BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027I20

Length=793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            174   3e-46   Nicotiana sylvestris
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       169   1e-44   Nicotiana tomentosiformis
emb|CDP13516.1|  unnamed protein product                                166   1e-43   Coffea canephora [robusta coffee]
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       164   9e-43   
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             162   3e-42   Phaseolus vulgaris [French bean]
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       163   3e-42   
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       162   3e-42   Solanum tuberosum [potatoes]
ref|XP_002308665.2|  grr1 family protein                                162   4e-42   
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       162   6e-42   Populus euphratica
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       161   1e-41   Populus euphratica
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         161   1e-41   Jatropha curcas
ref|XP_002515516.1|  grr1, plant, putative                              161   1e-41   Ricinus communis
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       161   1e-41   Solanum tuberosum [potatoes]
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       160   1e-41   Solanum lycopersicum
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             160   1e-41   
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    160   3e-41   Glycine max [soybeans]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       159   3e-41   Cicer arietinum [garbanzo]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                159   4e-41   Erythranthe guttata [common monkey flower]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             159   4e-41   
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    159   4e-41   Prunus mume [ume]
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   5e-41   Populus euphratica
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       159   7e-41   Pyrus x bretschneideri [bai li]
gb|KHN33913.1|  EIN3-binding F-box protein 1                            159   7e-41   Glycine soja [wild soybean]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       158   8e-41   Pyrus x bretschneideri [bai li]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       158   9e-41   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       158   1e-40   Pyrus x bretschneideri [bai li]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       158   1e-40   Citrus sinensis [apfelsine]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             158   1e-40   Citrus clementina [clementine]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             157   2e-40   Prunus persica
gb|AFT92041.1|  EIN3 binding F-box 1                                    157   3e-40   Malus domestica [apple tree]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             157   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    156   5e-40   
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    156   5e-40   
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       156   5e-40   
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   156   6e-40   Citrus sinensis [apfelsine]
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   6e-40   Populus euphratica
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       156   6e-40   Populus euphratica
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             156   6e-40   
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    156   7e-40   
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    156   7e-40   
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       155   1e-39   
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             154   2e-39   
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            155   2e-39   Sesamum indicum [beniseed]
ref|XP_007011864.1|  EIN3-binding F box protein 1                       155   2e-39   
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         154   3e-39   Jatropha curcas
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   5e-39   Fragaria vesca subsp. vesca
gb|AFU61111.1|  F-box protein                                           153   5e-39   Capsicum annuum
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   6e-39   
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            153   6e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       153   7e-39   Solanum lycopersicum
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   7e-39   Nicotiana tomentosiformis
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       153   8e-39   
ref|XP_002524506.1|  grr1, plant, putative                              152   1e-38   Ricinus communis
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       152   1e-38   
ref|XP_003588766.1|  Ein3-binding f-box protein                         152   2e-38   Medicago truncatula
gb|KJB65824.1|  hypothetical protein B456_010G114900                    152   2e-38   Gossypium raimondii
