPGIDLSKQPPAVRLNKELGFILTFKLK  489

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTI+RPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL+SPYAC
Sbjct  490  GEDEIRESGIPYTIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALKSPYAC  549

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVDPENPPPEKDY+ YFKTLK+GITGKESLE TP+
Sbjct  550  DKTFEVKSVIPFSEPFTVDPENPPPEKDYNEYFKTLKDGITGKESLEKTPI  600



>gb|AAM19355.1|AF369888_1 UOS1 [Pisum sativum]
Length=620

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AYI DPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL +ILTFKLK
Sbjct  448  FELPVSSIKAYINDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDYILTFKLK  507

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA++CVAAL+SPYAC
Sbjct  508  GEDSIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVAQMCVAALQSPYAC  567

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVDPENPPPEKDYD+YFK+LKEGITGKE+L+  P+
Sbjct  568  DKTFEVKSVIPFSEPFTVDPENPPPEKDYDIYFKSLKEGITGKEALQQNPI  618



>gb|KJB66859.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
 gb|KJB66860.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
Length=478

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS I+AYIKDPITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNKEL F+LTFKLK
Sbjct  306  FELPLSTIKAYIKDPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKELDFVLTFKLK  365

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREE+A IC+AALESPYAC
Sbjct  366  GEDLIRESGIPYTIVRPCALTEEPAGADLVFDQGDNITGKISREEIALICIAALESPYAC  425

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY++YF+TLK+GITGKESL  + +
Sbjct  426  DKTFEVKSVVPFSEPFTVDPENPPPEKDYNIYFQTLKDGITGKESLGQSAI  476



>gb|KHN48016.1| hypothetical protein glysoja_015486 [Glycine soja]
Length=518

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRPERPG+DLSKQPPAVRLNKEL +ILTFKLK
Sbjct  346  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPERPGIDLSKQPPAVRLNKELDYILTFKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGA+LIFDQGDNITGKISREE+A +CVAAL+SPYAC
Sbjct  406  GEDLLRESGIPYAIVRPCALTEEPAGANLIFDQGDNITGKISREEIALMCVAALDSPYAC  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEP+TVDP NPPPEKDYDVYFK LKEGITGKE+L+  PV+
Sbjct  466  DKTFEVKSVIPFSEPFTVDPTNPPPEKDYDVYFKNLKEGITGKEALQQNPVS  517



>ref|XP_010057126.1| PREDICTED: uncharacterized protein LOC104445030 isoform X1 [Eucalyptus 
grandis]
 gb|KCW74149.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
 gb|KCW74150.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
Length=590

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAYIKDP+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  418  FQLPISNIRAYIKDPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTFKLK  477

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIP+ IVRPCALTEEPAGADLIFDQGDNITGK+SREE+ARICVAALESPYAC
Sbjct  478  GEDLIRDSGIPFAIVRPCALTEEPAGADLIFDQGDNITGKVSREEIARICVAALESPYAC  537

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY  YFK LK+GITGKE L+ +PV 
Sbjct  538  DKTFEVKSVVPFSEPFTVDPENPPPEKDYSEYFKNLKDGITGKEFLQKSPVA  589



>ref|XP_006384071.1| hypothetical protein POPTR_0004s05960g [Populus trichocarpa]
 gb|ERP61868.1| hypothetical protein POPTR_0004s05960g [Populus trichocarpa]
Length=347

 Score =   309 bits (792),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IR +IKDP+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  175  FQLPVSSIRTFIKDPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  234

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+ARIC+AALESPYA 
Sbjct  235  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKISREEIARICIAALESPYAL  294

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVD ENPP EKDYD+YFK LK+GITGKE LE +PV
Sbjct  295  DKTFEVKSVIPFSEPFTVDLENPPREKDYDIYFKDLKDGITGKELLEQSPV  345



>ref|XP_008790013.1| PREDICTED: uncharacterized protein LOC103707347 isoform X1 [Phoenix 
dactylifera]
Length=603

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYI +PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILT+KLK
Sbjct  431  FQLPLSSIRAYINEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTYKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGKISREEVARIC+AALESP+AC
Sbjct  491  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICIAALESPHAC  550

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLE  216
             KTFEVKS +PFSEPYTVDP NPPPEKDYDVYFKTLK+GITGKE+LE
Sbjct  551  GKTFEVKSTVPFSEPYTVDPSNPPPEKDYDVYFKTLKDGITGKEALE  597



>ref|XP_003629826.1| UOS1 [Medicago truncatula]
Length=589

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AYI DPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILT+KLK
Sbjct  417  FELPVSSIKAYINDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTYKLK  476

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREEVAR+CVAALESPYAC
Sbjct  477  GEDLIRESGIPYVIVRPCALTEEPAGADLIFDQGDNITGKISREEVARMCVAALESPYAC  536

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLE--PTPV  204
            DKTFEVKSVIPFSEP+TVDPENPP EKDYD+YFK LKEGITGKE+L+  PTPV
Sbjct  537  DKTFEVKSVIPFSEPFTVDPENPPSEKDYDIYFKNLKEGITGKEALQQSPTPV  589



>ref|XP_004504280.1| PREDICTED: uncharacterized protein LOC101492899 isoform X1 [Cicer 
arietinum]
Length=598

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILTFKLK
Sbjct  426  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTFKLK  485

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKI+REE+AR+CVAALESP AC
Sbjct  486  GEDLIRESGIPYVIVRPCALTEEPAGADLIFDQGDNITGKIAREEIARMCVAALESPDAC  545

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSV+PFSEP+TVDPENPPPEKDYD+YFK LKEGITGKE+L+  P+
Sbjct  546  DKTFEVKSVVPFSEPFTVDPENPPPEKDYDIYFKNLKEGITGKEALQQNPL  596



>emb|CDX99423.1| BnaC01g11290D [Brassica napus]
Length=362

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDL+KQPPAVRLNKEL FILT+KLK
Sbjct  162  FELPLSTIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLTKQPPAVRLNKELDFILTYKLK  221

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGK+SR+EVARIC+AALESP+A 
Sbjct  222  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKVSRDEVARICIAALESPHAL  281

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE + V+
Sbjct  282  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQSTVS  333



>ref|XP_006449545.1| hypothetical protein CICLE_v10018335mg, partial [Citrus clementina]
 gb|ESR62785.1| hypothetical protein CICLE_v10018335mg, partial [Citrus clementina]
Length=662

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S I++YIKDP+TPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  490  FQLPVSSIQSYIKDPVTPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  549

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVAR+CVAALESP+A 
Sbjct  550  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARVCVAALESPFAL  609

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKS IPFSE +TVDPENPP EKDY++YFK LK+GITGKESLE +PV
Sbjct  610  DKTFEVKSTIPFSESFTVDPENPPQEKDYNIYFKGLKDGITGKESLEQSPV  660



>ref|XP_006467612.1| PREDICTED: uncharacterized protein LOC102627312 [Citrus sinensis]
 gb|KDO77910.1| hypothetical protein CISIN_1g047192mg [Citrus sinensis]
Length=600

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S I++YIKDP+TPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  428  FQLPVSSIQSYIKDPVTPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  487

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESP+A 
Sbjct  488  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPFAL  547

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKS IPFSE +TVDPENPP EKDY++YFK LK+GITGKESLE +PV
Sbjct  548  DKTFEVKSTIPFSESFTVDPENPPQEKDYNIYFKGLKDGITGKESLEQSPV  598



>gb|AET04302.2| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=597

 Score =   315 bits (808),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AYI DPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILT+KLK
Sbjct  425  FELPVSSIKAYINDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTYKLK  484

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREEVAR+CVAALESPYAC
Sbjct  485  GEDLIRESGIPYVIVRPCALTEEPAGADLIFDQGDNITGKISREEVARMCVAALESPYAC  544

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLE--PTPV  204
            DKTFEVKSVIPFSEP+TVDPENPP EKDYD+YFK LKEGITGKE+L+  PTPV
Sbjct  545  DKTFEVKSVIPFSEPFTVDPENPPSEKDYDIYFKNLKEGITGKEALQQSPTPV  597



>ref|XP_010686247.1| PREDICTED: uncharacterized protein LOC104900519 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=577

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYI++PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  404  FQLPLSTIRAYIQEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTYKLK  463

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVARICVAAL SP+AC
Sbjct  464  GEDLLRESGIPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVARICVAALASPHAC  523

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+T+DPENPP EKDYDV+FKTLKEGITGKE LE  PV
Sbjct  524  DKTFEVKSVIPFSEPFTIDPENPPLEKDYDVFFKTLKEGITGKELLEQNPV  574



>ref|XP_004295588.1| PREDICTED: uncharacterized protein LOC101314642 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   315 bits (807),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AY+KDPITPRFVHV SAGVTRPERPGLDLS+QPPAVRLNKEL FILTFKLK
Sbjct  420  FKLPVSSIKAYLKDPITPRFVHVSSAGVTRPERPGLDLSRQPPAVRLNKELDFILTFKLK  479

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVA+ICVAALESPYA 
Sbjct  480  GEDLIRESGIPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVAQICVAALESPYAN  539

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKSVIPFSEP+TVDPENPPPEKDYDVYFKTLK+GITGKE LE  PV
Sbjct  540  GKTFEVKSVIPFSEPFTVDPENPPPEKDYDVYFKTLKDGITGKEVLEQNPV  590



>ref|XP_010686246.1| PREDICTED: uncharacterized protein LOC104900519 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score =   315 bits (806),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYI++PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  426  FQLPLSTIRAYIQEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTYKLK  485

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVARICVAAL SP+AC
Sbjct  486  GEDLLRESGIPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVARICVAALASPHAC  545

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+T+DPENPP EKDYDV+FKTLKEGITGKE LE  PV
Sbjct  546  DKTFEVKSVIPFSEPFTIDPENPPLEKDYDVFFKTLKEGITGKELLEQNPV  596



>ref|XP_010686245.1| PREDICTED: uncharacterized protein LOC104900519 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=606

 Score =   315 bits (807),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYI++PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  433  FQLPLSTIRAYIQEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTYKLK  492

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVARICVAAL SP+AC
Sbjct  493  GEDLLRESGIPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVARICVAALASPHAC  552

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+T+DPENPP EKDYDV+FKTLKEGITGKE LE  PV
Sbjct  553  DKTFEVKSVIPFSEPFTIDPENPPLEKDYDVFFKTLKEGITGKELLEQNPV  603



>gb|KJB66858.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
 gb|KJB66862.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
Length=603

 Score =   315 bits (806),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS I+AYIKDPITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNKEL F+LTFKLK
Sbjct  431  FELPLSTIKAYIKDPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKELDFVLTFKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREE+A IC+AALESPYAC
Sbjct  491  GEDLIRESGIPYTIVRPCALTEEPAGADLVFDQGDNITGKISREEIALICIAALESPYAC  550

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY++YF+TLK+GITGKESL  + +
Sbjct  551  DKTFEVKSVVPFSEPFTVDPENPPPEKDYNIYFQTLKDGITGKESLGQSAI  601



>gb|KJB66861.1| hypothetical protein B456_010G161400 [Gossypium raimondii]
Length=587

 Score =   314 bits (804),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS I+AYIKDPITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNKEL F+LTFKLK
Sbjct  415  FELPLSTIKAYIKDPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKELDFVLTFKLK  474

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREE+A IC+AALESPYAC
Sbjct  475  GEDLIRESGIPYTIVRPCALTEEPAGADLVFDQGDNITGKISREEIALICIAALESPYAC  534

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY++YF+TLK+GITGKESL  + + 
Sbjct  535  DKTFEVKSVVPFSEPFTVDPENPPPEKDYNIYFQTLKDGITGKESLGQSAIA  586



>ref|XP_010915482.1| PREDICTED: uncharacterized protein LOC105040590 isoform X2 [Elaeis 
guineensis]
Length=595

 Score =   314 bits (804),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP S +RAYI +PITPRFVHV SAGVTRP+RPGLDLS+QPPAVRLNKELGFILT+KLK
Sbjct  423  FQLPFSSMRAYINEPITPRFVHVSSAGVTRPDRPGLDLSRQPPAVRLNKELGFILTYKLK  482

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGKISREEVARIC+AALESP+AC
Sbjct  483  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICIAALESPHAC  542

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKS +PFSEPYTVDP NPPPE+DYDVYFKTLK+GITGKE+LE + V
Sbjct  543  GKTFEVKSTVPFSEPYTVDPSNPPPERDYDVYFKTLKDGITGKEALEGSLV  593



>gb|KHG02784.1| hypothetical protein F383_26204 [Gossypium arboreum]
Length=606

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS I+AYIK PITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNKEL F+LTFKLK
Sbjct  434  FELPLSTIKAYIKYPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKELDFVLTFKLK  493

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREE+A IC+AALESPYAC
Sbjct  494  GEDLIRESGIPYTIVRPCALTEEPAGADLVFDQGDNITGKISREEIALICIAALESPYAC  553

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSV+PFSEP+TVDPENPPPEKDY++YF+TLK+GITGKESLE + +
Sbjct  554  DKTFEVKSVVPFSEPFTVDPENPPPEKDYNIYFQTLKDGITGKESLEQSAI  604



>ref|XP_010915481.1| PREDICTED: uncharacterized protein LOC105040590 isoform X1 [Elaeis 
guineensis]
Length=603

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP S +RAYI +PITPRFVHV SAGVTRP+RPGLDLS+QPPAVRLNKELGFILT+KLK
Sbjct  431  FQLPFSSMRAYINEPITPRFVHVSSAGVTRPDRPGLDLSRQPPAVRLNKELGFILTYKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGKISREEVARIC+AALESP+AC
Sbjct  491  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICIAALESPHAC  550

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKS +PFSEPYTVDP NPPPE+DYDVYFKTLK+GITGKE+LE + V
Sbjct  551  GKTFEVKSTVPFSEPYTVDPSNPPPERDYDVYFKTLKDGITGKEALEGSLV  601



>ref|NP_001242339.1| uncharacterized protein LOC100815475 [Glycine max]
 gb|ACU21450.1| unknown [Glycine max]
Length=600

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRPERPG+DLSKQPPAVRLNKEL +ILTFKLK
Sbjct  428  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPERPGIDLSKQPPAVRLNKELDYILTFKLK  487

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGA+LIFDQGDNITGKISREE+  +CVAAL+SPYAC
Sbjct  488  GEDLLRESGIPYAIVRPCALTEEPAGANLIFDQGDNITGKISREEIVLMCVAALDSPYAC  547

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKSVIPFSEP+TVDP NPPPEKDYDVYFK LKEGITGKE+L+  PV+
Sbjct  548  DKTFEVKSVIPFSEPFTVDPTNPPPEKDYDVYFKNLKEGITGKEALQQNPVS  599



>ref|XP_007214164.1| hypothetical protein PRUPE_ppa018961mg, partial [Prunus persica]
 gb|EMJ15363.1| hypothetical protein PRUPE_ppa018961mg, partial [Prunus persica]
Length=592

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAY+K+PITPRFVHVGSAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  420  FKLPLSSIRAYLKEPITPRFVHVGSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  479

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA+ICVAALES YA 
Sbjct  480  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVAQICVAALESHYAS  539

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKSV+PFSEP+TVDP+NPPPEKDY+VYFKTLK+GITGKE LE  PV
Sbjct  540  GKTFEVKSVVPFSEPFTVDPQNPPPEKDYNVYFKTLKDGITGKEILEQDPV  590



>ref|XP_003524972.1| PREDICTED: uncharacterized protein LOC100500578 [Glycine max]
Length=601

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 162/173 (94%), Gaps = 1/173 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYI-KDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKL  540
            F+LP+S I AYI KDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILTFKL
Sbjct  428  FELPVSSIHAYIIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTFKL  487

Query  539  KGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYA  360
            KGEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+A +CVAAL+SPYA
Sbjct  488  KGEDLLRESGIPYVIVRPCALTEEPAGADLIFDQGDNITGKISREEIALMCVAALDSPYA  547

Query  359  CDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            CDKTFEVKSVIPFSEP+TVDP NPPPEKDYDVYFK LKEGITGKE+L+  PV+
Sbjct  548  CDKTFEVKSVIPFSEPFTVDPANPPPEKDYDVYFKNLKEGITGKEALQQNPVS  600



>gb|KHN06420.1| Putative complex I intermediate-associated protein 30 [Glycine 
soja]
Length=597

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 162/173 (94%), Gaps = 1/173 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYI-KDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKL  540
            F+LP+S I AYI KDPITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILTFKL
Sbjct  424  FELPVSSIHAYIIKDPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTFKL  483

Query  539  KGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYA  360
            KGEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+A +CVAAL+SPYA
Sbjct  484  KGEDLLRESGIPYVIVRPCALTEEPAGADLIFDQGDNITGKISREEIALMCVAALDSPYA  543

Query  359  CDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            CDKTFEVKSVIPFSEP+TVDP NPPPEKDYDVYFK LKEGITGKE+L+  PV+
Sbjct  544  CDKTFEVKSVIPFSEPFTVDPANPPPEKDYDVYFKNLKEGITGKEALQQNPVS  596



>ref|XP_010999786.1| PREDICTED: uncharacterized protein LOC105107529 isoform X2 [Populus 
euphratica]
Length=544

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IR +IKDP+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  372  FQLPVSSIRTFIKDPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  431

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+ARIC+AALESPYA 
Sbjct  432  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKISREEIARICIAALESPYAL  491

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVD ENPP EKDYD+YFK LK+GITGKE LE +PV
Sbjct  492  DKTFEVKSVIPFSEPFTVDQENPPQEKDYDIYFKDLKDGITGKELLEQSPV  542



>emb|CDX99422.1| BnaC01g11300D [Brassica napus]
Length=599

 Score =   310 bits (794),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDL+KQPPAVRLNKEL FILT+KLK
Sbjct  427  FELPLSTIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLTKQPPAVRLNKELDFILTYKLK  486

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGK+SR+EVARIC+AALESP+A 
Sbjct  487  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKVSRDEVARICIAALESPHAL  546

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE + V+
Sbjct  547  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQSTVS  598



>ref|XP_004161206.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101211769 
[Cucumis sativus]
Length=597

 Score =   310 bits (793),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYIK P+TPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL FILT KLK
Sbjct  425  FQLPLSSIRAYIKYPLTPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDFILTSKLK  484

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGK+S EE+ARIC+AALESPYAC
Sbjct  485  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKVSSEEIARICIAALESPYAC  544

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            DKTFEVKSVIPF EP+TVDPENPPPEKDY++YFKTLK+GITGKE L  TP
Sbjct  545  DKTFEVKSVIPFGEPFTVDPENPPPEKDYNIYFKTLKDGITGKELLVQTP  594



>ref|XP_010999785.1| PREDICTED: uncharacterized protein LOC105107529 isoform X1 [Populus 
euphratica]
Length=598

 Score =   309 bits (792),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IR +IKDP+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  426  FQLPVSSIRTFIKDPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  485

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+ARIC+AALESPYA 
Sbjct  486  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKISREEIARICIAALESPYAL  545

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPFSEP+TVD ENPP EKDYD+YFK LK+GITGKE LE +PV
Sbjct  546  DKTFEVKSVIPFSEPFTVDQENPPQEKDYDIYFKDLKDGITGKELLEQSPV  596



>emb|CDX78897.1| BnaA01g09640D [Brassica napus]
Length=628

 Score =   310 bits (794),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDL+KQPPAVRLNKEL FILT+KLK
Sbjct  428  FELPLSTIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLTKQPPAVRLNKELDFILTYKLK  487

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGK+SR+EVARIC+AALESP+A 
Sbjct  488  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKVSRDEVARICIAALESPHAL  547

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE + V+
Sbjct  548  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQSTVS  599



>ref|XP_010529213.1| PREDICTED: uncharacterized protein LOC104806167 isoform X2 [Tarenaya 
hassleriana]
Length=478

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  306  FELPLSSIRAYIQEPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  365

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPY IVRPCALTEEPAGADLIFDQGDNITGK+SREEVA IC+AAL+SPYA 
Sbjct  366  GEDSIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKVSREEVALICIAALDSPYAL  425

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKS IPFSEP+TVD ENPPPEKDYDVYFK LK+GITGKE LEP+ V
Sbjct  426  DKTFEVKSTIPFSEPFTVDLENPPPEKDYDVYFKNLKDGITGKEVLEPSGV  476



>ref|XP_009381202.1| PREDICTED: uncharacterized protein LOC103969413 [Musa acuminata 
subsp. malaccensis]
Length=603

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP S IRAYI +PITPRFVHV SAGVTRP RPGLDLSKQPPAVRLNKELGF+LT+KLK
Sbjct  431  FQLPFSSIRAYINEPITPRFVHVSSAGVTRPGRPGLDLSKQPPAVRLNKELGFVLTYKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+ARIC+AAL+SPYAC
Sbjct  491  GEDLLRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKISREEIARICIAALDSPYAC  550

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKS +PFSE Y +DPENPPPEKDYD YFK LKEGITGKE+LE  PV
Sbjct  551  GKTFEVKSTVPFSELYVIDPENPPPEKDYDEYFKNLKEGITGKEALEGNPV  601



>ref|NP_193616.2| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AAL61926.1| putative protein [Arabidopsis thaliana]
 gb|AAP37723.1| At4g18810 [Arabidopsis thaliana]
 gb|AEE84092.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=596

 Score =   309 bits (791),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  424  FELPLSSIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  483

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESPYA 
Sbjct  484  GEDLIRDSGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPYAL  543

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFKTLK+GITGKE+LE + V
Sbjct  544  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKTLKDGITGKEALEQSTV  594



>dbj|BAD27665.1| putative UOS1 [Oryza sativa Japonica Group]
Length=367

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVR+NKELG ILT+KLK
Sbjct  195  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRMNKELGSILTYKLK  254

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREE+A ICVAAL SP A 
Sbjct  255  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEIAFICVAALASPNAV  314

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            +KTFEVKS +PFSEP+ VDP NPPPEKDYDVYFK LK GITGKE+LE TP
Sbjct  315  EKTFEVKSTVPFSEPFVVDPSNPPPEKDYDVYFKELKAGITGKEALEGTP  364



>ref|XP_004147418.1| PREDICTED: uncharacterized protein LOC101211769 [Cucumis sativus]
Length=597

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYIK P+TPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKEL FILT KLK
Sbjct  425  FQLPLSSIRAYIKYPLTPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDFILTSKLK  484

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGK+S EE+ARIC+AALESPYAC
Sbjct  485  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKVSSEEIARICIAALESPYAC  544

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            DKTFEVKSVIPFSEP+TVDPENPP EKDY++YFKTLK+GITGKE L  TP
Sbjct  545  DKTFEVKSVIPFSEPFTVDPENPPLEKDYNIYFKTLKDGITGKELLVQTP  594



>ref|NP_001190764.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 gb|AEE84093.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=627

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  424  FELPLSSIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  483

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESPYA 
Sbjct  484  GEDLIRDSGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPYAL  543

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFKTLK+GITGKE+LE + V
Sbjct  544  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKTLKDGITGKEALEQSTV  594



>gb|ACN39869.1| unknown [Picea sitchensis]
Length=587

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AY+K+PITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELG+ILTFKLK
Sbjct  415  FELPVSSIKAYLKEPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGYILTFKLK  474

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIPYTI+RPCALTEEPAGADLIF+QGDNITGKISREEVARICVAALES YAC
Sbjct  475  GEDLLRDSGIPYTIIRPCALTEEPAGADLIFEQGDNITGKISREEVARICVAALESSYAC  534

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            D TFEVKSV+PFSEP+ +DP NPP EKDYD++F +LK+GITGKE+LE +PV 
Sbjct  535  DTTFEVKSVVPFSEPFKIDPNNPPAEKDYDIFFLSLKKGITGKEALEKSPVA  586



>gb|ABR17731.1| unknown [Picea sitchensis]
Length=587

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 163/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I+AY+K+PITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELG+ILTFKLK
Sbjct  415  FELPVSSIKAYLKEPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGYILTFKLK  474

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIPYTI+RPCALTEEPAGADLIF+QGDNITGKISREEVARICVAALES YAC
Sbjct  475  GEDLLRDSGIPYTIIRPCALTEEPAGADLIFEQGDNITGKISREEVARICVAALESSYAC  534

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            D TFEVKSV+PFSEP+ +DP NPP EKDYD++F +LK+GITGKE+LE +PV 
Sbjct  535  DTTFEVKSVVPFSEPFKIDPNNPPAEKDYDIFFLSLKKGITGKEALEKSPVA  586



>ref|XP_002867974.1| transcriptional repressor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44233.1| transcriptional repressor [Arabidopsis lyrata subsp. lyrata]
Length=596

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  424  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  483

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESPYA 
Sbjct  484  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPYAL  543

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE + V
Sbjct  544  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQSTV  594



>gb|KFK28552.1| hypothetical protein AALP_AA7G011200 [Arabis alpina]
Length=585

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++PITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  412  FELPLSSIRAYIQEPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  471

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIPY IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AAL+SPYA 
Sbjct  472  GEDLIRDSGIPYAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALDSPYAL  531

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE   V+
Sbjct  532  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNDYFKNLKDGITGKEALEQNTVS  583



>ref|XP_006830227.1| hypothetical protein AMTR_s00130p00051210 [Amborella trichopoda]
 gb|ERM97643.1| hypothetical protein AMTR_s00130p00051210 [Amborella trichopoda]
Length=601

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F LP+S IRAYIKDPITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELG+ILTFKLK
Sbjct  429  FALPVSCIRAYIKDPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGYILTFKLK  488

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R+SGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICV ALESP+AC
Sbjct  489  GEDVIRDSGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVTALESPHAC  548

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +KTFEVKS +PFSEP+ V+P  PPPEKDYDVYFK L+EGITGKE+LE +P+
Sbjct  549  NKTFEVKSTVPFSEPFVVNPNTPPPEKDYDVYFKALEEGITGKEALERSPM  599



>ref|XP_010106609.1| hypothetical protein L484_004838 [Morus notabilis]
 gb|EXC10939.1| hypothetical protein L484_004838 [Morus notabilis]
Length=590

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAYIKDPITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNKELGF+LTFKLK
Sbjct  418  FQLPVSSIRAYIKDPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKELGFVLTFKLK  477

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIFDQGDNITGK+SREE+A IC+AALESPYA 
Sbjct  478  GEDLIRESGIPHAIVRPCALTEEPAGADLIFDQGDNITGKVSREEIALICIAALESPYAL  537

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKSVIPF+EP+TVD ENPPPEKDY++YFK LK GITGKE L+ +P+
Sbjct  538  DKTFEVKSVIPFNEPFTVDLENPPPEKDYNIYFKNLKGGITGKELLQQSPL  588



>ref|XP_006283354.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
 gb|EOA16252.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
Length=435

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLS+QPPAVRLNKEL FILT+KLK
Sbjct  263  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSRQPPAVRLNKELDFILTYKLK  322

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIPY IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESP A 
Sbjct  323  GEDLIRDSGIPYAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPSAL  382

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLE  216
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE
Sbjct  383  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALE  429



>ref|NP_001288965.1| uncharacterized LOC103856855 [Brassica rapa]
 gb|ABV89650.1| transcriptional repressor [Brassica rapa]
Length=600

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDL+KQPPAVRLNKEL FILT+KLK
Sbjct  428  FELPLSTIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLTKQPPAVRLNKELDFILTYKLK  487

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGK+SR+EVARIC+AALES  A 
Sbjct  488  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKVSRDEVARICIAALESSSAL  547

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE + V+
Sbjct  548  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQSTVS  599



>ref|XP_008679815.1| PREDICTED: uncharacterized protein LOC103654777 [Zea mays]
 gb|AFW65983.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=590

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELG ILTFKLK
Sbjct  418  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGSILTFKLK  477

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREEVARICVAAL SP A 
Sbjct  478  GEDLIRESGIPYTIVRPCALTEEPAGADLMFDQGDNITGKISREEVARICVAALASPDAV  537

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
             KTFEVKS +PFSEPY +DP NPPPEKDY+VYFK LKEGITGKE+LE TP
Sbjct  538  GKTFEVKSTVPFSEPYVIDPANPPPEKDYEVYFKELKEGITGKEALEATP  587



>ref|XP_007212771.1| hypothetical protein PRUPE_ppa019705mg, partial [Prunus persica]
 gb|EMJ13970.1| hypothetical protein PRUPE_ppa019705mg, partial [Prunus persica]
Length=268

 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS I+AY+K+PITPRFVHVGSAGVTRP+RPGLDLSKQPPAV LNKEL FILTF+LK
Sbjct  96   FKLPLSSIQAYLKEPITPRFVHVGSAGVTRPDRPGLDLSKQPPAVLLNKELDFILTFQLK  155

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL RESGIPYTIVRPCALTEEPAGAD IFDQGDN+TGK+SREEVA+IC AALESPYA 
Sbjct  156  GEDLTRESGIPYTIVRPCALTEEPAGADHIFDQGDNVTGKVSREEVAQICFAALESPYAS  215

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTF+VKSV+PFSEP+TVDP++PPPEKDY+VYFKTLK+G+ GKE LE  PV
Sbjct  216  GKTFKVKSVVPFSEPFTVDPQSPPPEKDYNVYFKTLKDGLIGKEILEQDPV  266



>ref|XP_010529212.1| PREDICTED: uncharacterized protein LOC104806167 isoform X1 [Tarenaya 
hassleriana]
Length=596

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  424  FELPLSSIRAYIQEPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  483

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPY IVRPCALTEEPAGADLIFDQGDNITGK+SREEVA IC+AAL+SPYA 
Sbjct  484  GEDSIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKVSREEVALICIAALDSPYAL  543

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFEVKS IPFSEP+TVD ENPPPEKDYDVYFK LK+GITGKE LEP+ V
Sbjct  544  DKTFEVKSTIPFSEPFTVDLENPPPEKDYDVYFKNLKDGITGKEVLEPSGV  594



>ref|XP_002451838.1| hypothetical protein SORBIDRAFT_04g008450 [Sorghum bicolor]
 gb|EES04814.1| hypothetical protein SORBIDRAFT_04g008450 [Sorghum bicolor]
Length=592

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELG ILT+KLK
Sbjct  420  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGSILTYKLK  479

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL SP A 
Sbjct  480  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALASPNAV  539

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
             KTFEVKS +PFSEPY +DP NPP EKDYDVYFK LKEGITGKE+LE TP
Sbjct  540  GKTFEVKSTVPFSEPYVIDPTNPPSEKDYDVYFKELKEGITGKEALEATP  589



>ref|XP_006414053.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
 gb|ESQ55506.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
Length=598

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  426  FELPLSSIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  485

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R SGIP+ IVRPCALTEEPAGA+LIFDQGDNITGK+SR+EVARIC+AALESP A 
Sbjct  486  GEDLIRSSGIPFAIVRPCALTEEPAGAELIFDQGDNITGKVSRDEVARICIAALESPLAL  545

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE + V
Sbjct  546  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQSTV  596



>ref|XP_002305056.2| hypothetical protein POPTR_0004s05960g [Populus trichocarpa]
 gb|EEE85567.2| hypothetical protein POPTR_0004s05960g [Populus trichocarpa]
Length=599

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IR +IKDP+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  426  FQLPVSSIRTFIKDPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  485

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNITGKISREE+ARIC+AALESPYA 
Sbjct  486  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNITGKISREEIARICIAALESPYAL  545

Query  356  DKTFE-VKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            DKTFE VKSVIPFSEP+TVD ENPP EKDYD+YFK LK+GITGKE LE +PV
Sbjct  546  DKTFEVVKSVIPFSEPFTVDLENPPREKDYDIYFKDLKDGITGKELLEQSPV  597



>ref|XP_006414054.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
 gb|ESQ55507.1| hypothetical protein EUTSA_v10024714mg [Eutrema salsugineum]
Length=601

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  429  FELPLSSIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  488

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R SGIP+ IVRPCALTEEPAGA+LIFDQGDNITGK+SR+EVARIC+AALESP A 
Sbjct  489  GEDLIRSSGIPFAIVRPCALTEEPAGAELIFDQGDNITGKVSRDEVARICIAALESPLAL  548

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE + V
Sbjct  549  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQSTV  599



>ref|XP_009408895.1| PREDICTED: uncharacterized protein LOC103991243 [Musa acuminata 
subsp. malaccensis]
Length=304

 Score =   294 bits (753),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 156/177 (88%), Gaps = 6/177 (3%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILT----  549
            FQLP S IRAYI + ITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILT    
Sbjct  126  FQLPFSSIRAYINESITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTEVVH  185

Query  548  --FKLKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAAL  375
              F L+GEDL+RESGIPY+IVRPCALTEEPAGADLIFD GDNITGKISREEVA+ICVAAL
Sbjct  186  SVFLLQGEDLIRESGIPYSIVRPCALTEEPAGADLIFDPGDNITGKISREEVAQICVAAL  245

Query  374  ESPYACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             SPYAC KTFEVKS +PF+EPY VDPENPPPEKDYD YFK LKEG+TGKE+ E +PV
Sbjct  246  SSPYACGKTFEVKSTVPFNEPYVVDPENPPPEKDYDEYFKNLKEGVTGKEASEGSPV  302



>ref|XP_010439808.1| PREDICTED: uncharacterized protein LOC104723179 isoform X1 [Camelina 
sativa]
Length=598

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  426  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  485

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESP A 
Sbjct  486  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPSAL  545

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  546  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQS  594



>ref|XP_010439809.1| PREDICTED: uncharacterized protein LOC104723179 isoform X2 [Camelina 
sativa]
Length=629

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  426  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  485

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESP A 
Sbjct  486  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPSAL  545

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  546  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQS  594



>ref|XP_010449465.1| PREDICTED: uncharacterized protein LOC104731696 isoform X2 [Camelina 
sativa]
Length=594

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  422  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  481

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESP A 
Sbjct  482  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPSAL  541

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TV+PENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  542  NKTFEVKSTVPFSEPFTVNPENPPPEKDYNEYFKNLKDGITGKEALEQS  590



>ref|XP_010449464.1| PREDICTED: uncharacterized protein LOC104731696 isoform X1 [Camelina 
sativa]
Length=597

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  425  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  484

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESP A 
Sbjct  485  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPSAL  544

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TV+PENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  545  NKTFEVKSTVPFSEPFTVNPENPPPEKDYNEYFKNLKDGITGKEALEQS  593



>ref|XP_006283353.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
 gb|EOA16251.1| hypothetical protein CARUB_v10004397mg [Capsella rubella]
Length=612

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLS+QPPAVRLNKEL FILT+KLK
Sbjct  409  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSRQPPAVRLNKELDFILTYKLK  468

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIPY IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESP A 
Sbjct  469  GEDLIRDSGIPYAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPSAL  528

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  529  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQS  577



>ref|XP_010449466.1| PREDICTED: uncharacterized protein LOC104731696 isoform X3 [Camelina 
sativa]
Length=624

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  425  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  484

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESP A 
Sbjct  485  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPSAL  544

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TV+PENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  545  NKTFEVKSTVPFSEPFTVNPENPPPEKDYNEYFKNLKDGITGKEALEQS  593



>gb|EEC72794.1| hypothetical protein OsI_06478 [Oryza sativa Indica Group]
Length=587

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVR+NKELG ILT+KLK
Sbjct  415  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRMNKELGSILTYKLK  474

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREE+A ICVAAL SP A 
Sbjct  475  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEIAFICVAALASPNAV  534

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            +KTFEVKS +PFSEP+ VDP NPPPEKDYDVYFK LK GITGKE+LE TP
Sbjct  535  EKTFEVKSTVPFSEPFVVDPSNPPPEKDYDVYFKELKAGITGKEALEGTP  584



>ref|NP_001046381.1| Os02g0234500 [Oryza sativa Japonica Group]
 dbj|BAD27664.1| putative UOS1 [Oryza sativa Japonica Group]
 dbj|BAF08295.1| Os02g0234500 [Oryza sativa Japonica Group]
 dbj|BAG90704.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56622.1| hypothetical protein OsJ_06005 [Oryza sativa Japonica Group]
Length=587

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVR+NKELG ILT+KLK
Sbjct  415  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRMNKELGSILTYKLK  474

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREE+A ICVAAL SP A 
Sbjct  475  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEIAFICVAALASPNAV  534

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            +KTFEVKS +PFSEP+ VDP NPPPEKDYDVYFK LK GITGKE+LE TP
Sbjct  535  EKTFEVKSTVPFSEPFVVDPSNPPPEKDYDVYFKELKAGITGKEALEGTP  584



>ref|XP_010434492.1| PREDICTED: uncharacterized protein LOC104718440 isoform X1 [Camelina 
sativa]
Length=599

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLS+QPPAVRLNKEL FILT+KLK
Sbjct  427  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSRQPPAVRLNKELDFILTYKLK  486

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AAL+SP A 
Sbjct  487  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALDSPSAL  546

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  547  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQS  595



>ref|XP_010434493.1| PREDICTED: uncharacterized protein LOC104718440 isoform X2 [Camelina 
sativa]
Length=630

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI++P+TPRFVHVGSAGVTRPERPGLDLS+QPPAVRLNKEL FILT+KLK
Sbjct  427  FELPLSSIRAYIQEPVTPRFVHVGSAGVTRPERPGLDLSRQPPAVRLNKELDFILTYKLK  486

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AAL+SP A 
Sbjct  487  GEDLIRESGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALDSPSAL  546

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            +KTFEVKS +PFSEP+TVDPENPPPEKDY+ YFK LK+GITGKE+LE +
Sbjct  547  NKTFEVKSTVPFSEPFTVDPENPPPEKDYNEYFKNLKDGITGKEALEQS  595



>ref|XP_004951358.1| PREDICTED: uncharacterized protein LOC101762330 isoform X3 [Setaria 
italica]
Length=590

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELG ILT+KLK
Sbjct  420  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGSILTYKLK  479

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA ICVAAL SP A 
Sbjct  480  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVACICVAALASPNAV  539

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
             KTFEVKS +PFSE Y +DP NPPPEKDY+VYFK LKEGITGKE+LE TP
Sbjct  540  GKTFEVKSTVPFSEAYVIDPSNPPPEKDYEVYFKELKEGITGKEALEATP  589



>ref|XP_003571881.1| PREDICTED: uncharacterized protein LOC100826457 [Brachypodium 
distachyon]
Length=593

 Score =   299 bits (766),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVR+NKELG ILT+KLK
Sbjct  421  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRMNKELGSILTYKLK  480

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+PYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVARICVAAL SP A 
Sbjct  481  GEDLIRESGVPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVARICVAALASPNAV  540

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKS +PFSEP+ +DP NPPPEKDY+VYFK LKEGITGKE LE TP 
Sbjct  541  GKTFEVKSTVPFSEPFVIDPSNPPPEKDYEVYFKELKEGITGKEVLEGTPA  591