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       152   2e-38   Sesamum indicum [beniseed]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    151   2e-38   Gossypium raimondii
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       152   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       151   3e-38   Sesamum indicum [beniseed]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  151   3e-38   Cucumis sativus [cucumbers]
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       150   4e-38   Nicotiana sylvestris
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   4e-38   
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   4e-38   Glycine max [soybeans]
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   5e-38   Solanum tuberosum [potatoes]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   5e-38   Glycine max [soybeans]
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   5e-38   Glycine max [soybeans]
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   6e-38   Vitis vinifera
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   6e-38   Nelumbo nucifera [Indian lotus]
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   6e-38   Nicotiana sylvestris
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       150   8e-38   Pyrus x bretschneideri [bai li]
gb|KJB65823.1|  hypothetical protein B456_010G114900                    150   8e-38   Gossypium raimondii
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       148   3e-37   Cicer arietinum [garbanzo]
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      149   3e-37   Gossypium arboreum [tree cotton]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       147   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       147   6e-37   Nicotiana tomentosiformis
gb|KJB55011.1|  hypothetical protein B456_009G058000                    147   7e-37   Gossypium raimondii
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       147   7e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      147   7e-37   Gossypium arboreum [tree cotton]
gb|KJB82811.1|  hypothetical protein B456_013G215000                    147   1e-36   Gossypium raimondii
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     146   1e-36   Eucalyptus grandis [rose gum]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       146   2e-36   Cucumis sativus [cucumbers]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    146   2e-36   Eucalyptus grandis [rose gum]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       146   2e-36   Fragaria vesca subsp. vesca
gb|KJB07737.1|  hypothetical protein B456_001G042600                    146   2e-36   Gossypium raimondii
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             145   3e-36   Phaseolus vulgaris [French bean]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    145   4e-36   
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    145   6e-36   
gb|KJB54023.1|  hypothetical protein B456_009G017100                    144   1e-35   Gossypium raimondii
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                144   1e-35   Erythranthe guttata [common monkey flower]
gb|KHN07078.1|  EIN3-binding F-box protein 1                            143   2e-35   Glycine soja [wild soybean]
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     142   2e-35   Eucalyptus grandis [rose gum]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       143   3e-35   Cucumis melo [Oriental melon]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       142   4e-35   Eucalyptus grandis [rose gum]
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       142   4e-35   Eucalyptus grandis [rose gum]
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      142   4e-35   Gossypium arboreum [tree cotton]
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      142   4e-35   Gossypium arboreum [tree cotton]
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       142   5e-35   Cucumis sativus [cucumbers]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             141   8e-35   Phaseolus vulgaris [French bean]
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            141   1e-34   Cucumis melo [Oriental melon]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like       141   1e-34   
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       141   2e-34   Elaeis guineensis
gb|EPS63879.1|  f-box family protein                                    141   2e-34   Genlisea aurea
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       140   2e-34   Vitis vinifera
gb|KEH32122.1|  EIN3-binding F-box-like protein                         140   3e-34   Medicago truncatula
gb|KEH32121.1|  EIN3-binding F-box-like protein                         140   3e-34   Medicago truncatula
ref|XP_010086585.1|  hypothetical protein L484_002248                   139   4e-34   Morus notabilis
ref|XP_003609344.1|  Ein3-binding f-box protein                         140   5e-34   