>gb|AFW65984.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=598

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 156/178 (88%), Gaps = 8/178 (4%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFV--------HVGSAGVTRPERPGLDLSKQPPAVRLNKELG  561
            F+LP S IRAYI +PITPRFV        HV SAGVTRPERPGLDLSKQPPAVRLNKELG
Sbjct  418  FELPFSSIRAYINEPITPRFVYLLVFRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELG  477

Query  560  FILTFKLKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVA  381
             ILTFKLKGEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREEVARICVA
Sbjct  478  SILTFKLKGEDLIRESGIPYTIVRPCALTEEPAGADLMFDQGDNITGKISREEVARICVA  537

Query  380  ALESPYACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            AL SP A  KTFEVKS +PFSEPY +DP NPPPEKDY+VYFK LKEGITGKE+LE TP
Sbjct  538  ALASPDAVGKTFEVKSTVPFSEPYVIDPANPPPEKDYEVYFKELKEGITGKEALEATP  595



>ref|XP_006648484.1| PREDICTED: uncharacterized protein LOC102714621 [Oryza brachyantha]
Length=628

 Score =   297 bits (760),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRA I +P+TPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELG ILT+KLK
Sbjct  456  FELPFSSIRACINEPMTPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGSILTYKLK  515

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVARICVAAL SP A 
Sbjct  516  GEDLIRESGIPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVARICVAALASPNAV  575

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            DK FEVKS +PFSEP+ VDP NPPPEKDY+VYFK LK GITGKE+LE TP
Sbjct  576  DKNFEVKSTVPFSEPFAVDPSNPPPEKDYEVYFKELKAGITGKEALEGTP  625



>gb|AAG42527.1| unknown [Prunus persica]
Length=158

 Score =   277 bits (708),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = -2

Query  665  PRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIVRP  486
            PRFVHVGSAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLKGEDL+RESGIPYTIVRP
Sbjct  3    PRFVHVGSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLKGEDLIRESGIPYTIVRP  62

Query  485  CALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVIPFSEPYT  306
            CALTEEPAGADLIFDQGDNITGKISREEVA+ICVAALES YA  KTFEVKSV+PFSEP+T
Sbjct  63   CALTEEPAGADLIFDQGDNITGKISREEVAQICVAALESHYASGKTFEVKSVVPFSEPFT  122

Query  305  VDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            V  ENPPPEKDY+VYFKTLK+GITGKE LE  PV
Sbjct  123  VTLENPPPEKDYNVYFKTLKDGITGKEILEQDPV  156



>emb|CAB37466.1| putative protein [Arabidopsis thaliana]
 emb|CAB78883.1| putative protein [Arabidopsis thaliana]
Length=621

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 163/204 (80%), Gaps = 33/204 (16%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAYI+DP+TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKEL FILT+KLK
Sbjct  416  FELPLSSIRAYIQDPVTPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELDFILTYKLK  475

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+R+SGIP+ IVRPCALTEEPAGADLIF+QGDNITGK+SR+EVARIC+AALESPYA 
Sbjct  476  GEDLIRDSGIPFAIVRPCALTEEPAGADLIFEQGDNITGKVSRDEVARICIAALESPYAL  535

Query  356  DKTFE---------------------------------VKSVIPFSEPYTVDPENPPPEK  276
            +KTFE                                 VKS +PFSEP+TVDPENPPPEK
Sbjct  536  NKTFEVFKESSIFRFFRVAIQKVKFLNWAVLCVVCLFQVKSTVPFSEPFTVDPENPPPEK  595

Query  275  DYDVYFKTLKEGITGKESLEPTPV  204
            DY+ YFKTLK+GITGKE+LE + V
Sbjct  596  DYNEYFKTLKDGITGKEALEQSTV  619



>ref|XP_007216112.1| hypothetical protein PRUPE_ppa018758mg, partial [Prunus persica]
 gb|EMJ17311.1| hypothetical protein PRUPE_ppa018758mg, partial [Prunus persica]
Length=219

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 152/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAY+K+ ITPR V  G AG+TRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  51   FKLPLSSIRAYLKETITPRLVRGGFAGITRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  110

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
             EDL+RESGIPYTIVRPCALTEEPAGA+LIFDQGDNITGKISREEVA ICV ALESPYA 
Sbjct  111  EEDLIRESGIPYTIVRPCALTEEPAGANLIFDQGDNITGKISREEVAHICVGALESPYAS  170

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             +TFEVKSV+PF    TVDP+NPPPEKDY+VYFKTLK+GITGKE LE  PV
Sbjct  171  GETFEVKSVVPF----TVDPQNPPPEKDYNVYFKTLKDGITGKEILEQDPV  217



>ref|XP_004951357.1| PREDICTED: uncharacterized protein LOC101762330 isoform X2 [Setaria 
italica]
Length=591

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 154/201 (77%), Gaps = 31/201 (15%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELG ILT+KLK
Sbjct  390  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGSILTYKLK  449

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA ICVAAL SP A 
Sbjct  450  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVACICVAALASPNAV  509

Query  356  DKTFE-------------------------------VKSVIPFSEPYTVDPENPPPEKDY  270
             KTFE                               VKS +PFSE Y +DP NPPPEKDY
Sbjct  510  GKTFEVKTLQLVSKTGTDIIVNYLWEKANGGNSFDQVKSTVPFSEAYVIDPSNPPPEKDY  569

Query  269  DVYFKTLKEGITGKESLEPTP  207
            +VYFK LKEGITGKE+LE TP
Sbjct  570  EVYFKELKEGITGKEALEATP  590



>ref|XP_004951356.1| PREDICTED: uncharacterized protein LOC101762330 isoform X1 [Setaria 
italica]
Length=621

 Score =   284 bits (726),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 154/201 (77%), Gaps = 31/201 (15%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVHV SAGVTRPERPGLDLSKQPPAVRLNKELG ILT+KLK
Sbjct  420  FELPFSSIRAYINEPITPRFVHVSSAGVTRPERPGLDLSKQPPAVRLNKELGSILTYKLK  479

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA ICVAAL SP A 
Sbjct  480  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVACICVAALASPNAV  539

Query  356  DKTFE-------------------------------VKSVIPFSEPYTVDPENPPPEKDY  270
             KTFE                               VKS +PFSE Y +DP NPPPEKDY
Sbjct  540  GKTFEVKTLQLVSKTGTDIIVNYLWEKANGGNSFDQVKSTVPFSEAYVIDPSNPPPEKDY  599

Query  269  DVYFKTLKEGITGKESLEPTP  207
            +VYFK LKEGITGKE+LE TP
Sbjct  600  EVYFKELKEGITGKEALEATP  620



>ref|XP_002968299.1| hypothetical protein SELMODRAFT_170011 [Selaginella moellendorffii]
 gb|EFJ30553.1| hypothetical protein SELMODRAFT_170011 [Selaginella moellendorffii]
Length=483

 Score =   275 bits (702),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F +P++ I+AY+ +P+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELG ILT+KLK
Sbjct  309  FAIPIASIKAYLNEPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGDILTYKLK  368

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+P+TIVRPCALTEEPAGA+L FDQGDNITGKISREEVARICVAALESP AC
Sbjct  369  GEDLIRESGVPFTIVRPCALTEEPAGAELQFDQGDNITGKISREEVARICVAALESPAAC  428

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGK  228
            + TFEVKS +PFSEP+++DP NPP E++Y+  FK LK+GITGK
Sbjct  429  NVTFEVKSTVPFSEPFSIDPSNPPAERNYEENFKNLKQGITGK  471



>ref|XP_002976078.1| hypothetical protein SELMODRAFT_175261 [Selaginella moellendorffii]
 gb|EFJ22983.1| hypothetical protein SELMODRAFT_175261 [Selaginella moellendorffii]
Length=581

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F +P++ I+AY+ +P+TPR VHV SAGVTRP+RPGLDLSKQPPAVRLNKELG ILT+KLK
Sbjct  407  FAIPIASIKAYLSEPVTPRLVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGDILTYKLK  466

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+P+TIVRPCALTEEPAGA+L FDQGDNITGKISREEVARICVAALESP AC
Sbjct  467  GEDLIRESGVPFTIVRPCALTEEPAGAELQFDQGDNITGKISREEVARICVAALESPAAC  526

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            + TFEVKS +PFSEP+++DP NPP EK+Y+  FK LK+GITGK   EP P
Sbjct  527  NVTFEVKSTVPFSEPFSIDPSNPPAEKNYEENFKNLKQGITGKT--EPVP  574



>ref|XP_001752746.1| predicted protein [Physcomitrella patens]
 gb|EDQ82250.1| predicted protein [Physcomitrella patens]
Length=591

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 150/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP++ I+AY+K+P+TPR VH+ SAGVTRP+RPGLDLSKQPPAVR+NKELG+ILT+KLK
Sbjct  419  FELPIASIKAYLKEPVTPRIVHLSSAGVTRPDRPGLDLSKQPPAVRMNKELGYILTYKLK  478

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
             EDLVRESGIPYT++RPCALTEEPAGA+L FDQGDNITGKISR EVARI VA++ SP A 
Sbjct  479  AEDLVRESGIPYTVIRPCALTEEPAGAELQFDQGDNITGKISRAEVARIIVASMSSPAAR  538

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPVT  201
            DKTFEVKS +PFS+P+TVDP NPPP +DY+ +F  LK GITGKE+L    V 
Sbjct  539  DKTFEVKSTVPFSQPFTVDPANPPPVRDYEPFFSKLKTGITGKEALNQAEVA  590



>ref|XP_007203005.1| hypothetical protein PRUPE_ppa017382mg, partial [Prunus persica]
 gb|EMJ04204.1| hypothetical protein PRUPE_ppa017382mg, partial [Prunus persica]
Length=215

 Score =   238 bits (608),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 140/172 (81%), Gaps = 15/172 (9%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAY+K+PITPR V  GSAG+TRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  56   FKLPLSSIRAYLKEPITPRLVRGGSAGITRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  115

Query  536  G-EDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYA  360
              EDL+RESGIPYTIVRPCALTEEPAGA+LIFDQGDNIT               +E  Y+
Sbjct  116  QEEDLIRESGIPYTIVRPCALTEEPAGANLIFDQGDNIT-----------VYNQIEDHYS  164

Query  359  CDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
                F VKSV+PFSEP+TVDP+NPPP+KDY+VYFKTLK+GITGKE LE  PV
Sbjct  165  L---FVVKSVVPFSEPFTVDPQNPPPDKDYNVYFKTLKDGITGKEILEQDPV  213



>ref|XP_008242153.1| PREDICTED: uncharacterized protein LOC103340512, partial [Prunus 
mume]
Length=200

 Score =   233 bits (593),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IR+Y+K+PITPRF+HVGSAG+TRP+R GLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  76   FKLPLSSIRSYLKEPITPRFIHVGSAGITRPDRAGLDLSKQPPAVRLNKELDFILTFKLK  135

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGA+LIFDQGDNITGKISREEVA+ICVAALESPYA 
Sbjct  136  GEDLIRESGIPYTIVRPCALTEEPAGANLIFDQGDNITGKISREEVAQICVAALESPYAS  195

Query  356  DKTFE  342
             KTFE
Sbjct  196  GKTFE  200



>ref|XP_007025317.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY27939.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=560

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 123/126 (98%), Gaps = 0/126 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S IRAYIKDPITPRFVHV SAGVTRP+RPG+DLSKQPPAVRLNK+LGF+LTFKLK
Sbjct  431  FELPVSSIRAYIKDPITPRFVHVSSAGVTRPDRPGIDLSKQPPAVRLNKDLGFVLTFKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPYTIVRPCALTEEPAGADLIFDQGDNI GKISREE+ARIC+AALESPYAC
Sbjct  491  GEDLIRESGIPYTIVRPCALTEEPAGADLIFDQGDNIMGKISREEIARICIAALESPYAC  550

Query  356  DKTFEV  339
            DKTFE+
Sbjct  551  DKTFEM  556



>ref|XP_008790014.1| PREDICTED: uncharacterized protein LOC103707347 isoform X2 [Phoenix 
dactylifera]
Length=579

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYI +PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILT+KLK
Sbjct  431  FQLPLSSIRAYINEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTYKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGKISREEVARIC+AALESP+AC
Sbjct  491  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICIAALESPHAC  550

Query  356  DKTFEVKSVI  327
             KTFEV  ++
Sbjct  551  GKTFEVWHLL  560



>ref|XP_008790015.1| PREDICTED: uncharacterized protein LOC103707347 isoform X3 [Phoenix 
dactylifera]
Length=572

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLPLS IRAYI +PITPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILT+KLK
Sbjct  431  FQLPLSSIRAYINEPITPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTYKLK  490

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESGIPY I+RPCALTEEPAGADLIFDQGDNITGKISREEVARIC+AALESP+AC
Sbjct  491  GEDLIRESGIPYAIIRPCALTEEPAGADLIFDQGDNITGKISREEVARICIAALESPHAC  550

Query  356  DKTFE  342
             KTFE
Sbjct  551  GKTFE  555



>ref|XP_008245276.1| PREDICTED: uncharacterized protein LOC103343393, partial [Prunus 
mume]
Length=163

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 127/162 (78%), Gaps = 11/162 (7%)
 Frame = -2

Query  659  FVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIVRPCA  480
            F+ VGSAG+TRP+RPGLDLSKQPPAVRLNKEL FILTFKLKGE L+RESGIPYTIVRPCA
Sbjct  1    FISVGSAGITRPDRPGLDLSKQPPAVRLNKELDFILTFKLKGEYLIRESGIPYTIVRPCA  60

Query  479  LTEEPAGADLIFDQGDNITGKISREEVARICVAALES----------PYACDKTFEVKSV  330
            LTEEPAGA+LIF+QGDNIT      ++   C   L S           Y    T+++ +V
Sbjct  61   LTEEPAGANLIFNQGDNITVDTWHAQLHPDCTVGLLSNGYIFKWKIINYLSSCTYKL-TV  119

Query  329  IPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            +PFSEP+TVDP+NPPPEKDY+VYFKTLK+GITGKE LE  PV
Sbjct  120  VPFSEPFTVDPQNPPPEKDYNVYFKTLKDGITGKEILEQDPV  161



>gb|EMT20673.1| hypothetical protein F775_52263 [Aegilops tauschii]
Length=570

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 120/170 (71%), Gaps = 38/170 (22%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S IRAYI +PITPRFVH                                      
Sbjct  436  FELPFSSIRAYINEPITPRFVH--------------------------------------  457

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+PYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVAR+CVAAL SP A 
Sbjct  458  GEDLIRESGVPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVARLCVAALASPSAV  517

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
             KTFEVKS +PFSEP+ +DP NPPPEKDY+VYFK LK+GITGKE+LE TP
Sbjct  518  GKTFEVKSTVPFSEPFVIDPSNPPPEKDYEVYFKELKDGITGKEALEGTP  567



>gb|AFW65987.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=136

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  542  LKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPY  363
             +GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREEVARICVAAL SP 
Sbjct  22   FQGEDLIRESGIPYTIVRPCALTEEPAGADLMFDQGDNITGKISREEVARICVAALASPD  81

Query  362  ACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            A  KTFEVKS +PFSEPY +DP NPPPEKDY+VYFK LKEGITGKE+LE TP
Sbjct  82   AVGKTFEVKSTVPFSEPYVIDPANPPPEKDYEVYFKELKEGITGKEALEATP  133



>ref|XP_007207983.1| hypothetical protein PRUPE_ppa015737mg [Prunus persica]
 gb|EMJ09182.1| hypothetical protein PRUPE_ppa015737mg [Prunus persica]
Length=192

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  677  DPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYT  498
            DP    FVHVGSAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLKGE+L+ ESGIPYT
Sbjct  36   DPSNIVFVHVGSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLKGENLIWESGIPYT  95

Query  497  IVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKS  333
            IVRPCALTEE AGAD IFDQGDNITGKISREEVA+ICVAALESPYA  KTFEV +
Sbjct  96   IVRPCALTEELAGADRIFDQGDNITGKISREEVAQICVAALESPYASGKTFEVTA  150



>gb|AFW65985.1| hypothetical protein ZEAMMB73_939804 [Zea mays]
Length=510

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -2

Query  542  LKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPY  363
            L+GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNITGKISREEVARICVAAL SP 
Sbjct  396  LQGEDLIRESGIPYTIVRPCALTEEPAGADLMFDQGDNITGKISREEVARICVAALASPD  455

Query  362  ACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTP  207
            A  KTFEVKS +PFSEPY +DP NPPPEKDY+VYFK LKEGITGKE+LE TP
Sbjct  456  AVGKTFEVKSTVPFSEPYVIDPANPPPEKDYEVYFKELKEGITGKEALEATP  507



>ref|XP_008241855.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103340237 
[Prunus mume]
Length=201

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = -2

Query  659  FVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIVRPCA  480
            FVH+GSAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLKGEDL+RESGIPYTIVRPCA
Sbjct  2    FVHLGSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLKGEDLIRESGIPYTIVRPCA  61

Query  479  LTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVIPFSEPYTVD  300
            LTEEPAGADLIF Q DN+TGKISREEVA+ICVAALESPYA   +  V S    +   T  
Sbjct  62   LTEEPAGADLIFYQXDNVTGKISREEVAQICVAALESPYAFPNSNIVASYNVTAADLTAS  121

Query  299  PENPPPEKDYDVYFKTLKEGITGKESLEP  213
             +NP        +   ++  I   ESL P
Sbjct  122  GDNPKQINQVHCFADYVEPLIEFIESLPP  150



>gb|EMS56081.1| putative complex I intermediate-associated protein 30 [Triticum 
urartu]
Length=769

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 112/161 (70%), Gaps = 38/161 (24%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP S I+AYI +PITPRF+H                                      
Sbjct  586  FELPFSSIKAYISEPITPRFIH--------------------------------------  607

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GEDL+RESG+PYTIVRPCALTEEPAGADLIF+QGDNITGKISREEVAR+CVAAL SP A 
Sbjct  608  GEDLIRESGVPYTIVRPCALTEEPAGADLIFEQGDNITGKISREEVARLCVAALASPSAV  667

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGIT  234
             KTFEVKS +PFSEP+ +DP NPPPEKDY+VYFK LK+GIT
Sbjct  668  GKTFEVKSTVPFSEPFVIDPSNPPPEKDYEVYFKELKDGIT  708



>ref|XP_001700919.1| protein with predicted nucleoside-diphosphate-sugar epimerase 
activity [Chlamydomonas reinhardtii]
 gb|EDP07173.1| protein with predicted nucleoside-diphosphate-sugar epimerase 
activity [Chlamydomonas reinhardtii]
Length=461

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 122/171 (71%), Gaps = 9/171 (5%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP + I AY+   + PRFVHV SAGVTRP RPG+D++++PPAV+LN  LG ILT+KL 
Sbjct  262  FRLPFTSIAAYLPAGVPPRFVHVSSAGVTRPNRPGIDVNQEPPAVKLNDTLGGILTWKLA  321

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R+SG+P+ +VRP ALTEEP G  L  DQGD + GKISR++VA +CVA L  P A 
Sbjct  322  GEDSLRDSGVPFAVVRPTALTEEPGGMPLELDQGDTVKGKISRDDVADLCVALLGCPAAT  381

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKE-----GITGKESL  219
            + TFEVKS +PFS+P+T  PE   P +D   +F TL +     G+TG+  L
Sbjct  382  NTTFEVKSTVPFSQPWT-GPEPSAPRRD---WFATLNQARLRPGVTGRTVL  428



>ref|XP_008245335.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Prunus mume]
Length=305

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 96/111 (86%), Gaps = 5/111 (5%)
 Frame = -2

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            G DL+RESGIPYTIVRPCALTEEPAG DLIFDQGDNITGKISREEV +ICVAALESPYA 
Sbjct  198  GGDLIRESGIPYTIVRPCALTEEPAGVDLIFDQGDNITGKISREEVVQICVAALESPYAS  257

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
             KTFEVKSV+PFS     D +NP PEKDY+VYFKTLK+GITGKE LE  PV
Sbjct  258  GKTFEVKSVVPFS-----DRQNPTPEKDYNVYFKTLKDGITGKEILEQDPV  303



>ref|XP_002522251.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40109.1| conserved hypothetical protein [Ricinus communis]
Length=530

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S I+A+IKDPITPR VHV SAGVTRP+RPGLDLSKQPPAVRLNKEL FILTFKLK
Sbjct  432  FQLPVSSIKAFIKDPITPRLVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELDFILTFKLK  491

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNIT  423
            GEDL+RESGIPY IVRPCALTEEPAGADLIFDQGDNIT
Sbjct  492  GEDLIRESGIPYAIVRPCALTEEPAGADLIFDQGDNIT  529



>gb|KIY97781.1| hypothetical protein MNEG_10183 [Monoraphidium neglectum]
Length=287

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP++++  Y+  P+TPR VHV SAGVTRP RPG+++  +PPAV+LN  LG +LT+KL 
Sbjct  92   FQLPITEVTGYLASPVTPRLVHVSSAGVTRPNRPGINVDVEPPAVKLNDALGGLLTWKLA  151

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESG+P  +VRPCALTEE     L  DQGD I GKISR +V+ + VA L+SP A 
Sbjct  152  GEDAIRESGVPAVVVRPCALTEEAGRMPLEIDQGDVIKGKISRADVSELVVALLDSPAAV  211

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFK--TLKEGITGK  228
              TFE+KS +PFS+P+  +     P +D+    +   L  G+TGK
Sbjct  212  GTTFEIKSTVPFSQPWGEEDAAQQPPRDWQSTIQGAGLVPGVTGK  256



>ref|WP_026098965.1| NADH:ubiquinone oxidoreductase [Oscillatoria sp. PCC 10802]
Length=496

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 109/157 (69%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL L  I+AY    I PRFV V SAGVTRP RPGL L ++PPAVRLN +LG ILT+KL+
Sbjct  349  FQLQLESIKAY-GSTILPRFVQVSSAGVTRPGRPGLKLEEEPPAVRLNDQLGGILTWKLR  407

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SG+PYTI+RPCA+TEEP G  LIFDQGDNI GK+SRE++A +CV AL  P AC
Sbjct  408  GEDAIRASGLPYTIIRPCAMTEEPGGKALIFDQGDNIKGKVSREDIAELCVRALSEPKAC  467

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEV+            P    PE D++  F  LK
Sbjct  468  NVTFEVRE----------SPNGGSPE-DWETLFAGLK  493



>gb|EPS64358.1| hypothetical protein M569_10423, partial [Genlisea aurea]
Length=490

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LP+S I AY+K+P+T  F+HV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILT+KLK
Sbjct  393  FELPISAITAYVKEPVTAGFIHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTYKLK  452

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNIT  423
            GEDL+RESGIPYTIVRPCALTEEPAGADL+FDQGDNIT
Sbjct  453  GEDLIRESGIPYTIVRPCALTEEPAGADLVFDQGDNIT  490



>ref|WP_026735574.1| NADH:ubiquinone oxidoreductase [Fischerella sp. PCC 9605]
Length=494

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 109/156 (70%), Gaps = 12/156 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY  + + P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KL+
Sbjct  347  FTLQLESIKAYGGETL-PQFILVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTI+RPCALTEEP G  LIF+QGDNI GKISRE+VA ICV  L+ P AC
Sbjct  406  GEDSLRESGIPYTIIRPCALTEEPGGKSLIFEQGDNIRGKISREDVAEICVQVLQQPQAC  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTL  249
            + TFEVK           + EN     D+   F  L
Sbjct  466  NVTFEVK-----------EGENHANSIDWQRLFSQL  490



>ref|WP_015176136.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Oscillatoria nigro-viridis]
 gb|AFZ06842.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Oscillatoria nigro-viridis PCC 7112]
Length=487

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 108/157 (69%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL L  I+A     + PR V V SAGVTRP RPG++L ++PPAVR+N  LG ILT+KLK
Sbjct  343  FQLELESIKADGGQTL-PRVVMVSSAGVTRPGRPGINLEEEPPAVRMNDMLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SGIPYT+VRPCALTEEP G  LIF+QGDNI GK+SRE++A +CV ALE P AC
Sbjct  402  GEDCVRSSGIPYTVVRPCALTEEPGGKALIFEQGDNIRGKVSREDIAELCVQALEQPQAC  461

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK           + EN    +D+   F  +K
Sbjct  462  NVTFEVK-----------EGENASSPEDWQALFSGVK  487



>ref|XP_008230832.1| PREDICTED: uncharacterized protein LOC103330068 [Prunus mume]
Length=134

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 100/147 (68%), Gaps = 38/147 (26%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+LPLS IRAY+K+PITPRFVH+G AGVTRP+RPGLDL+KQPP VRLNKEL FILTFKLK
Sbjct  20   FKLPLSSIRAYLKEPITPRFVHLGFAGVTRPDRPGLDLNKQPPVVRLNKELDFILTFKLK  79

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
                                                   KISREEVA+ICVAALESPYA 
Sbjct  80   --------------------------------------DKISREEVAQICVAALESPYAS  101

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEK  276
             KTFEVKSV+PFSEP+TVDP+ PPP +
Sbjct  102  GKTFEVKSVVPFSEPFTVDPQYPPPRE  128



>ref|WP_026721354.1| NADH:ubiquinone oxidoreductase [Fischerella sp. PCC 9431]
Length=495

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY  + + P+F+ V SAGVTRP RPG++L ++PPAVRLN ELG ILT+KLK
Sbjct  347  FALQLESIKAYGGENL-PQFILVSSAGVTRPGRPGINLEEEPPAVRLNDELGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SGIPYTI+RPCALTEE  G   IF+QGDNI GKISRE+VA ICV AL+ P AC
Sbjct  406  GEDSVRASGIPYTIIRPCALTEEAGGKSFIFEQGDNIRGKISREDVAEICVQALKQPQAC  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|WP_015180824.1| NmrA-like family protein [Microcoleus sp. PCC 7113]
 gb|AFZ16661.1| NmrA-like family protein [Microcoleus sp. PCC 7113]
Length=496

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 104/139 (75%), Gaps = 1/139 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ + SAGVTRP RPG++L ++PPAVR+N +LG ILT+KL+
Sbjct  346  FALQVESIKAY-GGATKPQFIMISSAGVTRPGRPGINLEEEPPAVRMNNQLGGILTWKLR  404

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VRESG+PYTI+RPCALTEEP G  L+F+QGDNI GK+SRE++A +C+  LE P AC
Sbjct  405  GEDAVRESGVPYTIIRPCALTEEPGGKGLVFEQGDNIRGKVSREDIAELCLQVLEQPKAC  464

Query  356  DKTFEVKSVIPFSEPYTVD  300
            + TFEVK    F+  +  D
Sbjct  465  NVTFEVKEADSFNSFHNWD  483



>ref|WP_015116675.1| NmrA-like family protein [Rivularia sp. PCC 7116]
 gb|AFY53097.1| NmrA-like family protein [Rivularia sp. PCC 7116]
Length=492

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 113/157 (72%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L + +I+AY    + P+FV V SAGVTRP RPG++L ++PPAV+LN +LG ILT+KLK
Sbjct  340  FALEVEEIKAYGGKEL-PQFVLVSSAGVTRPGRPGINLEEEPPAVKLNDQLGGILTWKLK  398

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R S IPYTI+RPCALTEEP G +LIF+QGDNI GKISRE++A++CV +L+ P+AC
Sbjct  399  GEDSLRASEIPYTIIRPCALTEEPGGKELIFEQGDNIKGKISREDIAKLCVQSLQQPFAC  458

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK             EN     D++  FKT+ 
Sbjct  459  NVTFEVKQ-----------GENNASYIDWEELFKTVN  484



>ref|WP_015146863.1| NmrA-like family protein [Oscillatoria acuminata]
 gb|AFY80213.1| NmrA-like family protein [Oscillatoria acuminata PCC 6304]
Length=499

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  ++AY   P  PRF+ V SAGVTRP RPGLDL  +PPAVR+N++LG ILT+KL+
Sbjct  348  FQLQIHSLKAY-GGPSLPRFIQVSSAGVTRPGRPGLDLESEPPAVRMNEQLGGILTWKLR  406

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +R SG+PYTI+RPCALTEEP G  LIF+QGDNI G++SRE++A +CV ALE   AC
Sbjct  407  GEEAIRASGLPYTIIRPCALTEEPGGDGLIFEQGDNIKGQVSREDIAELCVQALELSEAC  466

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  467  NMTFEVKA  474



>ref|WP_015141536.1| NmrA-like family protein [Nostoc sp. PCC 7524]
 gb|AFY51135.1| NmrA-like family protein [Nostoc sp. PCC 7524]
Length=492

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L+ I+AY     TP+F+ V SAGVTRP RPG++L  +PPAVRLN +LG ILT+KLK
Sbjct  345  FALQLASIKAY-GGSNTPQFILVSSAGVTRPGRPGINLEDEPPAVRLNDQLGGILTWKLK  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE  G  LIF+QGDNI GKISRE+VA++CV +L+ P AC
Sbjct  404  GEDSLRASGIPYTIIRPCALTEEVGGKALIFEQGDNIKGKISREDVAQLCVRSLQQPQAC  463

Query  356  DKTFEVKS  333
            + TFEVKS
Sbjct  464  NVTFEVKS  471



>ref|WP_017323313.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [cyanobacterium PCC 7702]
Length=494

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY    I P+FV V SAGVTRP RPG++L ++PPAVRLN++LG ILT+KLK
Sbjct  347  FALQIQSIKAY-GGEILPQFVLVSSAGVTRPGRPGINLDEEPPAVRLNEQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R+SGIPYTI+RPCALTEEP G  LIFDQGDNI GKISRE+VA ICV AL+ P A 
Sbjct  406  GEDSLRKSGIPYTIIRPCALTEEPKGKSLIFDQGDNIKGKISREDVAEICVQALKYPQAR  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NVTFEVK  472



>ref|WP_040937520.1| NADH:ubiquinone oxidoreductase [Prochloron didemni]
Length=496

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY   P TP+F+ + SAGVTRP RPGL+L+++PPAVR+NK+LG ILT+KL+
Sbjct  350  FNLEIESIKAYGGKP-TPQFILISSAGVTRPGRPGLNLAEEPPAVRMNKQLGGILTWKLR  408

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR+SG+PYTIVRPCALTE+P    L+ +QGDN+ G++SRE +AR+CV A+E P AC
Sbjct  409  GEEVVRKSGLPYTIVRPCALTEKPGDKTLLVEQGDNMKGQVSREAIARLCVEAIELPSAC  468

Query  356  DKTFEVKSVIPFSEPYTVDPEN  291
            +KT EV+      EP TV+ +N
Sbjct  469  NKTLEVRET---GEPGTVNWQN  487



>ref|WP_027845680.1| NADH:ubiquinone oxidoreductase [Mastigocoleus testarum]
Length=497

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  +   P+FV V SAGVTRP RPG++L +QPPAV+LN +LG ILT+KLK
Sbjct  349  FNLQIESIKAYGSN--LPQFVLVSSAGVTRPGRPGINLDEQPPAVKLNDQLGGILTWKLK  406

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTI+RPCALTEE  G +LIFDQGDNITGK+ RE++A ICV ALE P A 
Sbjct  407  GEDSLRESGIPYTIIRPCALTEEAGGQELIFDQGDNITGKVPREDIAEICVQALEQPEAR  466

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  467  NVTFEVK  473



>ref|WP_007356111.1| MULTISPECIES: NmrA-like [Kamptonema]
 emb|CBN56906.1| NmrA-like [ [[Oscillatoria] sp. PCC 6506]
Length=472

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL L  I+AY +  +T RFV V SAGVTRP RPG++L ++PPAVR+N +LG ILT+KLK
Sbjct  343  FQLELEYIKAYGEQNLT-RFVMVSSAGVTRPGRPGINLEEEPPAVRMNDQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEEP G  L+FDQGDNI GK+SRE++A +CV ALE P   
Sbjct  402  GEDCLRSSGIPYTIIRPCALTEEPGGKALMFDQGDNIKGKVSREDIAELCVQALEEPKYS  461

Query  356  DKTFEVK  336
              TFEVK
Sbjct  462  RLTFEVK  468



>ref|WP_040943935.1| NADH:ubiquinone oxidoreductase [Prochloron didemni]
Length=496

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 111/142 (78%), Gaps = 4/142 (3%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY   P TP+F+ + SAGVTRP RPGL+L+++PPAVR+NK+LG ILT+KL+
Sbjct  350  FNLEIESIKAYGGKP-TPQFILISSAGVTRPGRPGLNLAEEPPAVRMNKQLGGILTWKLR  408

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR+SG+PYTIVRPCALTE+P    L+ +QGDN+ G++SRE +A++CV A+E P AC
Sbjct  409  GEEVVRKSGLPYTIVRPCALTEKPGDKTLLVEQGDNMKGQVSREAIAQLCVEAIELPSAC  468

Query  356  DKTFEVKSVIPFSEPYTVDPEN  291
            +KT EV+      EP TV+ +N
Sbjct  469  NKTLEVRET---GEPGTVNWQN  487



>ref|WP_009457802.1| MULTISPECIES: NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella]
 gb|EHC12311.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella sp. JSC-11]
Length=500

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  + + P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQVESIKAYGGETL-PQFILVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE  G  LIF+QGDNI GKISRE+VA IC+ AL+ P AC
Sbjct  406  GEDSLRASGIPYTIIRPCALTEEAGGKSLIFEQGDNIRGKISREDVAEICLQALQQPQAC  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NITFEVK  472



>ref|WP_039754165.1| NADH:ubiquinone oxidoreductase, partial [Hassallia byssoidea]
Length=448

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  + + P+FV V SAGVTRP RPG++L ++PPAVRLN ELG ILT+KLK
Sbjct  301  FALQVESIKAYGGETL-PQFVLVSSAGVTRPGRPGINLEEEPPAVRLNDELGGILTWKLK  359

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGI YTI+RPCALTEE  G +LIF+QGDNI GKISRE+VA +CV AL+   AC
Sbjct  360  GEDSLRESGIAYTIIRPCALTEEAGGKELIFEQGDNIRGKISREDVAELCVQALQLTKAC  419

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  420  NVTFEVK  426



>ref|WP_006634404.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Microcoleus vaginatus]
 gb|EGK85814.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Microcoleus vaginatus FGP-2]
Length=487

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 106/157 (68%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL L  ++A     + PRFV V SAGVTRP RPG++L ++PPAVR+N  LG ILT+KLK
Sbjct  343  FQLELESLKADGGQTL-PRFVMVSSAGVTRPGRPGINLEEEPPAVRMNDMLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR S IPYTIVRPCALTEEP G  LIF+QGDNI GK+SRE++A +CV AL  P AC
Sbjct  402  GEDCVRSSRIPYTIVRPCALTEEPGGKALIFEQGDNIRGKVSREDIAELCVEALAQPQAC  461

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK           + EN     D+   F  +K
Sbjct  462  NVTFEVK-----------EGENGSSPGDWQALFSGVK  487



>ref|WP_015205483.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Crinalium epipsammum]
 gb|AFZ15393.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Crinalium epipsammum PCC 9333]
Length=493

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 111/158 (70%), Gaps = 13/158 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ + SAGVTRP RPG++L+++PPAVR+N +LG ILT+KL+
Sbjct  347  FSLEIESIKAY-GGVAKPQFIMISSAGVTRPGRPGINLAEEPPAVRMNDQLGGILTWKLR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR+SGIPYTI+RPCALTEEP G  LIF+QGDNI GK+SRE++A++CV  LE P AC
Sbjct  406  GEDSVRDSGIPYTIIRPCALTEEPGGKQLIFEQGDNIKGKVSREDIAQLCVQVLEQPQAC  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKE  243
            + T EVK     SE   V+        ++D  F  LK 
Sbjct  466  NITLEVKE----SEDSGVN--------NWDNLFANLKH  491



>ref|WP_015206966.1| NmrA-like family protein [Cylindrospermum stagnale]
 gb|AFZ23710.1| NmrA-like family protein [Cylindrospermum stagnale PCC 7417]
Length=494

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 108/156 (69%), Gaps = 12/156 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY    ++P+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+K K
Sbjct  347  FALEVEAIKAY-DGEVSPQFVLVSSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKFK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE  G + IF+QGDNI GKISRE++A +CV AL+ P A 
Sbjct  406  GEDSLRSSGIPYTIIRPCALTEEAGGKEYIFEQGDNIRGKISREDIAELCVQALQQPTAS  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTL  249
            ++TFEVK+            EN P   D+   F  L
Sbjct  466  NRTFEVKA-----------GENSPNSIDWQKLFSQL  490



>ref|WP_016866205.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella muscicola]
Length=500

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  + + P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQVESIKAYGGETL-PQFILVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE  G  LIF+QGDNI GKISRE+VA IC+ AL  P AC
Sbjct  406  GEDSLRASGIPYTIIRPCALTEEAGGKSLIFEQGDNIRGKISREDVAEICLQALRQPQAC  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|XP_008225252.1| PREDICTED: uncharacterized protein LOC103324917 [Prunus mume]
Length=111

 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  479  LTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVIPFSEPYTVD  300
              EEPAGADLIFDQGDN+TGKISRE+ A+ICVAALESPYA  KTFEVKSV+PFSEP+TVD
Sbjct  18   FAEEPAGADLIFDQGDNVTGKISREQTAQICVAALESPYASGKTFEVKSVVPFSEPFTVD  77

Query  299  PENPPPEKDYDVYFKTLKEGITGKESLEPTPV  204
            P+NP PEKDY+VYFKTLK+GITGKE LE  PV
Sbjct  78   PQNPSPEKDYNVYFKTLKDGITGKEILEQDPV  109



>ref|WP_041032572.1| NADH:ubiquinone oxidoreductase [Tolypothrix campylonemoides]
 gb|KIJ78392.1| NADH:ubiquinone oxidoreductase [Tolypothrix campylonemoides VB511288]
Length=495

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 109/157 (69%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY    + P+FV V SAGVTRP RPG++L ++PPAV+LN +LG ILT+KLK
Sbjct  347  FALQVESIQAYGGTNL-PQFVLVSSAGVTRPGRPGINLDEEPPAVKLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTI+RPCALTEEP G + I +QGDNI GKISRE+VA++CV AL+   AC
Sbjct  406  GEDSLRESGIPYTIIRPCALTEEPGGKEFICEQGDNIRGKISREDVAKLCVEALQQKTAC  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK           + EN     D+   F  L+
Sbjct  466  NVTFEVK-----------EGENTASSIDWQRLFSQLQ  491



>ref|WP_017651686.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Microchaete sp. PCC 7126]
Length=500

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+ Y ++ + P+F+ V SAGVTRP RPGL+L +QPPAVRLN +LG ILT+KLK
Sbjct  347  FTLQVESIKGYSQNTL-PQFILVSSAGVTRPGRPGLNLDEQPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SGIPYTI+RPCALTEE  G +LI +QGDNI GKISRE+VA ICV AL+   A 
Sbjct  406  GEDSVRASGIPYTIIRPCALTEESGGQELILEQGDNIRGKISREDVAEICVQALQQITAS  465