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             139   8e-34   Phaseolus vulgaris [French bean]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                138   1e-33   Erythranthe guttata [common monkey flower]
gb|EPS63568.1|  ein3-binding f-box protein 3                            137   2e-33   Genlisea aurea
gb|KJB07621.1|  hypothetical protein B456_001G033400                    137   2e-33   Gossypium raimondii
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       137   3e-33   Phoenix dactylifera
emb|CAN83761.1|  hypothetical protein VITISV_043743                     137   3e-33   Vitis vinifera
gb|AEK81539.1|  EIN3 binding F-box 1                                    137   3e-33   Dianthus caryophyllus [carnation]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       136   6e-33   Phoenix dactylifera
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       136   9e-33   Elaeis guineensis
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    135   9e-33   Glycine max [soybeans]
gb|AES91540.2|  EIN3-binding F-box-like protein                         135   1e-32   Medicago truncatula
dbj|BAF01819.1|  putative glucose regulated repressor protein           133   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            135   2e-32   Camelina sativa [gold-of-pleasure]
dbj|BAH20224.1|  AT2G25490                                              133   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like       134   5e-32   
ref|NP_565597.1|  EIN3-binding F-box protein 1                          134   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609343.1|  Ein3-binding f-box protein                         135   7e-32   
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       133   8e-32   Tarenaya hassleriana [spider flower]
gb|ACF81449.1|  unknown                                                 127   1e-31   Zea mays [maize]
emb|CDX87090.1|  BnaC09g04050D                                          132   1e-31   
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             133   1e-31   Capsella rubella
ref|XP_006648432.1|  PREDICTED: EIN3-binding F-box protein 1-like       131   1e-31   
emb|CBI21043.3|  unnamed protein product                                132   1e-31   Vitis vinifera
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       132   2e-31   Brassica rapa
ref|NP_001237471.1|  grr1 protein                                       133   2e-31   
gb|ABK25485.1|  unknown                                                 131   2e-31   Picea sitchensis
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             132   3e-31   Eutrema salsugineum [saltwater cress]
emb|CDX80503.1|  BnaC07g29410D                                          131   4e-31   
dbj|BAJ34438.1|  unnamed protein product                                130   4e-31   Eutrema halophilum
ref|XP_002880682.1|  ein3-binding F box protein 1                       130   9e-31   
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       130   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          130   1e-30   Amborella trichopoda
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             130   1e-30   Eutrema salsugineum [saltwater cress]
emb|CDY19807.1|  BnaA09g04600D                                          129   2e-30   Brassica napus [oilseed rape]
ref|NP_001132560.1|  F-box family member                                127   2e-30   
emb|CDX88173.1|  BnaA06g27640D                                          129   3e-30   
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            129   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like       129   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001046222.1|  Os02g0200900                                       127   6e-30   
gb|ACR35519.1|  unknown                                                 127   6e-30   Zea mays [maize]
ref|XP_002437255.1|  hypothetical protein SORBIDRAFT_10g023670          124   6e-30   
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like       128   6e-30   Tarenaya hassleriana [spider flower]
emb|CAN82790.1|  hypothetical protein VITISV_030601                     128   8e-30   Vitis vinifera
ref|XP_004170235.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    126   9e-30   
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2            127   1e-29   Brassica rapa
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             127   1e-29   Capsella rubella
dbj|BAD15849.1|  putative F-box protein                                 127   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1          127   2e-29   
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       127   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADW83728.1|  EIN3-binding F-box protein 1                            125   2e-29   Musa acuminata AAA Group [Cavendish banana]
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   3e-29   Setaria italica
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like       126   3e-29   Cucumis sativus [cucumbers]
ref|XP_002874252.1|  ein3-binding F box protein 2                       125   3e-29   
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1            125   3e-29   Brassica rapa