Query  356  DKTFEVKS  333
             +TFEVKS
Sbjct  466  YQTFEVKS  473



>ref|XP_002949080.1| hypothetical protein VOLCADRAFT_89408 [Volvox carteri f. nagariensis]
 gb|EFJ50015.1| hypothetical protein VOLCADRAFT_89408 [Volvox carteri f. nagariensis]
Length=601

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 107/151 (71%), Gaps = 13/151 (9%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKL-  540
            F+LP ++I  Y+ + + PRFVHV SAGVTRP RPG+++ ++PPAV+LN  LG ILT+KL 
Sbjct  383  FRLPFARISTYLPEGVAPRFVHVSSAGVTRPNRPGINVDQEPPAVKLNDALGGILTWKLA  442

Query  539  ------------KGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVA  396
                        +GED +R SG+P+ +VRP ALTEEP G  +  DQGD + GKISRE+VA
Sbjct  443  VARAHLFPSHLARGEDALRASGVPFAVVRPTALTEEPGGMPVELDQGDTVKGKISREDVA  502

Query  395  RICVAALESPYACDKTFEVKSVIPFSEPYTV  303
             +CVA L  P A D TFE++S +PFS+P+T+
Sbjct  503  DLCVALLSCPSATDTTFEIRSTVPFSQPWTL  533



>gb|EWM29347.1| nadh:ubiquinone oxidoreductase complex i intermediate-associated 
protein 30 [Nannochloropsis gaditana]
Length=598

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 108/160 (68%), Gaps = 2/160 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYI--KDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFK  543
            F+L +  I AY+    P TPRFVH+ SAGV RP RPG+ L ++PPAVR+N  LG ILT+K
Sbjct  435  FKLVIQSIEAYMGPSAPRTPRFVHISSAGVERPGRPGVVLEEEPPAVRMNDMLGGILTYK  494

Query  542  LKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPY  363
            LKGE+ +R SG+PYTI+RPCALTEEPA   L  D GD I GK+SR++VAR+ V AL  P 
Sbjct  495  LKGEEAIRASGLPYTIIRPCALTEEPANMPLEVDVGDTIKGKVSRDDVARLAVYALACPE  554

Query  362  ACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKE  243
            A D TFEVKS + FS+ +T +     P  D    F  +K 
Sbjct  555  ATDLTFEVKSSLAFSQQWTAEDAARAPVTDMTQVFAQVKS  594



>ref|WP_017312960.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella sp. PCC 9339]
Length=493

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY  + +  +F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQLESIKAYGGESLA-QFILVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SGIPYTI+RPCALTEE  G  LIF+QGDNI GKISRE+VA ICV AL+ P A 
Sbjct  406  GEDSVRTSGIPYTIIRPCALTEEAGGKSLIFEQGDNIRGKISREDVAEICVQALKQPQAR  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|WP_044446747.1| NADH:ubiquinone oxidoreductase [Mastigocladus laminosus]
 gb|KIY14874.1| NADH:ubiquinone oxidoreductase [Mastigocladus laminosus UU774]
Length=493

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY  + +  +F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQLESIKAYGGESLA-QFILVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SGIPYTI+RPCALTEE  G  LIF+QGDNI GKISRE+VA ICV AL+ P A 
Sbjct  406  GEDSVRTSGIPYTIIRPCALTEEAGGKSLIFEQGDNIRGKISREDVAEICVQALKQPQAR  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|WP_016864210.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Fischerella muscicola]
Length=500

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  + + P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQVESIKAYGGESL-PQFILVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R S IPYTI+RPCALTEE  G  LIF+QGDNI GK+SRE+VA IC+ AL+ P AC
Sbjct  406  GEDSLRASRIPYTIIRPCALTEEAGGKSLIFEQGDNIRGKVSREDVAEICLQALKHPQAC  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NVTFEVK  472



>emb|CBN79682.1| conserved unknown protein [Ectocarpus siliculosus]
Length=476

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 118/170 (69%), Gaps = 5/170 (3%)
 Frame = -2

Query  716  FQLPLSQIRAYI----KDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILT  549
            F+L ++ I+A      ++    RFVH+ SAGVTRP RP LD+  +PPAVR+N+ L  +LT
Sbjct  288  FELTIASIKAVSIETSEEMQNSRFVHLSSAGVTRPGRPDLDMDTEPPAVRMNEMLSHLLT  347

Query  548  FKLKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALES  369
            +KLKGED++R+SGIP TI+RPCALTEEPAGA +I  QGD + GKISR+++A + V++L +
Sbjct  348  YKLKGEDVIRDSGIPATIIRPCALTEEPAGAPMIVGQGDYLKGKISRDDIAELAVSSLLT  407

Query  368  PYACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESL  219
            P A   TFEVKS + FS  +   P+  P  + Y      L++G+TGKE +
Sbjct  408  PEASGLTFEVKSDLAFSTLWQGAPQGAPA-RSYGDILGPLEQGVTGKEWM  456



>ref|WP_023067525.1| short chain dehydrogenase family protein [Lyngbya aestuarii]
 gb|ERT06302.1| short chain dehydrogenase family protein [Lyngbya aestuarii BL 
J]
Length=492

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY  +  +PRF+ + SAGVTRP +PGL+L ++PPAVR+N +LG ILT+KLK
Sbjct  343  FQLQIETIKAYGGEK-SPRFIQISSAGVTRPGKPGLNLEEEPPAVRMNDQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTEE  G  L F+QGD I G++SRE++A +C+ AL    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEEAGGKALTFEQGDTIKGQVSREDIAELCIQALNESQAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NVTFEVKA  469



>ref|WP_006530839.1| NmrA-like family protein [Gloeocapsa sp. PCC 73106]
 gb|ELR96214.1| NmrA-like family protein [Gloeocapsa sp. PCC 73106]
Length=473

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY K   TP+F+ + SAGVTRP RPG+DL K+PPAVRLN +LG ILT+KL 
Sbjct  328  FGLEVETIKAYGKQINTPQFILISSAGVTRPGRPGIDLEKEPPAVRLNDQLGGILTWKLA  387

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR SG+ YTI+RPCALTE+P    LIFDQGDNI G++SRE +A++C+  L +P A 
Sbjct  388  GEEVVRNSGLLYTIIRPCALTEKPGDKGLIFDQGDNIKGQVSREAIAQLCLQVLNNPEAV  447

Query  356  DKTFEVK  336
            +KTFEVK
Sbjct  448  NKTFEVK  454



>ref|WP_015113169.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc sp. PCC 7107]
 gb|AFY42954.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc sp. PCC 7107]
Length=494

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FSLQIESIKAY-NGKTAPQFVLVSSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTIVRPCALTEE  G ++IF+QGDNI GKISRE+VA ICV ALE     
Sbjct  406  GEDSLRVSGIPYTIVRPCALTEESGGQEVIFEQGDNIRGKISREDVAEICVQALEQSKVH  465

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  466  NVTFEVKA  473



>ref|WP_012412749.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc punctiforme]
 gb|ACC84813.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Nostoc punctiforme PCC 73102]
Length=494

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY    + P+F+ V SAGVTRP RPG++L ++PPAV+LN +LG ILT+KLK
Sbjct  347  FTLQLESIKAYGGTTL-PQFILVSSAGVTRPGRPGINLDEEPPAVKLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESG+PYTI+RPCALTEE  G +LI +QGDNI GKISRE+VA +CV AL+   AC
Sbjct  406  GEDSLRESGVPYTIIRPCALTEEVGGKELILEQGDNIKGKISREDVAELCVQALKIAKAC  465

Query  356  DKTFEVK  336
            + TFE+K
Sbjct  466  NVTFEIK  472



>gb|KIJ84806.1| NADH:ubiquinone oxidoreductase [Scytonema tolypothrichoides VB-61278]
Length=493

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 107/157 (68%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  ++AY    + P+FV V SAGVTRP RPG++L ++PPAV+LN +LG ILT+KLK
Sbjct  347  FALEVKSMKAYGGVNL-PQFVLVSSAGVTRPGRPGINLDEEPPAVKLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RESGIPYTI+RPCALTEE  G + IF+QGDNI GKISRE+VA++CV AL+   A 
Sbjct  406  GEDTLRESGIPYTIIRPCALTEEAGGKEFIFEQGDNIKGKISREDVAKLCVEALQQTKAS  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK             EN     D+   F  L+
Sbjct  466  NVTFEVKQ-----------GENTASSIDWQRLFSQLQ  491



>ref|WP_019492893.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 7103]
Length=493

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 12/159 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY   P+ P FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FSLEVETIKAYGGSPL-PGFVLVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SG+ YTI+RPCALTEE  G  L+F+QGDNI GKISR++VA +CV AL+   AC
Sbjct  406  GEDSVRASGVNYTIIRPCALTEEVGGKQLVFEQGDNIRGKISRDDVAEVCVQALQYDKAC  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEG  240
            + TFEVK+            E+     D+   F ++++G
Sbjct  466  NVTFEVKAT-----------EDKADYIDWQQLFASIQKG  493



>ref|WP_017318111.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Mastigocladopsis repens]
Length=495

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQVESIKAYGGANF-PQFILVSSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +RESGIPYTI+RPCALTEEP G + I +QGDNI GKISRE+VA++CV AL+   AC
Sbjct  406  GEESLRESGIPYTIIRPCALTEEPGGKEFIVEQGDNIRGKISREDVAQLCVEALQQTKAC  465

Query  356  DKTFEVK  336
              TFEVK
Sbjct  466  HVTFEVK  472



>ref|WP_012599050.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7424]
 gb|ACK70106.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7424]
Length=494

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F + +  I+AY   P  P+F+ + SAGVTRP RPG++L ++PPAVR+N +LG ILT+KL+
Sbjct  346  FGIEIESIKAYGGKP-KPQFIMISSAGVTRPGRPGINLEEEPPAVRMNDQLGGILTWKLR  404

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+++R SG+ YTIVRPCALTE+PA   LIFDQGDN+ G++SRE +A++CV ALE P AC
Sbjct  405  GEEVIRSSGLSYTIVRPCALTEKPADKGLIFDQGDNLKGQVSREAIAQLCVEALELPSAC  464

Query  356  DKTFEVK  336
            +KTFEV+
Sbjct  465  NKTFEVR  471



>ref|WP_009782432.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW38977.1| hypothetical protein L8106_01642 [Lyngbya sp. PCC 8106]
Length=492

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY      PRF+ + SAGVTRP +PGL+L ++PPAVR+N +LG ILT+KLK
Sbjct  343  FQLQIETIKAYGGQKY-PRFIQISSAGVTRPGKPGLNLEEEPPAVRMNDQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTEE  G  L F+QGD I GK+SR+++A +C+ AL    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEEAGGKALTFEQGDTIKGKVSRDDIAELCIQALNESQAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NVTFEVKA  469



>ref|WP_008183365.1| complex I intermediate-associated protein, NmrA-like family [Moorea 
producens]
 gb|EGJ33004.1| complex I intermediate-associated protein, NmrA-like family [Moorea 
producens 3L]
Length=491

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY      P+F+ + SAGVTRP RPG++L ++PPAVR+N +LG ILT+KL+
Sbjct  345  FVLQLETIKAY-GGITKPQFIMISSAGVTRPGRPGINLEEEPPAVRMNDQLGGILTWKLR  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR+SG+ YTI+RPCALTEEP G  L+F QGDNI GK+SRE++A +C+  LE P AC
Sbjct  404  GEDAVRDSGVSYTIIRPCALTEEPGGQALVFAQGDNIRGKVSREDIAELCIQVLEQPKAC  463

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  464  NVTFEVK  470



>gb|AHJ26864.1| hypothetical protein NSP_5140 [Nodularia spumigena CCY9414]
Length=474

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  +   P+FV + SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  322  FALQIESIKAYGGESF-PQFVLISSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLK  380

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SGIPYTI+RPCALTEE  G +LIF+QGDNI GKISR++VA +CV +L+  +A 
Sbjct  381  GEDSVRASGIPYTIIRPCALTEEAGGKELIFEQGDNIRGKISRDDVAELCVRSLQQSHAH  440

Query  356  DKTFEVKS  333
            + T EVKS
Sbjct  441  NITLEVKS  448



>ref|WP_006196301.1| hypothetical protein [Nodularia spumigena]
 gb|EAW45470.1| hypothetical protein N9414_03960 [Nodularia spumigena CCY9414]
Length=499

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  +   P+FV + SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQIESIKAYGGESF-PQFVLISSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED VR SGIPYTI+RPCALTEE  G +LIF+QGDNI GKISR++VA +CV +L+  +A 
Sbjct  406  GEDSVRASGIPYTIIRPCALTEEAGGKELIFEQGDNIRGKISRDDVAELCVRSLQQSHAH  465

Query  356  DKTFEVKS  333
            + T EVKS
Sbjct  466  NITLEVKS  473



>ref|WP_026796563.1| NADH:ubiquinone oxidoreductase [Planktothrix prolifica]
Length=489

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY    + PRFV V SAGVTRP +PGL+L+++PPAVRLN++LG ILT+KLK
Sbjct  343  FQLEIESIKAY-GGTVLPRFVQVSSAGVTRPGKPGLNLAEEPPAVRLNEQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTE P G+ L F QGD I G++SR+++A +C+  L    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEVPGGSALKFAQGDTIKGQVSRDDIAELCIQVLTQAPAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NTTFEVKT  469



>ref|WP_012626990.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7425]
 gb|ACL43899.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7425]
Length=500

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY    + PR++ V SAGVTRP+RPGL+L ++PPAV+LN++LG ILT+KL+
Sbjct  353  FQLQIESIKAY-SSKLPPRWIMVSSAGVTRPDRPGLNLEEEPPAVKLNQQLGGILTWKLR  411

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
             EDLVR+SG+PYTI+RPCALTEEP    L FDQGDN+ GK+SRE++A +CV AL+ P A 
Sbjct  412  AEDLVRQSGLPYTIIRPCALTEEPGQQRLRFDQGDNLKGKVSREDIAELCVQALKLPQAH  471

Query  356  DKTFEV  339
            + TFEV
Sbjct  472  NCTFEV  477



>ref|WP_026787787.1| NADH:ubiquinone oxidoreductase [Planktothrix rubescens]
Length=489

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY    + PRFV V SAGVTRP +PGL+L+++PPAVRLN++LG ILT+KLK
Sbjct  343  FQLEIESIKAY-GGKVLPRFVQVSSAGVTRPGKPGLNLAEEPPAVRLNEQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTE P G+ L F QGD I G++SR+++A +C+  L    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEVPGGSALKFAQGDTIKGQVSRDDIAELCIQVLTQAPAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NTTFEVKT  469



>ref|WP_027255199.1| NADH:ubiquinone oxidoreductase [Planktothrix agardhii]
Length=489

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY    + PRFV V SAGVTRP +PGL+L+++PPAVRLN++LG ILT+KLK
Sbjct  343  FQLEIESIKAY-GGKVLPRFVQVSSAGVTRPGKPGLNLAEEPPAVRLNEQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTE P G+ L F QGD I G++SR+++A +C+  L    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEVPGGSALKFAQGDTIKGQVSRDDIAELCIQVLTQAPAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NTTFEVKT  469



>ref|WP_015216704.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Anabaena cylindrica]
 gb|AFZ60088.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Anabaena cylindrica PCC 7122]
Length=494

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 110/157 (70%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+A+  + + P+FV + SAGVTRP RPG++L ++PPAVRLN +LG ILT+KL+
Sbjct  347  FALEIESIKAFGGESL-PQFVFISSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R+SGIPYTI+RPCALTE   G +LIF+QGDNI GKISR++VA IC+ +L+ P A 
Sbjct  406  GEDSLRDSGIPYTIIRPCALTEATGGKELIFEQGDNIRGKISRDDVAEICIQSLQQPKAR  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK             EN     +++  F +LK
Sbjct  466  NLTFEVKQ-----------GENNANSMNWNQIFSSLK  491



>gb|KIE07000.1| NADH:ubiquinone oxidoreductase [Tolypothrix bouteillei VB521301]
Length=492

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY K  + P+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  346  FSLQVESIKAYGKQ-VLPQFVLVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  404

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +R+SGIPYTIVRPCALTEE  G +LI  QGDNI GKISRE+VA++CV AL+   A 
Sbjct  405  GEESLRQSGIPYTIVRPCALTEELGGKELIVAQGDNIKGKISREDVAKLCVEALQQSQAR  464

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  465  NVTFEVK  471



>ref|WP_011319070.1| hypothetical protein [Anabaena variabilis]
 gb|ABA21904.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=493

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 100/134 (75%), Gaps = 2/134 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY     TP+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FALQLEFIKAY-GGANTPKFVLVSSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEEP    LIF+QGDNI GKISRE+VA +CV AL+    C
Sbjct  406  GEDSLRASGIPYTIIRPCALTEEPGSKALIFEQGDNIRGKISREDVAELCVQALQQK-RC  464

Query  356  DKTFEVKSVIPFSE  315
            + TFEVK     +E
Sbjct  465  NVTFEVKEGTNVAE  478



>ref|WP_015143937.1| NmrA-like family protein [Pleurocapsa minor]
 gb|AFY77634.1| NmrA-like family protein [Pleurocapsa sp. PCC 7327]
Length=491

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ V SAGVTRP RPGL+L ++PPAVRLN +LG ILT+KL+
Sbjct  345  FSLEIESIKAY-GGQAKPQFIMVSSAGVTRPGRPGLNLEEEPPAVRLNDQLGGILTWKLQ  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ VR+SGI YTIVRPCALTE+P    L+FDQGDN+ G++SRE +A +C+ AL+ P AC
Sbjct  404  GEEAVRQSGINYTIVRPCALTEKPGNKVLVFDQGDNMKGQVSREAIAELCIQALQIPEAC  463

Query  356  DKTFEVK  336
            +KTFEV+
Sbjct  464  NKTFEVR  470



>gb|EFA71481.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=292

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY  + ++ +FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  142  FTLELESIQAYGGEGVS-QFVLVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  200

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R+S IPYTI+RPCALTE+  G +LI DQGDNI GKISR++VA IC+ +L+ P A 
Sbjct  201  GEDSLRDSQIPYTIIRPCALTEDRGGKELIVDQGDNIRGKISRDDVAEICLQSLQQPQAK  260

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  261  NITFEVK  267



>ref|XP_005855477.1| nadh:ubiquinone oxidoreductase complex i intermediate-associated 
protein 30 [Nannochloropsis gaditana CCMP526]
 gb|EKU20879.1| nadh:ubiquinone oxidoreductase complex i intermediate-associated 
protein 30 [Nannochloropsis gaditana CCMP526]
Length=1014

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYI--KDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFK  543
            F+L +  I AY+    P TPRFVH+ SAGV RP RPG+ L ++PPAVR+N  LG ILT+K
Sbjct  435  FKLVIQSIEAYMGPSAPRTPRFVHISSAGVERPGRPGVVLEEEPPAVRMNDMLGGILTYK  494

Query  542  LKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPY  363
            LKGE+ +R SG+PYTI+RPCALTEEPA   L  D GD I GK+SR++VAR+ V AL  P 
Sbjct  495  LKGEEAIRASGLPYTIIRPCALTEEPANMPLEVDVGDTIKGKVSRDDVARLAVYALACPE  554

Query  362  ACDKTFEVKSVIPFSEPYTVDPENPPPEKDY  270
            A D TFEVKS + FS+ +T +     P  D 
Sbjct  555  ATDLTFEVKSSLAFSQQWTAEDAARAPVTDM  585



>ref|WP_010999152.1| hypothetical protein [Nostoc sp. PCC 7120]
 dbj|BAB76725.1| all5026 [Nostoc sp. PCC 7120]
Length=493

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 101/134 (75%), Gaps = 2/134 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY     TP+FV V SAGVTRP RPG++L ++PPAVRLN++LG ILT+KLK
Sbjct  347  FALQMEFIKAY-GGANTPKFVLVSSAGVTRPGRPGINLDEEPPAVRLNEQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE  G  LIF+QGDNI GKISRE+VA +C+ AL+    C
Sbjct  406  GEDSLRASGIPYTIIRPCALTEEAGGKALIFEQGDNIRGKISREDVAELCIQALQQK-RC  464

Query  356  DKTFEVKSVIPFSE  315
            + TFEVK     +E
Sbjct  465  NVTFEVKEGTNVAE  478



>ref|WP_042154417.1| NADH:ubiquinone oxidoreductase [Planktothrix agardhii]
 gb|KEI67346.1| NmrA-like protein [Planktothrix agardhii NIVA-CYA 126/8]
Length=489

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY    + PRFV V SAGVTRP +PGL+L+++PPAVRLN++LG ILT+KLK
Sbjct  343  FQLEIESIKAY-GGKVLPRFVQVSSAGVTRPGKPGLNLAEEPPAVRLNEQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTE P G+   F QGD I G++SR+++A +C+  L    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEVPGGSAFKFAQGDTIKGQVSRDDIAELCIQVLTQAPAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NTTFEVKT  469



>ref|WP_027250028.1| NADH:ubiquinone oxidoreductase [Planktothrix agardhii]
Length=489

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY    + PRFV V SAGVTRP +PGL+L+++PPAVRLN++LG ILT+KLK
Sbjct  343  FQLEIESIKAY-GGKVLPRFVQVSSAGVTRPGKPGLNLAEEPPAVRLNEQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTE P G+   F QGD I G++SR+++A +C+  L    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEVPGGSAFKFAQGDTIKGQVSRDDIAELCIQVLTQAPAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NTTFEVKA  469



>ref|WP_026795424.1| MULTISPECIES: NADH:ubiquinone oxidoreductase [Planktothrix]
Length=489

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I++Y    + PRFV V SAGVTRP +PGL+L+++PPAVRLN +LG ILT+KLK
Sbjct  343  FQLEIESIKSY-GGTVLPRFVQVSSAGVTRPGKPGLNLAEEPPAVRLNDQLGGILTWKLK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R SGIPYTI+RPCALTE P G+ L F QGD I G++SR+++A +C+  L    AC
Sbjct  402  GEDVIRSSGIPYTIIRPCALTEVPGGSALKFAQGDTIKGQVSRDDIAELCIQVLTQAPAC  461

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  462  NTTFEVKT  469



>ref|WP_006623969.1| MULTISPECIES: NmrA-like protein [Arthrospira]
 emb|CCE18300.1| putative nucleoside-diphosphate-sugar epimerase [Arthrospira 
sp. PCC 8005]
 gb|EKD08188.1| NmrA-like protein [Arthrospira platensis C1]
 emb|CDM97045.1| putative nucleoside-diphosphate-sugar epimerase [Arthrospira 
sp. PCC 8005]
Length=493

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+AY  +   PR V V SAGVTRP +PGL+L ++PPAVR+N +LG ILT+KL+
Sbjct  344  FQLQIESIKAY-GNAAKPRLVMVSSAGVTRPGKPGLNLDEEPPAVRMNDQLGGILTWKLR  402

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR S IPYTI+RPCA+TEEP G  L+FDQGD I GK+SRE++A +C+ AL  P A 
Sbjct  403  GENVVRSSNIPYTIIRPCAMTEEPGGEALMFDQGDTIKGKVSREDIAELCIKALNQPSAT  462

Query  356  DKTFEVKSV  330
            + T EVK++
Sbjct  463  NVTVEVKAL  471



>ref|WP_037224336.1| NADH:ubiquinone oxidoreductase [Richelia intracellularis]
 emb|CDN16871.1| similar to nucleoside-diphosphate-sugar epimerases [Richelia 
intracellularis]
Length=492

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 105/157 (67%), Gaps = 13/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  +   P+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  346  FNLQVESIKAYGAN--FPQFVLVSSAGVTRPNRPGINLDEEPPAVRLNDQLGGILTWKLK  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE  +R S IPYTI+RPCALTEE  G ++I  QGDNI GKISRE VA +CVAAL+   AC
Sbjct  404  GEYSLRNSRIPYTIIRPCALTEEAGGKEIIVAQGDNIKGKISRENVAELCVAALQKSKAC  463

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + T E+K           + EN     D+ V F +L+
Sbjct  464  NVTLEIK-----------EGENKVSHTDWQVLFSSLQ  489



>ref|WP_015131038.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 7507]
 gb|AFY35243.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 7507]
Length=494

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 106/157 (68%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  ++ Y  + + P+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KL+
Sbjct  347  FTLQVESMKVYGGETL-PQFVLVSSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLQ  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R S IPYTI+RPCALTEE  G +LI +QGDNI GK+SRE+VA ICV AL+ P A 
Sbjct  406  GEDSLRASEIPYTIIRPCALTEESGGKELILEQGDNIRGKVSREDVAEICVQALQQPEAS  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK+            EN     D+   F  L+
Sbjct  466  NLTFEVKA-----------GENSAESSDWKQLFSNLQ  491



>ref|WP_035150436.1| NADH:ubiquinone oxidoreductase [Calothrix sp. 336/3]
 gb|KFB82257.1| NADH:ubiquinone oxidoreductase [Calothrix sp. 336/3]
Length=497

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 97/128 (76%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  ++AY     TP+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  350  FTLEIESMKAY-GAAKTPQFVLVSSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLK  408

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE    ++I +QGDNI GKISR++VA IC+ AL     C
Sbjct  409  GEDSIRNSGIPYTIIRPCALTEEAGNKEIIVEQGDNIRGKISRDDVAEICLQALNQAQLC  468

Query  356  DKTFEVKS  333
            + TFEVKS
Sbjct  469  NVTFEVKS  476



>ref|WP_027401452.1| NADH:ubiquinone oxidoreductase [Aphanizomenon flos-aquae]
Length=494

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L ++ I+AY  + + P+FV + SAGVTRP RPG++L ++PPAVRLN +LG ILT+KL+
Sbjct  347  FALEVASIQAYGGETL-PQFVLISSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ ++ SGIPYTI+RPCALTE   G +LIF+QGDNI GK+SR++VA ICV A++ P A 
Sbjct  406  GEESLKASGIPYTIIRPCALTESAGGQELIFEQGDNIRGKVSRDDVAEICVQAIKEPQAI  465

Query  356  DKTFEVK  336
            ++TFEVK
Sbjct  466  NRTFEVK  472



>ref|WP_006618043.1| NmrA-like protein [Arthrospira platensis]
 dbj|BAI92491.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR54347.1| NADH:ubiquinone oxidoreductase [Arthrospira platensis str. Paraca]
Length=493

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 102/142 (72%), Gaps = 1/142 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L +  I+AY  +   PR V V SAGVTRP +PGL+L ++PPAVR+N +LG ILT+KL+
Sbjct  344  FKLEIESIKAY-GNAAKPRLVMVSSAGVTRPGKPGLNLDEEPPAVRMNDQLGGILTWKLR  402

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED+VR S IPY I+RPCA+TEEP G  L+ DQGD I GK+SRE++A +C+ AL  P A 
Sbjct  403  GEDVVRSSNIPYAIIRPCAMTEEPGGEALMLDQGDTIKGKVSREDIAELCIKALNEPSAT  462

Query  356  DKTFEVKSVIPFSEPYTVDPEN  291
            + T EVK++     P   +PE+
Sbjct  463  NVTVEVKALANGDRPQHSEPES  484



>ref|WP_015078922.1| hypothetical protein [Anabaena sp. 90]
 gb|AFW93758.1| hypothetical protein ANA_C10968 [Anabaena sp. 90]
Length=494

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L ++ I+AY  + + P+FV + SAGVTRP RPG++L ++PPAVRLN +LG ILT+KL+
Sbjct  347  FALEVASIQAYGGETL-PQFVLISSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ V+ SGIPYTI+RPCALTE   G +LIF+QGDNI GKISR++VA ICV A++ P A 
Sbjct  406  GEESVKASGIPYTIIRPCALTETAGGKELIFEQGDNIRGKISRDDVAEICVQAIKEPKAS  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|WP_013192562.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Trichormus azollae]
 gb|ADI65551.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 ['Nostoc azollae' 0708]
Length=494

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 106/157 (68%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  I+AY  + + P+FV V SAGVTRP RPG++L ++PP VRLN +LG ILT+KLK
Sbjct  347  FTLELESIKAYGGETL-PQFVLVSSAGVTRPGRPGINLDEEPPTVRLNNQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPY I+RPCALTE   G +LIF+QGDNI GKISR +VA ICV +L+ P A 
Sbjct  406  GEDSLRASGIPYIIIRPCALTEADGGKELIFEQGDNIRGKISRNDVAEICVRSLKQPKAR  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + T EVK           + EN P   +++  F  LK
Sbjct  466  NITVEVK-----------EGENNPSSINWEHLFSKLK  491



>ref|WP_009344296.1| hypothetical protein [Raphidiopsis brookii]
 gb|EFA71868.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=498

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L L  IRAY  + ++ +FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FTLELESIRAYGGEGVS-QFVLVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R+S IPYTI+RPCALTE+  G +LI DQGDNI GKISR++VA IC+ +L+ P A 
Sbjct  406  GEDSLRDSQIPYTIIRPCALTEDRGGKELIVDQGDNIRGKISRDDVAEICLQSLQQPQAK  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NITFEVK  472



>ref|WP_016953583.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Anabaena sp. PCC 7108]
Length=494

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F + L  I+AY  + + P+FV + SAGVTRP RPG++L+++PPAVRLN +LG ILT+KLK
Sbjct  347  FAIHLESIKAYGGESL-PQFVLISSAGVTRPGRPGINLNEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTE+  G + IF+QGDNI GKISRE++A +C+ +++   A 
Sbjct  406  GEDSLRSSGIPYTIIRPCALTEDAGGKEFIFEQGDNIRGKISREDIAELCIQSIQKTKAL  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|WP_012594575.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8801]
 gb|ACK65301.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8801]
Length=491

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY   P TP F+ + SAGVTRP RPGL+L ++PPAVRLN +LG ILT+K +
Sbjct  344  FGLEIESIKAYGGQPKTPHFILISSAGVTRPGRPGLNLDEEPPAVRLNDQLGGILTWKWR  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR+SG+ YTI+RPCALTE+P    L+FDQGDNI G++SR+ +A +C+  L++P A 
Sbjct  404  GEEVVRQSGLNYTIIRPCALTEKPGDKGLVFDQGDNIKGQVSRDAIAALCLDILKNPQAG  463

Query  356  DKTFEVK  336
             KTFEV+
Sbjct  464  QKTFEVR  470



>ref|WP_015783548.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8802]
 gb|ACV00188.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 8802]
Length=491

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY   P TP F+ + SAGVTRP RPGL+L ++PPAVRLN +LG ILT+K +
Sbjct  344  FGLEIESIKAYGGQPKTPHFILISSAGVTRPGRPGLNLDEEPPAVRLNDQLGGILTWKWR  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR+SG+ YTI+RPCALTE+P    L+FDQGDNI G++SR+ +A +C+  L++P A 
Sbjct  404  GEEVVRQSGLNYTIIRPCALTEKPGDKGLVFDQGDNIKGQVSRDAIAALCLDILKNPQAG  463

Query  356  DKTFEVK  336
             KTFEV+
Sbjct  464  QKTFEVR  470



>ref|WP_009633206.1| NmrA-like family protein [Synechocystis sp. PCC 7509]
Length=489

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 110/157 (70%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  + + P+FV + SAGVTRP RPG++L+++PPAVR+N++LG ILT+KL 
Sbjct  343  FALQVESIKAYGGETL-PQFVLISSAGVTRPNRPGINLAEEPPAVRMNEQLGGILTWKLC  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +RES IPYTI+RPCALTEE    +LIF+QGDNI GK+SR+ +A +C+ AL  P A 
Sbjct  402  GEDSLRESKIPYTIIRPCALTEETGVQELIFEQGDNIRGKVSRDAIALLCIEALSQPQAS  461

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK++           E+  P  ++   F +L+
Sbjct  462  NVTFEVKAI-----------ESTNPSNNWQQLFASLQ  487



>ref|WP_028084600.1| NADH:ubiquinone oxidoreductase [Dolichospermum circinale]
Length=494

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +S I+AY    I P+F+ + SAGVTRP RPG++L ++PPAVRLN +LG ILT+KL+
Sbjct  347  FSLEVSSIQAY-GGEILPQFILISSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ ++ SGIPYTI+RPCALTE   G +LIF QGDNI GK+SR++VA ICV A++ P A 
Sbjct  406  GEECLKSSGIPYTIIRPCALTETAGGKELIFAQGDNIRGKVSRDDVAEICVQAIKEPKAK  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|WP_016878104.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Chlorogloeopsis fritschii]
Length=494

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY    + P+F+ V SAGVTRP R G++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FTLQIESIKAYGGTSV-PQFILVSSAGVTRPGRVGINLDEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE  G +L F+QGDNI GKISRE+VA ICV  L+ P A 
Sbjct  406  GEDSLRASGIPYTIIRPCALTEESGGKELTFEQGDNIRGKISREDVAEICVQVLKEPQAR  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + T EVK           + EN     D+   F  L+
Sbjct  466  NVTLEVK-----------EGENNANSIDWQRLFANLQ  491



>ref|WP_013325168.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7822]
 gb|ADN17130.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece sp. PCC 7822]
Length=494

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F + +  I+AY   P  P+F+ + SAGVTRP RPG++L ++PPAVR+N +LG ILT+K +
Sbjct  346  FGIEIESIKAYGGKP-KPQFIMISSAGVTRPGRPGINLEEEPPAVRMNDQLGGILTWKFR  404

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR SG+ YTIVRPCALTE+PA   L+F QGDNI G++SRE +A +CV ALE P AC
Sbjct  405  GEEVVRSSGLAYTIVRPCALTEKPADKVLMFAQGDNIKGQVSREAIAELCVEALELPNAC  464

Query  356  DKTFEVK  336
             KTFEV+
Sbjct  465  HKTFEVR  471



>ref|WP_017747824.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Scytonema hofmanni]
Length=493

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY K  + P+FV V SAGVTRP RPG++L ++PPAVRLN +LG ILT+KLK
Sbjct  347  FSLQVESIKAYSKQ-VLPQFVLVSSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLK  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +++SGIPYTIVRPCALTEE  G +LI  QGDNI GKISR++VA++C   L+   A 
Sbjct  406  GEESLKQSGIPYTIVRPCALTEELGGKELIVAQGDNIKGKISRDDVAKLCAEVLQQSQAS  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NVTFEVK  472



>ref|WP_028090688.1| NADH:ubiquinone oxidoreductase [Dolichospermum circinale]
Length=498

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +S I+AY    + P+F+ + SAGVTRP RPG++L ++PPAVRLN +LG ILT+KL+
Sbjct  347  FSLEVSSIQAY-GGEVLPQFILISSAGVTRPGRPGINLDEEPPAVRLNDQLGGILTWKLR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ ++ SGIPYTI+RPCALTE   G +LIF QGDNI GK+SR++VA ICV A++ P A 
Sbjct  406  GEECLKASGIPYTIIRPCALTETAGGKELIFAQGDNIRGKVSRDDVAEICVQAIKEPKAK  465

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  466  NLTFEVK  472



>ref|WP_008274624.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92387.1| hypothetical protein CY0110_28549 [Cyanothece sp. CCY0110]
Length=489

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L ++ I+AY     TP+F+ + SAGVTRP R  L+L +QPPAV++N +LG ILT+KLK
Sbjct  343  FRLEVTSIKAYGGSANTPQFILISSAGVTRPGRSDLNLEEQPPAVKMNDKLGGILTWKLK  402

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+++RESG+ YTI+RPCALTE+P    LIF+QGDN+ G++SRE +A +C+  L  P AC
Sbjct  403  GEEVLRESGLNYTIIRPCALTEKPGNKALIFEQGDNLKGQVSREAIADLCLQVLRWPEAC  462

Query  356  DKTFEV  339
             KTFEV
Sbjct  463  QKTFEV  468



>ref|XP_003606736.1| UOS1, partial [Medicago truncatula]
Length=386

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -2

Query  659  FVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIVRPCA  480
            FVHV SAGVTRPERPGLDLSKQPPAVRLNKEL +ILT+KLKGEDL+RESGIPY IVRPCA
Sbjct  307  FVHVSSAGVTRPERPGLDLSKQPPAVRLNKELDYILTYKLKGEDLIRESGIPYVIVRPCA  366

Query  479  LTEEPAGADLIFDQGDNIT  423
            LTEEPAGADLIFDQGDNIT
Sbjct  367  LTEEPAGADLIFDQGDNIT  385



>ref|WP_039716664.1| NADH:ubiquinone oxidoreductase [Scytonema millei]
 gb|KIF19171.1| NADH:ubiquinone oxidoreductase [Scytonema millei VB511283]
Length=494

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I AY      P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+K +
Sbjct  348  FALQVESIGAY--GSAKPQFILVSSAGVTRPNRPGINLEEEPPAVRLNNQLGGILTWKWR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ VRESG+PYTI+RPCALTEEP    L+FDQGDNI GK+SR+ +A +CV  +E P   
Sbjct  406  GEEAVRESGVPYTIIRPCALTEEPGIQPLVFDQGDNIKGKVSRDSIAELCVRVVEQPQDA  465

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  466  NLTFEVKA  473



>ref|WP_015189798.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Gloeocapsa sp. PCC 7428]
 gb|AFZ31929.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Gloeocapsa sp. PCC 7428]
Length=490

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY    + P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+K +
Sbjct  347  FALQVESIKAYAGAKL-PQFILVSSAGVTRPGRPGINLEEEPPAVRLNDQLGGILTWKWR  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +R SGIPYTIVRPCALTEE     L+F QGDNI GK+SR+ +A +C+  LE P AC
Sbjct  406  GEEALRHSGIPYTIVRPCALTEEAGVQPLVFAQGDNIKGKVSRDSIAELCLQVLEQPKAC  465

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  466  NVTFEVKA  473



>ref|WP_015200706.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix parietina]
 gb|AFZ04096.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Calothrix sp. PCC 6303]
Length=495

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY    + PRFV + SAGVTRP R G++L ++PPAVRLN +LG ILT+KL+
Sbjct  348  FALEVESIKAYGGSKL-PRFVLISSAGVTRPGREGINLEEEPPAVRLNDQLGGILTWKLR  406

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SGIPYTI+RPCALTEE  G +L+ +QGDNI GKISR++VA +C+ AL+   A 
Sbjct  407  GEDSLRTSGIPYTIIRPCALTEETGGKELLAEQGDNIRGKISRDDVAELCLQALQETAAS  466