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like       125   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like       125   5e-29   Cucumis melo [Oriental melon]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    125   6e-29   Arabis alpina [alpine rockcress]
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            125   6e-29   Camelina sativa [gold-of-pleasure]
emb|CDY35358.1|  BnaA04g14890D                                          125   7e-29   Brassica napus [oilseed rape]
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like       125   7e-29   Setaria italica
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       125   8e-29   Camelina sativa [gold-of-pleasure]
ref|NP_001145991.1|  uncharacterized protein LOC100279520               124   8e-29   
gb|EAY84905.1|  hypothetical protein OsI_06273                          124   1e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_197917.1|  EIN3-binding F-box protein 2                          124   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       124   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            124   2e-28   Camelina sativa [gold-of-pleasure]
gb|AES73649.2|  EIN3-binding F-box-like protein                         124   2e-28   Medicago truncatula
emb|CDP10419.1|  unnamed protein product                                124   2e-28   Coffea canephora [robusta coffee]
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870          124   2e-28   Sorghum bicolor [broomcorn]
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...    123   3e-28   
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like       123   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       123   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001147557.1|  LOC100281166                                       122   4e-28   Zea mays [maize]
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                    123   5e-28   
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       122   6e-28   Tarenaya hassleriana [spider flower]
gb|EMS45959.1|  hypothetical protein TRIUR3_29988                       120   8e-28   Triticum urartu
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       122   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACB59221.1|  F-box protein                                           121   1e-27   Brassica oleracea
gb|KHM99176.1|  EIN3-binding F-box protein 1                            114   2e-27   Glycine soja [wild soybean]
gb|EMT32544.1|  hypothetical protein F775_30491                         119   3e-27   
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like       120   3e-27   Oryza brachyantha
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                    120   4e-27   
dbj|BAD35544.1|  putative F-box protein Fbl2                            120   4e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ01599.1|  hypothetical protein OsI_23635                          120   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like       116   7e-26   Brachypodium distachyon [annual false brome]
gb|AFA36487.1|  EIN3-binding F-box protein                              112   8e-26   Lolium perenne [perennial ryegrass]
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1            115   2e-25   Brachypodium distachyon [annual false brome]
gb|EMT19526.1|  hypothetical protein F775_07091                         115   3e-25   
dbj|BAJ88579.1|  predicted protein                                      114   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68820.1|  hypothetical protein TRIUR3_29831                       112   8e-25   Triticum urartu
ref|XP_003603398.1|  Ein3-binding f-box protein                         112   2e-24   
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g             101   1e-20   Phaseolus vulgaris [French bean]
ref|XP_001775242.1|  predicted protein                                94.7    2e-18   
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like     90.9    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like     89.4    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_001783097.1|  predicted protein                                89.0    2e-16   
emb|CDX76980.1|  BnaC04g37750D                                        83.2    1e-14   
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441           82.4    3e-14   
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861           82.0    3e-14   
ref|NP_001058023.1|  Os06g0605900                                     75.5    1e-13   
ref|XP_002963689.1|  hypothetical protein SELMODRAFT_62165            76.3    3e-12   
ref|XP_009386195.1|  PREDICTED: EIN3-binding F-box protein 1-like     75.5    4e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849175.1|  hypothetical protein AMTR_s00027p00189050        75.5    5e-12   
ref|XP_009032915.1|  hypothetical protein AURANDRAFT_11299            72.0    3e-11   Aureococcus anophagefferens
ref|XP_009523402.1|  hypothetical protein PHYSODRAFT_489031           71.6    1e-10   Phytophthora sojae
ref|XP_002974778.1|  hypothetical protein SELMODRAFT_442539           69.7    4e-10   Selaginella moellendorffii
ref|XP_009414462.1|  PREDICTED: EIN3-binding F-box protein 1-like     69.3    4e-10   
emb|CDQ65477.1|  unnamed protein product                              67.0    6e-10   Oncorhynchus mykiss
ref|XP_001635812.1|  predicted protein                                66.6    1e-09   Nematostella vectensis
ref|XP_002908196.1|  conserved hypothetical protein                   67.0    4e-09   Phytophthora infestans T30-4
gb|ETP54439.1|  hypothetical protein F442_00817                       67.0    4e-09   Phytophthora parasitica P10297
gb|ETP26438.1|  hypothetical protein F441_00841                       67.0    4e-09   Phytophthora parasitica CJ01A1
gb|ETL49854.1|  hypothetical protein L916_00795                       67.0    4e-09   Phytophthora parasitica
gb|ETK96431.1|  hypothetical protein L915_00805                       67.0    4e-09   Phytophthora parasitica
gb|ETI56676.1|  hypothetical protein F443_00864                       67.0    4e-09   Phytophthora parasitica P1569
ref|XP_008891235.1|  hypothetical protein PPTG_20788                  66.2    5e-09   Phytophthora parasitica INRA-310
ref|XP_009859252.1|  PREDICTED: protein AMN1 homolog                  63.9    7e-09   
ref|XP_009065234.1|  hypothetical protein LOTGIDRAFT_184154           64.3    8e-09   Lottia gigantea
gb|ETO85437.1|  hypothetical protein F444_00872                       65.1    1e-08   Phytophthora parasitica P1976
ref|XP_010903725.1|  PREDICTED: protein AMN1 homolog                  63.5    1e-08   
ref|XP_008035164.1|  RNI-like protein                                 64.3    2e-08   Trametes versicolor FP-101664 SS1
ref|WP_032112559.1|  hypothetical protein                             62.0    4e-08   
ref|XP_001783600.1|  predicted protein                                62.8    5e-08   
gb|ELU01858.1|  hypothetical protein CAPTEDRAFT_191279                62.0    1e-07   Capitella teleta
ref|XP_003727308.1|  PREDICTED: protein AMN1 homolog                  61.2    1e-07   
ref|XP_002981401.1|  hypothetical protein SELMODRAFT_420841           62.0    1e-07   Selaginella moellendorffii
gb|ETM02924.1|  hypothetical protein L917_00764                       62.0    2e-07   Phytophthora parasitica
ref|XP_004345962.1|  leucine rich repeat domain containing protein    62.0    2e-07   Acanthamoeba castellanii str. Neff
gb|KDQ64252.1|  hypothetical protein JAAARDRAFT_118397                61.6    2e-07   Jaapia argillacea MUCL 33604
dbj|GAM19532.1|  hypothetical protein SAMD00019534_027070             61.6    2e-07   Acytostelium subglobosum LB1
gb|EFA03310.1|  hypothetical protein TcasGA2_TC013252                 61.2    3e-07   
ref|XP_010908612.1|  PREDICTED: EIN3-binding F-box protein 1-like     60.8    3e-07   Elaeis guineensis
ref|XP_002969928.1|  hypothetical protein SELMODRAFT_410553           60.5    3e-07   Selaginella moellendorffii
ref|XP_001630901.1|  predicted protein                                58.9    4e-07   Nematostella vectensis
ref|XP_317696.4|  AGAP007807-PA                                       60.1    5e-07   Anopheles gambiae str. PEST
ref|XP_008604897.1|  hypothetical protein SDRG_01159                  60.1    5e-07   Saprolegnia diclina VS20
gb|KIJ70119.1|  hypothetical protein HYDPIDRAFT_172019                60.5    5e-07   Hydnomerulius pinastri MD-312
gb|KIJ58308.1|  hypothetical protein HYDPIDRAFT_55403                 60.5    5e-07   Hydnomerulius pinastri MD-312
gb|ETN67343.1|  f-box/leucine rich repeat protein                     59.7    7e-07   Anopheles darlingi [American malaria mosquito]
ref|XP_009393361.1|  PREDICTED: F-box/LRR-repeat protein 4            59.7    7e-07   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO71371.1|  hypothetical protein BN946_scf184908.g129            59.7    8e-07   Trametes cinnabarina
ref|XP_002900439.1|  sporangia induced conserved hypothetical pro...  59.3    1e-06   Phytophthora infestans T30-4
gb|KFB36115.1|  AGAP007807-PA-like protein                            59.3    1e-06   Anopheles sinensis
gb|KDQ29450.1|  hypothetical protein PLEOSDRAFT_1103472               59.3    1e-06   Pleurotus ostreatus PC15
ref|XP_010424250.1|  PREDICTED: F-box/LRR-repeat protein 2-like       58.9    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_001510661.3|  PREDICTED: protein AMN1 homolog                  58.2    1e-06   
ref|NP_001132304.1|  uncharacterized protein LOC100193745             55.8    1e-06   
ref|XP_001783427.1|  predicted protein                                58.5    1e-06   
ref|XP_008618836.1|  hypothetical protein SDRG_14482                  59.3    1e-06   Saprolegnia diclina VS20
ref|XP_007862154.1|  RNI-like protein                                 59.3    1e-06   Gloeophyllum trabeum ATCC 11539
ref|XP_004611387.1|  PREDICTED: protein AMN1 homolog                  57.4    1e-06   Sorex araneus [Eurasian shrew]
ref|XP_011294617.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  58.9    1e-06   
ref|XP_002062979.1|  GK21630                                          58.9    2e-06   
ref|XP_006287878.1|  hypothetical protein CARUB_v10001105mg           58.5    2e-06   Capsella rubella