Query  356  DKTFEVK  336
            + TFEVK
Sbjct  467  NVTFEVK  473



>gb|ABG52549.1| NmrA-like [Trichodesmium erythraeum IMS101]
Length=500

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 102/157 (65%), Gaps = 11/157 (7%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+ Y  D + PRFV V SAGVTRP RPGL+L +Q   V+LN +L  +L +K K
Sbjct  345  FQLEIEYIKTYGSDEL-PRFVLVSSAGVTRPGRPGLNLDEQIKIVQLNDQLKGLLNWKFK  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR SGIPYTI+RPC +TE+P G  LIFDQGDNI G +SR+++A +CV  LE   AC
Sbjct  404  GEEVVRSSGIPYTIIRPCGMTEQPGGQALIFDQGDNIKGIVSRDDIAELCVKVLEENQAC  463

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFE K           D EN    ++++  F  LK
Sbjct  464  NTTFEAKG----------DKENQATVENWERLFNGLK  490



>ref|WP_044137683.1| NADH:ubiquinone oxidoreductase [Trichodesmium erythraeum]
Length=498

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 102/157 (65%), Gaps = 11/157 (7%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQL +  I+ Y  D + PRFV V SAGVTRP RPGL+L +Q   V+LN +L  +L +K K
Sbjct  343  FQLEIEYIKTYGSDEL-PRFVLVSSAGVTRPGRPGLNLDEQIKIVQLNDQLKGLLNWKFK  401

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++VR SGIPYTI+RPC +TE+P G  LIFDQGDNI G +SR+++A +CV  LE   AC
Sbjct  402  GEEVVRSSGIPYTIIRPCGMTEQPGGQALIFDQGDNIKGIVSRDDIAELCVKVLEENQAC  461

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFE K           D EN    ++++  F  LK
Sbjct  462  NTTFEAKG----------DKENQATVENWERLFNGLK  488



>ref|WP_021832890.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii]
 emb|CCQ55699.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 0005]
Length=489

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L ++ I+AY +   TP+F+ + SAGVTRP R  ++L  QPPAV++N++LG ILT+KLK
Sbjct  343  FRLDVNNIKAYGRKVNTPQFILISSAGVTRPGRSDINLEDQPPAVKMNEQLGGILTWKLK  402

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R+SG+ YTI+RPCALTE+P    L F+QGDN+ G++SR+ +A +C+  L+ P AC
Sbjct  403  GEDVLRQSGLNYTIIRPCALTEKPGDKALFFEQGDNLKGQVSRDAIADLCLQLLQYPSAC  462

Query  356  DKTFEV  339
             KTFEV
Sbjct  463  QKTFEV  468



>ref|WP_007309137.1| hypothetical Transposase-like protein, IS200/IS605 family, partial 
[Crocosphaera watsonii]
 gb|EHJ14809.1| hypothetical Transposase-like protein, IS200/IS605 family, partial 
[Crocosphaera watsonii WH 0003]
Length=485

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L ++ I+AY +   TP+F+ + SAGVTRP R  ++L  QPPAV++N++LG ILT+KLK
Sbjct  343  FRLDVNNIKAYGRKVNTPQFILISSAGVTRPGRSDINLEDQPPAVKMNEQLGGILTWKLK  402

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R+SG+ YTI+RPCALTE+P    L F+QGDN+ G++SR+ +A +C+  L+ P AC
Sbjct  403  GEDVLRQSGLNYTIIRPCALTEKPGDKALFFEQGDNLKGQVSRDAIADLCLQLLQYPSAC  462

Query  356  DKTFEV  339
             KTFEV
Sbjct  463  QKTFEV  468



>ref|WP_015154354.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Chroococcidiopsis thermalis]
 gb|AFY87806.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Chroococcidiopsis thermalis PCC 7203]
Length=495

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 95/128 (74%), Gaps = 2/128 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I AY      P+F+ V SAGVTRP RPG++L ++PPAVRLN +LG ILT+K +
Sbjct  349  FALQVESIGAY--GSARPQFILVSSAGVTRPNRPGINLEEEPPAVRLNDQLGGILTWKWR  406

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ VRESG+PYTI+RPCALTEEP    L+FDQGDNI GK+SR+ +A +CV  +E P   
Sbjct  407  GEEAVRESGVPYTIIRPCALTEEPEIQPLVFDQGDNIKGKVSRDSIAELCVRVVEQPQDG  466

Query  356  DKTFEVKS  333
            + TFEVK+
Sbjct  467  NLTFEVKA  474



>ref|WP_007304974.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii]
 gb|EAM51462.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 8501]
 emb|CCQ61075.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 0401]
 emb|CCQ52384.1| similar to nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 8502]
Length=489

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L ++ I+AY +   TP+F+ + SAGVTRP R  ++L  QPPAV++N++LG ILT+KLK
Sbjct  343  FRLDVNNIKAYGRKVNTPQFILISSAGVTRPGRSDINLEDQPPAVKMNEQLGGILTWKLK  402

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED++R+SG+ YTI+RPCALTE+P    L F QGDN+ G++SR+ +A +C+  L+ P AC
Sbjct  403  GEDVLRQSGLNYTIIRPCALTEKPGDKALFFKQGDNLKGQVSRDAIADLCLQLLQYPSAC  462

Query  356  DKTFEV  339
             KTFEV
Sbjct  463  QKTFEV  468



>ref|WP_009545319.1| MULTISPECIES: NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Cyanothece]
 gb|ACB52863.1| unknown [Cyanothece sp. ATCC 51142]
Length=497

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L ++ I+AY     TP+F+ + SAGVTRP R  ++L +QPPAV++N +LG ILT+KLK
Sbjct  351  FRLEVNSIKAYGGKVNTPQFILISSAGVTRPGRSDINLEEQPPAVKMNDQLGNILTWKLK  410

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+++R+SG+ YTI+RPCALTE P    LIF+QGDN+ G++SRE +A +C+  L  P AC
Sbjct  411  GEEVLRQSGLNYTIIRPCALTENPGNKALIFEQGDNLKGQVSREAIADLCLQVLRWPEAC  470

Query  356  DKTFEV  339
             KTFEV
Sbjct  471  QKTFEV  476



>ref|WP_036486017.1| NADH:ubiquinone oxidoreductase, partial [Myxosarcina sp. GI1]
Length=424

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY  +  TP+FV V SAGVTRP+RP +DL  QPPAVR+N++LG ILT+KLK
Sbjct  296  FGLKVEYIKAYGGEA-TPQFVMVSSAGVTRPDRPEIDLESQPPAVRMNEQLGGILTWKLK  354

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++V+ SG+ YTI+RPCALTE+P    L  +QGDN+TG++SR  +A++C AA+  P A 
Sbjct  355  GEEVVKASGLTYTIIRPCALTEKPGDKVLYVEQGDNLTGQVSRNAIAQLCTAAIILPEAV  414

Query  356  DKTFEV  339
            +KTFEV
Sbjct  415  NKTFEV  420



>ref|WP_028948544.1| NADH:ubiquinone oxidoreductase [Synechocystis sp. PCC 6714]
 gb|AIE74110.1| nucleoside-diphosphate-sugar epimerase [Synechocystis sp. PCC 
6714]
Length=448

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+ Y  +P+TP+F+HV SAGVTRP RPGL+L+++PPAVRLN++LG ILT+KL+
Sbjct  300  FGLEIESIKTY-ANPLTPQFIHVSSAGVTRPGRPGLNLAEEPPAVRLNEQLGGILTWKLR  358

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SG+ YTIVRPCALTE      L F QGDN+ G++SR  +A++CV +L+   A 
Sbjct  359  GEDAIRGSGLTYTIVRPCALTESENPEILQFAQGDNLRGQVSRWAIAKLCVDSLQWAEAG  418

Query  356  DKTFEVKS  333
             KTFEV  
Sbjct  419  GKTFEVNG  426



>ref|WP_010873873.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_442575.1| hypothetical protein sll0096 [Synechocystis sp. PCC 6803]
 dbj|BAA10645.1| sll0096 [Synechocystis sp. PCC 6803]
 dbj|BAK51431.1| hypothetical protein SYNGTS_2683 [Synechocystis sp. PCC 6803]
 dbj|BAL30429.1| hypothetical protein SYNGTI_2682 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL33598.1| hypothetical protein SYNPCCN_2681 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL36767.1| hypothetical protein SYNPCCP_2681 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM53759.1| hypothetical protein BEST7613_4828 [Synechocystis sp. PCC 6803]
 gb|AGF52937.1| hypothetical protein MYO_127090 [Synechocystis sp. PCC 6803]
Length=448

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 97/131 (74%), Gaps = 1/131 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+ Y  +P+TP+F+HV SAGVTRP+RPGL+L ++PPAVRLN +LG ILT+KL+
Sbjct  300  FGLEIESIKTY-ANPLTPQFIHVSSAGVTRPDRPGLNLDEEPPAVRLNDQLGGILTWKLR  358

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GED +R SG+ YTIVRPCALTE      + F QGDN+ G++SR  +A++CV +L+   A 
Sbjct  359  GEDAIRGSGLTYTIVRPCALTESENPEMMQFAQGDNLRGQVSRWAIAKLCVDSLQWAEAG  418

Query  356  DKTFEVKSVIP  324
             KTFEV +  P
Sbjct  419  GKTFEVSAREP  429



>ref|WP_041235904.1| NADH:ubiquinone oxidoreductase [Dactylococcopsis salina]
Length=493

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L + +I+AY ++  TP+F+ + SAGVTRP R  LDLS++PPAV++N++LG +LT+KL 
Sbjct  346  FRLEVEEIKAY-REGKTPQFIMISSAGVTRPGRTDLDLSQEPPAVQMNEQLGGLLTWKLA  404

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +RESG+ YTI+RPCALTEE     L F+QGD + G++SRE +A +C+  L++P A 
Sbjct  405  GENSIRESGLRYTIIRPCALTEETEKEGLYFEQGDTLKGQVSRETIADLCLLLLKTPEAV  464

Query  356  DKTFEVKSVIPFSEP  312
            +KTFE      F+ P
Sbjct  465  NKTFEAAKSSEFNSP  479



>gb|AFZ51428.1| NAD dependent epimerase/dehydratase family protein [Dactylococcopsis 
salina PCC 8305]
Length=501

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L + +I+AY ++  TP+F+ + SAGVTRP R  LDLS++PPAV++N++LG +LT+KL 
Sbjct  354  FRLEVEEIKAY-REGKTPQFIMISSAGVTRPGRTDLDLSQEPPAVQMNEQLGGLLTWKLA  412

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +RESG+ YTI+RPCALTEE     L F+QGD + G++SRE +A +C+  L++P A 
Sbjct  413  GENSIRESGLRYTIIRPCALTEETEKEGLYFEQGDTLKGQVSRETIADLCLLLLKTPEAV  472

Query  356  DKTFEVKSVIPFSEP  312
            +KTFE      F+ P
Sbjct  473  NKTFEAAKSSEFNSP  487



>ref|WP_019508481.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=483

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ + SAGVTRP RPG++L ++PPAVR+N++LG ILT+KLK
Sbjct  337  FTLQVEYIKAY-GGQAKPQFIQISSAGVTRPGRPGINLEEEPPAVRMNEQLGGILTWKLK  395

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ ++ SG+ YTI+RPCALTE+P    L  +QGDNI G++SR+ +A +C+ A+  P A 
Sbjct  396  GEEAIKASGLTYTIIRPCALTEQPGDKILYAEQGDNIRGQVSRDAIAELCIQAMNLPQAV  455

Query  356  DKTFEVK  336
            +KTFEV+
Sbjct  456  NKTFEVR  462



>ref|WP_015224203.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Halothece sp. PCC 7418]
 gb|AFZ42325.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Halothece sp. PCC 7418]
Length=493

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L + QI AY  +  TP+++ + SAGVTRP R  LDLS++PPAV++N++LG +LT+KL 
Sbjct  347  FRLEVEQIAAYGGEA-TPQWITISSAGVTRPGRSDLDLSQEPPAVQMNEQLGGLLTWKLA  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +RESG+ YTI+RPCALTEE     L  +QGD + G++SRE +A++CV  L+SP A 
Sbjct  406  GENAIRESGLRYTIIRPCALTEETESESLQLEQGDTLKGQVSRETIAQLCVELLQSPEAV  465

Query  356  DKTFEV  339
            +KTFEV
Sbjct  466  NKTFEV  471



>ref|WP_017659907.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=500

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 106/157 (68%), Gaps = 11/157 (7%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L L  I AY  + + P+FV V SAGVTRP +PGL+L ++PPAVR+N +LG +LT+KL+
Sbjct  347  FRLELESISAYGGETV-PQFVIVSSAGVTRPGKPGLNLEEEPPAVRMNDQLGGLLTWKLE  405

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +R SGIPY IVRPCALTEEP G  L+   GD I G+ +R+++A +CV AL+ P A 
Sbjct  406  GENSLRNSGIPYAIVRPCALTEEPGGKPLVAATGDTIKGQCTRDDIAELCVRALDRPEAT  465

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLK  246
            + TFEVK              +    +D++ +F++LK
Sbjct  466  NATFEVKQT----------SADRGKIQDWNGFFESLK  492



>gb|AFA36543.1| transcriptional repressor, partial [Lolium perenne]
Length=76

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/76 (84%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = -2

Query  491  RPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVIPFSEP  312
            RPCALTEEPAGADLIF+QGDNITGKISREEVA ICVAALESP A  KTFEVKS +PFSEP
Sbjct  1    RPCALTEEPAGADLIFEQGDNITGKISREEVALICVAALESPSAVGKTFEVKSTVPFSEP  60

Query  311  YTVDPENPPPEKDYDV  264
            + +DP NPPPEKDY+V
Sbjct  61   FVIDPSNPPPEKDYEV  76



>ref|WP_006512403.1| NmrA-like family protein [Xenococcus sp. PCC 7305]
 gb|ELS00462.1| NmrA-like family protein [Xenococcus sp. PCC 7305]
Length=501

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 102/156 (65%), Gaps = 13/156 (8%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY   P   +FV + SAGVTRP RPGL+L ++PPAVR+N++LG ILT+KL+
Sbjct  348  FGLEIEYIKAYNTKP-KSQFVLISSAGVTRPGRPGLNLEEEPPAVRMNEQLGGILTWKLR  406

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE++V+ SG+ YTI+RPCALTE P    L  +QGDN+ G++ R+ +A + + A++ P A 
Sbjct  407  GEEVVQASGLNYTIIRPCALTENPGDKPLYVEQGDNLKGQVGRDAIAELAIQAIQLPEAV  466

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTL  249
            +KTFEVK             E+ P E ++   F  L
Sbjct  467  NKTFEVKE------------ESQPGETNWQKLFSGL  490



>ref|WP_015194049.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Stanieria cyanosphaera]
 gb|AFZ36382.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Stanieria cyanosphaera PCC 7437]
Length=491

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+FV + SAGVTRP RPG++L+++PPAVR+N +LG ILT+KL+
Sbjct  345  FSLDIEYIKAY-GSKAKPQFVMISSAGVTRPNRPGINLAEEPPAVRMNDQLGGILTWKLQ  403

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ VR SG+ YTI+RPCALTE+P    L  +QGDN+ G++SR+ +A + +AA+ SP A 
Sbjct  404  GEEAVRNSGLTYTIIRPCALTEQPGDKLLWVEQGDNLKGQVSRDAIATMAIAAINSPLAV  463

Query  356  DKTFEVK  336
            +KTFEV+
Sbjct  464  NKTFEVR  470



>ref|WP_024125545.1| NmrA family protein [Thermosynechococcus sp. NK55a]
 gb|AHB89161.1| NmrA family protein [Thermosynechococcus sp. NK55a]
Length=484

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 94/136 (69%), Gaps = 1/136 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F+L +  I+AY   P+ PR + V SAGVTRP++  LD+  QP AV+ NK+LG +LT+KL 
Sbjct  335  FRLEIEFIQAYGGLPL-PRIIQVSSAGVTRPQQANLDVKGQPLAVQYNKQLGGLLTWKLA  393

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
             E+++R+SG+PYTIVRPC LT++P G +L  DQGD +TG +SRE++A    + L  P AC
Sbjct  394  AENMLRQSGLPYTIVRPCGLTDQPGGKELRLDQGDRLTGFLSREDLAAFLASLLNLPVAC  453

Query  356  DKTFEVKSVIPFSEPY  309
             +T EV +    +E Y
Sbjct  454  YRTVEVVATDQAAEAY  469



>ref|WP_011055916.1| hypothetical protein [Thermosynechococcus elongatus]
 ref|NP_680852.1| hypothetical protein tll0061 [Thermosynechococcus elongatus BP-1]
 dbj|BAC07614.1| tll0061 [Thermosynechococcus elongatus BP-1]
Length=484

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
              L +  I+AY   P+ PR + V SAGVTRP++  LD  +QP AV+ NKELG +LT+KL 
Sbjct  335  LSLEIESIQAYGNLPL-PRIIQVSSAGVTRPQQANLDPKEQPLAVQYNKELGGLLTWKLA  393

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
             E+++R+SG+PYTIVRPC LT++  G +L  DQGD + G +SRE++A    + L  P AC
Sbjct  394  AENMLRQSGLPYTIVRPCGLTDQSGGRELRLDQGDRLMGSLSREDLAAFLASLLNLPMAC  453

Query  356  DKTFEVKSVIPFSEPY  309
             +T EV +    +E Y
Sbjct  454  YRTMEVVATDQAAEAY  469



>ref|WP_041431015.1| hypothetical protein [Synechococcus sp. PCC 6312]
Length=501

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQP-PAVRLNKELGFILTFKL  540
            F L L  I AY+     PR++ V SAG TRP  P  + +  P P VRL+++LG ILT+K 
Sbjct  355  FALELETISAYLDHHPLPRWIMVSSAGATRPGTP--EAATDPRPIVRLSEQLGGILTWKF  412

Query  539  KGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYA  360
            +GE+L+R+SGIPYTI+RP ALTE      LI  QGD + GK+SR++VA++CV AL+ P A
Sbjct  413  RGEELIRQSGIPYTIIRPTALTEATGQQPLIMSQGDTLAGKVSRQDVAQLCVQALKWPAA  472

Query  359  CDKTFEVKS  333
              KT E+ +
Sbjct  473  VQKTLEIAA  481



>gb|AFY59699.1| NmrA-like family protein [Synechococcus sp. PCC 6312]
Length=518

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQP-PAVRLNKELGFILTFKL  540
            F L L  I AY+     PR++ V SAG TRP  P  + +  P P VRL+++LG ILT+K 
Sbjct  372  FALELETISAYLDHHPLPRWIMVSSAGATRPGTP--EAATDPRPIVRLSEQLGGILTWKF  429

Query  539  KGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYA  360
            +GE+L+R+SGIPYTI+RP ALTE      LI  QGD + GK+SR++VA++CV AL+ P A
Sbjct  430  RGEELIRQSGIPYTIIRPTALTEATGQQPLIMSQGDTLAGKVSRQDVAQLCVQALKWPAA  489

Query  359  CDKTFEVKS  333
              KT E+ +
Sbjct  490  VQKTLEIAA  498



>ref|XP_003606730.1| UOS1 [Medicago truncatula]
Length=65

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 61/65 (94%), Gaps = 2/65 (3%)
 Frame = -2

Query  392  ICVAALESPYACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLE-  216
            +CVAALESPYACDKTFEVKSVIPFSEP+TVDPENPP EKDYD+YFK LKEGITGKE+L+ 
Sbjct  1    MCVAALESPYACDKTFEVKSVIPFSEPFTVDPENPPSEKDYDIYFKNLKEGITGKEALQQ  60

Query  215  -PTPV  204
             PTPV
Sbjct  61   SPTPV  65



>ref|XP_005539477.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM83441.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=615

 Score =   124 bits (311),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 6/140 (4%)
 Frame = -2

Query  665  PRFVHVGSAGVTRPERPGL--DLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIV  492
            PRF+H+ SAGVTR  RP    DLSK+PPAVR+N +LG +L +KL GEDLVR SGIPYTI+
Sbjct  461  PRFIHISSAGVTRVLRPDEFPDLSKEPPAVRMNAQLGRVLEWKLAGEDLVRSSGIPYTII  520

Query  491  RPCALT-EEPAG-ADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVIPFS  318
            RPCALT EE +G + L  +QGD + G++SR++VA + VA L+ P    KT EV +     
Sbjct  521  RPCALTLEEASGLSALRLEQGDWLRGQVSRDDVAALAVACLDEPAMEGKTVEVATSAATE  580

Query  317  EP--YTVDPENPPPEKDYDV  264
             P  +++       E+D D 
Sbjct  581  RPTMHSLRERALQLERDQDA  600



>gb|KCW74152.1| hypothetical protein EUGRSUZ_E02785 [Eucalyptus grandis]
Length=480

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            FQLP+S IRAYIKDP+TPRFVHV SAGVTRP+RPGLDLSKQPPAVRLNKELGFILTFKLK
Sbjct  418  FQLPISNIRAYIKDPVTPRFVHVSSAGVTRPDRPGLDLSKQPPAVRLNKELGFILTFKLK  477



>emb|CCQ66954.1| hypothetical protein CWATWH0402_3772 [Crocosphaera watsonii WH 
0402]
Length=101

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  578  LNKELGFILTFKLKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEV  399
            +N++LG ILT+KLKGED++R+SG+ YTI+RPCALTE+P    L F+QGDN+ G++SR+ +
Sbjct  1    MNEQLGGILTWKLKGEDVLRQSGLNYTIIRPCALTEKPGDKALFFEQGDNLKGQVSRDAI  60

Query  398  ARICVAALESPYACDKTFEV  339
            A +C+  L+ P AC KTFEV
Sbjct  61   ADLCLQLLQYPSACQKTFEV  80



>ref|XP_005716821.1| unnamed protein product [Chondrus crispus]
 emb|CDF37002.1| unnamed protein product [Chondrus crispus]
Length=554

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 6/132 (5%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDP---ITPRFVHVGSAGVTRPERPGLDLSKQ-PPAVRLNKELGFILT  549
            FQL +  + AY +     I P+ VH+ +A VTR  R      +Q PPA ++N +LG IL 
Sbjct  380  FQLQIESVSAYKQSGDGVIRPKIVHISTAAVTRVLRKSEFTPEQLPPAAQMNDQLGRILN  439

Query  548  FKLKGEDLVRESGIPYTIVRPCALTEEPA-GAD-LIFDQGDNITGKISREEVARICVAAL  375
            +K  GED +R SG+PYTI+RPCALTEE A G D L+F+QGD + G +SR++VA + + A 
Sbjct  440  WKFAGEDAIRNSGVPYTILRPCALTEEEAVGMDSLLFEQGDTLLGNVSRDDVATLIIKAF  499

Query  374  ESPYACDKTFEV  339
            ++P   D T EV
Sbjct  500  DTPALVDVTVEV  511



>emb|CCH67772.1| hypothetical protein RINTHH_16170 [Richelia intracellularis HH01]
Length=426

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 79/128 (62%), Gaps = 3/128 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ V  + ++RP   G D SK+P  V+ +++L  I  + L+
Sbjct  297  FNLQVEYIKAY--GASLPQFILVSPSVISRPNLLGADFSKEPTEVKSDRQLESIFIWSLE  354

Query  536  GEDLVRESGIPYTIVRPCALTE-EPAGADLIFDQGDNITGKISREEVARICVAALESPYA  360
            GE+ +R SGIPYTI+RP A ++ +    +LI D+GDNI G++    +A +CVAAL+   A
Sbjct  355  GENTLRNSGIPYTIIRPFAFSDKQQYNKELIIDEGDNIQGRMHDAHIAELCVAALQETKA  414

Query  359  CDKTFEVK  336
             +  F+VK
Sbjct  415  SNIIFDVK  422



>emb|CCH64716.1| hypothetical protein RINTHM_2400 [Richelia intracellularis HM01]
Length=148

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ V  + ++RP   G D SK    V+   +L  I  + L+
Sbjct  20   FNLQVEYIKAY--GASFPQFILVSPSVISRPNLLGADFSKDLTEVKSEGQLESIFIWNLE  77

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +R SGIPYTI+RP A +++    +LI D+G N   ++  + +A +CVAAL+   A 
Sbjct  78   GENTLRNSGIPYTIIRPFAFSDKQYDKELIIDEGGNTQERMHDDHIAELCVAALQETKAS  137

Query  356  DKTFEVK  336
            +  F+VK
Sbjct  138  NIIFDVK  144



>ref|WP_044258135.1| NADH:ubiquinone oxidoreductase, partial [Richelia intracellularis]
Length=197

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLK  537
            F L +  I+AY      P+F+ V  + ++RP   G D SK    V+   +L  I  + L+
Sbjct  69   FNLQVEYIKAY--GASFPQFILVSPSVISRPNLLGADFSKDLTEVKSEGQLESIFIWNLE  126

Query  536  GEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYAC  357
            GE+ +R SGIPYTI+RP A +++    +LI D+G N   ++  + +A +CVAAL+   A 
Sbjct  127  GENTLRNSGIPYTIIRPFAFSDKQYDKELIIDEGGNTQERMHDDHIAELCVAALQETKAS  186

Query  356  DKTFEVK  336
            +  F+VK
Sbjct  187  NIIFDVK  193



>emb|CBJ28796.1| conserved unknown protein [Ectocarpus siliculosus]
Length=928

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  674  PITPRFVHVGSAGVTRPERPGLD-----LSKQPPAVRLNKELGFILTFKLKGEDLVRESG  510
            P  PRFV + SA VTRP     D     LS   P V+LN     ILT K +GE  +RE G
Sbjct  743  PNAPRFVLLSSAAVTRPNWSSEDKALYPLSADVPIVKLNPL--NILTVKAQGEKELREVG  800

Query  509  IPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSV  330
            IPY +VRPC L ++      IF  GD   G+I RE+VA + V  L +P A  KTFEV+S+
Sbjct  801  IPYVVVRPCGLNDDHPRGRPIFSVGDTAAGRICREDVADVLVRCLGTPEATGKTFEVQSL  860

Query  329  IPF  321
              F
Sbjct  861  PGF  863



>ref|XP_005850646.1| hypothetical protein CHLNCDRAFT_140649 [Chlorella variabilis]
 gb|EFN58544.1| hypothetical protein CHLNCDRAFT_140649 [Chlorella variabilis]
Length=690

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 10/133 (8%)
 Frame = -2

Query  716  FQLPL-SQIRAYIKDPITPRFVHVGSAGVTRPERPGLD---LSKQPPAVRLNKELGFILT  549
            F+L +   IRAY +D   P+ + V SAGV R  + G D     K  P V+LN   G +L 
Sbjct  401  FELAIEGGIRAY-RDA-RPQLLMVSSAGVERNAKVGNDEEARKKDIPIVQLNP--GGVLN  456

Query  548  FKLKGEDLVRESGIPYTIVRPCALTEEPAGADLIFD--QGDNITGKISREEVARICVAAL  375
             K  GE  VR SG+ Y+++RP  LT E    D + +  QGD I+G+ISREE++ + VAAL
Sbjct  457  HKYTGEAAVRASGLAYSVLRPTGLTNESEPGDFLLEAGQGDRISGRISREELSTVVVAAL  516

Query  374  ESPYACDKTFEVK  336
             +P A  KT E++
Sbjct  517  GTPAAAGKTLELR  529



>ref|XP_005647522.1| CIA30-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE22978.1| CIA30-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=583

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 67/115 (58%), Gaps = 7/115 (6%)
 Frame = -2

Query  665  PRFVHVGSAGVTRPERPGLDLSKQP---PAVRLNKELGFILTFKLKGEDLVRESGIPYTI  495
            P  V V SAGV R  + G D + +    P V+LN   G +L  K  GE  VR +GIPY +
Sbjct  324  PAIVFVTSAGVERNAKIGDDETARKADIPIVQLNP--GGVLNHKYAGEWAVRSAGIPYAV  381

Query  494  VRPCALTEEPAGADLIFD--QGDNITGKISREEVARICVAALESPYACDKTFEVK  336
            VR   LT E    D + +  QGD I+GKISR+EVAR+ VAAL +  +  KT E++
Sbjct  382  VRSTGLTSEDEDTDFVLEASQGDRISGKISRKEVARVAVAALGTAASVGKTVEIR  436



>ref|WP_019072611.1| hypothetical protein [Streptomyces sp. R1-NS-10]
Length=236

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 20/128 (16%)
 Frame = -2

Query  668  TPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIVR  489
            +P FV V    VTR + P            +N   G +L ++L GE+ VR SG+PYT++R
Sbjct  107  SPHFVLVSQRHVTRRDHP------------MNA-YGRMLDWRLAGENAVRSSGLPYTVIR  153

Query  488  PCALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVI------  327
            P  LT+EP    L  +QGD   G+++R  VA  CV AL SP A   TFE++S +      
Sbjct  154  PGWLTDEPGHGHLHLEQGDVGDGRVARPHVADACVEALYSPAARGVTFEMRSEVGPGAGS  213

Query  326  -PFSEPYT  306
             P+ E +T
Sbjct  214  PPWDELFT  221



>ref|XP_005706763.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Galdieria sulphuraria]
 gb|EME30243.1| NADH:ubiquinone oxidoreductase complex I intermediate-associated 
protein 30 [Galdieria sulphuraria]
Length=512

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = -2

Query  716  FQLPLSQIRAYIKDPITPRFVHVGSAGVTRPE-----RPGLDLSKQPPAVRLNKELGFIL  552
            F+L L +I A+      PR V + SA VTR E     R     S   P V+LN   G IL
Sbjct  363  FELVLEKITAF--SLTIPRLVVLSSAAVTRLEWNEKQRQIYAGSFNIPIVQLNP--GNIL  418

Query  551  TFKLKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICVAALE  372
              K  GED VR SGIPY I+R   L +E     ++F QGD   G+I+R++VA   VAAL+
Sbjct  419  NEKRMGEDAVRSSGIPYCIIRATGLNDEHPSGRIVFQQGDTAVGRINRKDVADTLVAALD  478

Query  371  SPYACDKTFEVKSV  330
               +  KTFE+ SV
Sbjct  479  LSSSSYKTFEIFSV  492



>ref|WP_042393447.1| hypothetical protein [Streptacidiphilus carbonis]
Length=229

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 59/98 (60%), Gaps = 3/98 (3%)
 Frame = -2

Query  623  ERPGLDLSKQPPAVRLNKEL---GFILTFKLKGEDLVRESGIPYTIVRPCALTEEPAGAD  453
            +RP + L  Q  A      L   G +L ++L GE+ +RESG+PYT++RP  LT+  AG  
Sbjct  106  QRPHVVLISQHHATHWGHPLNAYGRVLEWRLAGEEALRESGLPYTVIRPGWLTDGAAGLR  165

Query  452  LIFDQGDNITGKISREEVARICVAALESPYACDKTFEV  339
            +  +QGD   G++SR++VA  CV AL  P A   TFE+
Sbjct  166  VRLEQGDRGNGQVSRQDVAEACVQALYCPSASGVTFEM  203



>ref|WP_030262252.1| hypothetical protein [Streptacidiphilus jeojiense]
Length=229

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
 Frame = -2

Query  623  ERPGLDLSKQPPAVRLNKEL---GFILTFKLKGEDLVRESGIPYTIVRPCALTEEPAGAD  453
            +RP + L  Q  A      L   G +L ++L GE+ +RESG+PYT++RP  LT+  AG  
Sbjct  106  QRPHVVLISQHHATHWGHPLNAYGRVLEWRLAGEEALRESGLPYTVIRPGWLTDGAAGLR  165

Query  452  LIFDQGDNITGKISREEVARICVAALESPYACDKTFEV  339
            +   QGD   G++SR++VA  CV AL  P A   TFE+
Sbjct  166  VRLAQGDRGNGQVSRQDVAEACVQALYCPSASGVTFEM  203



>ref|WP_012505715.1| epimerase [Prosthecochloris aestuarii]
 gb|ACF46180.1| NAD-dependent epimerase/dehydratase [Prosthecochloris aestuarii 
DSM 271]
Length=234

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 80/158 (51%), Gaps = 30/158 (19%)
 Frame = -2

Query  698  QIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVR  519
            ++ A+ ++     FV + S  VTRP+ P            LNK  G +LT KL+GE+ VR
Sbjct  100  RLAAHAREQGVRHFVLISSLAVTRPDHP------------LNK-YGQVLTMKLEGENEVR  146

Query  518  E----SGIPYTIVRPCALTE-EPAGADLIFDQGDNI-TGKISREEVARICVAALESPYAC  357
                  G  YTI+RP  L E EP    L+FD GD I TGKI+R +VA   V +L +P A 
Sbjct  147  RLFSMKGFSYTILRPGGLAEGEPMEHPLLFDTGDRIETGKINRSDVAEAAVESLWTPEAR  206

Query  356  DKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKE  243
            D TFE+           +  +    +K ++ YF+ L +
Sbjct  207  DLTFEL-----------IQTDENAAQKSFERYFRNLNK  233



>ref|WP_037737932.1| hypothetical protein [Streptomyces mirabilis]
Length=236

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  563  GFILTFKLKGEDLVRESGIPYTIVRPCALTEEPAGADLIFDQGDNITGKISREEVARICV  384
            G +L ++L GE+ VR SG+PYT+VRP  LT+EP    L  +QGD   G+++R  VA  CV
Sbjct  129  GRMLDWRLAGENAVRSSGLPYTVVRPGWLTDEPGHGHLHLEQGDLGDGQVTRVHVADACV  188

Query  383  AALESPYACDKTFEVKS  333
             AL +P A   TFE++S
Sbjct  189  QALYAPAARGVTFEMRS  205



>ref|WP_033279106.1| hypothetical protein [Streptomyces sp. NRRL F-525]
Length=236

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 60/111 (54%), Gaps = 13/111 (12%)
 Frame = -2

Query  665  PRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIVRP  486
            P FV +    VTR + P                 G +L ++L GE+ VR SG+PYT++RP
Sbjct  108  PHFVLISQRHVTRRDHP-------------MNAYGRMLDWRLAGENAVRSSGLPYTVIRP  154

Query  485  CALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKS  333
              LT+EP    L  +QGD   G+++R  VA  CV AL SP A   TFE++S
Sbjct  155  GWLTDEPDHGHLHLEQGDLGDGRVARPLVADACVQALYSPAAQGVTFEMRS  205



>ref|WP_035847875.1| hypothetical protein [Kitasatospora azatica]
Length=230

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 67/118 (57%), Gaps = 9/118 (8%)
 Frame = -2

Query  653  HVGSAGVTRPERPGLDLSKQPPAVRLNKEL---GFILTFKLKGEDLVRESGIPYTIVRPC  483
            HV +A      RP   L  Q  A      L   G +L ++  GE+++RESG+PYT+VRP 
Sbjct  96   HVLAAATAGGNRPHFVLVSQVHATHQGHPLNAYGRLLVWRFAGEEVLRESGLPYTVVRPG  155

Query  482  ALTEEP-AGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVIPFSEP  312
             L ++  AG  +  +QGD  TG+++R++VA  CV AL +P A   TFE+     F+EP
Sbjct  156  WLIDDHEAGRRVRLEQGDQGTGRVARDDVAEACVQALYTPAARGVTFEI-----FNEP  208



>ref|XP_002294504.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88338.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=398

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -2

Query  671  ITPRFVHVGSAGVTRP-----ERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGI  507
            + P+ + + SAGVTRP     ++  L+ S   P VRLN   G IL  K + ED++R  G+
Sbjct  190  VLPKVIMLSSAGVTRPGWSEEKKVALEGSAGIPIVRLN-PFG-ILGVKAESEDILRNCGV  247

Query  506  PYTIVRPCALTEE-PAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSV  330
             Y+I RP  L ++ PA    IF QGD   G+I+R++VA+I V  L +P A  KTFE  S 
Sbjct  248  DYSIFRPTGLNDKWPANQRPIFSQGDVAVGRINRKDVAKILVDLLSTPEATGKTFEAFS-  306

Query  329  IPFSEPY  309
            I  SE Y
Sbjct  307  IANSEGY  313



>ref|XP_002176753.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51216.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=372

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 88/171 (51%), Gaps = 17/171 (10%)
 Frame = -2

Query  704  LSQIRAYIKDPITPRFVHVGSAGVTRPERPGLDLSKQP-----PAVRLNKELGFILTFKL  540
            LS ++A   +P+ P+ +   SAGVTRP        + P     P VRLN   G IL  K 
Sbjct  165  LSAVQATGGEPL-PKVILCSSAGVTRPIWDDAKKQRFPGAANIPIVRLNP-FG-ILDIKR  221

Query  539  KGEDLVRESGIPYTIVRPCALTEE-PAGADLIFDQGDNITGKISREEVARICVAALESPY  363
              E+ +R++G  Y IVRP  L +  PAG+  IF QGD   G+I+R++VA++ V  L +P 
Sbjct  222  MSEEKLRDTGADYCIVRPSGLNDSWPAGSRPIFSQGDVAVGRINRKDVAKVLVDVLTAPE  281

Query  362  ACDKTFEVKSVIPFSEPYTVDPENPPPEKDYDVYFKTLKEGITGKESLEPT  210
            A  KTFE  +V  + +  ++ P      KD         EG+   E +E T
Sbjct  282  ATGKTFETTAVAGYPKAPSIAPVLSRLRKD--------SEGLPSMEQIEGT  324



>ref|WP_030921505.1| hypothetical protein [Streptomyces sp. NRRL S-384]
Length=230

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 64/113 (57%), Gaps = 9/113 (8%)
 Frame = -2

Query  623  ERPGLDLSKQPPAVRLNKEL---GFILTFKLKGEDLVRESGIPYTIVRPCALTE-EPAGA  456
             RP + L  Q  A  L   L   G +L ++L GE+ VR+SG+PYT++RP  LT+   AG 
Sbjct  106  HRPRVVLVSQIHATHLAHPLNAYGRVLEWRLAGENAVRDSGLPYTVIRPGWLTDTREAGG  165

Query  455  DLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKSVIPFSEPYTVDP  297
             +  +QGD  +G++SR ++A  CV AL  P A   TFE+     F+EP    P
Sbjct  166  RVRLEQGDRGSGQVSRPDLAEACVQALLHPAADGVTFEI-----FNEPGDASP  213



>ref|WP_019060063.1| hypothetical protein [Streptomyces prunicolor]
Length=236

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 59/111 (53%), Gaps = 13/111 (12%)
 Frame = -2

Query  665  PRFVHVGSAGVTRPERPGLDLSKQPPAVRLNKELGFILTFKLKGEDLVRESGIPYTIVRP  486
            P FV V    VTR + P                 G +L ++L GE+ VR SG+PYT++RP
Sbjct  108  PHFVLVSQRHVTRRDHP-------------MNAYGRMLDWRLAGENAVRSSGLPYTVIRP  154

Query  485  CALTEEPAGADLIFDQGDNITGKISREEVARICVAALESPYACDKTFEVKS  333
              LT++     L  +QGD   G+++R  VA  CV AL SP A   TFE++S
Sbjct  155  GWLTDDLGHGHLHLEQGDLGDGRVARPLVADACVQALYSPAAQGVTFEMRS  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410