gb|KDP40481.1|  hypothetical protein JCGZ_24480                       58.5    2e-06   Jatropha curcas
gb|ABI64127.1|  putative F-box and leucine-rich repeat protein        58.5    2e-06   Jatropha curcas
emb|CBI28209.3|  unnamed protein product                              58.5    2e-06   Vitis vinifera
emb|CBJ27438.1|  Hypothetical leucine rich repeat calmodulin bind...  58.5    2e-06   Ectocarpus siliculosus
ref|XP_010067019.1|  PREDICTED: F-box/LRR-repeat protein 4            58.2    2e-06   Eucalyptus grandis [rose gum]
ref|XP_005051563.1|  PREDICTED: F-box and leucine-rich protein 22...  55.5    2e-06   
ref|XP_001986492.1|  GH20493                                          58.5    2e-06   Drosophila grimshawi
ref|XP_010157665.1|  PREDICTED: F-box/LRR-repeat protein 20           56.6    2e-06   Eurypyga helias
ref|XP_002999050.1|  conserved hypothetical protein                   58.5    2e-06   Phytophthora infestans T30-4
ref|XP_010493455.1|  PREDICTED: F-box/LRR-repeat protein 2-like       58.2    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002441690.1|  hypothetical protein SORBIDRAFT_08g000800        57.8    3e-06   
ref|XP_003287718.1|  hypothetical protein DICPUDRAFT_32869            58.2    4e-06   Dictyostelium purpureum
ref|XP_009867977.1|  PREDICTED: protein AMN1 homolog                  55.8    4e-06   Apaloderma vittatum
gb|KFP89027.1|  Protein AMN1                                          55.8    4e-06   Apaloderma vittatum
gb|EFA80600.1|  Non-receptor tyrosine kinase spore lysis A            57.8    4e-06   Heterostelium album PN500
ref|XP_010454612.1|  PREDICTED: F-box/LRR-repeat protein 2-like       57.4    4e-06   Camelina sativa [gold-of-pleasure]
dbj|GAM20836.1|  hypothetical protein SAMD00019534_040110             57.8    4e-06   
ref|XP_005096020.1|  PREDICTED: uncharacterized protein LOC101862262  57.8    4e-06   
emb|CDY05352.1|  BnaC02g40600D                                        56.6    4e-06   
ref|XP_009401851.1|  PREDICTED: F-box/LRR-repeat protein 2-like       57.4    5e-06   
gb|EMP28536.1|  Protein AMN1 like protein                             55.5    5e-06   
ref|XP_011022001.1|  PREDICTED: F-box/LRR-repeat protein 4            57.0    5e-06   
ref|XP_008613481.1|  hypothetical protein SDRG_09334                  57.4    5e-06   
ref|XP_008193982.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  57.0    6e-06   
ref|XP_004926778.1|  PREDICTED: F-box/LRR-repeat protein 20-like      56.6    6e-06   
ref|XP_002174750.1|  Rad7 Rhp7                                        57.0    6e-06   
gb|KDO35085.1|  hypothetical protein SPRG_01150                       56.6    7e-06   
gb|KDO32278.1|  hypothetical protein SPRG_02757                       57.4    7e-06   
ref|XP_001837471.2|  SCF E3 ubiquitin ligase complex F-box protei...  57.0    7e-06   
ref|XP_009092417.1|  PREDICTED: protein AMN1 homolog                  56.2    7e-06   
ref|XP_004147107.1|  PREDICTED: F-box/LRR-repeat protein 20-like      56.6    8e-06   
ref|XP_008862817.1|  hypothetical protein H310_01483                  57.0    8e-06   
ref|XP_009150869.1|  PREDICTED: F-box/LRR-repeat protein 2            56.6    8e-06   
ref|XP_002307150.1|  hypothetical protein POPTR_0005s09110g           56.6    8e-06   
tpg|DAA59160.1|  TPA: hypothetical protein ZEAMMB73_277196            56.6    8e-06   
ref|XP_008193983.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  56.6    8e-06   
ref|XP_009519131.1|  hypothetical protein PHYSODRAFT_485942           57.0    8e-06   
tpg|DAA44558.1|  TPA: hypothetical protein ZEAMMB73_857721            55.5    8e-06   
ref|XP_001812041.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  56.6    8e-06   
ref|XP_643082.1|  hypothetical protein DDB_G0276529                   57.0    8e-06   
ref|XP_008675562.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  56.6    8e-06   
ref|XP_010712743.1|  PREDICTED: protein AMN1 homolog                  55.1    9e-06   
ref|XP_002872053.1|  protein binding protein                          56.2    9e-06   
ref|XP_011201070.1|  PREDICTED: F-box/LRR-repeat protein 20           56.6    9e-06   
gb|EFX86579.1|  hypothetical protein DAPPUDRAFT_208061                56.2    1e-05   
ref|XP_010000105.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  56.6    1e-05   
gb|ETO78584.1|  hypothetical protein F444_06521                       56.6    1e-05   
ref|XP_008669943.1|  PREDICTED: F-box/LRR-repeat protein 3-like i...  56.2    1e-05   
gb|ETE57652.1|  F-box/LRR-repeat protein 13                           54.3    1e-05   
ref|XP_007896792.1|  PREDICTED: protein AMN1 homolog isoform X2       54.7    1e-05   
ref|XP_008669944.1|  PREDICTED: F-box/LRR-repeat protein 3-like i...  56.2    1e-05   
ref|XP_004937951.1|  PREDICTED: protein AMN1 homolog isoform X3       55.5    1e-05   
ref|XP_004937954.1|  PREDICTED: protein AMN1 homolog isoform X6       54.7    1e-05   
ref|XP_008619390.1|  hypothetical protein SDRG_15005                  56.2    1e-05   
gb|KFU92743.1|  F-box/LRR-repeat protein 13                           55.8    1e-05   
ref|XP_010408721.1|  PREDICTED: protein AMN1 homolog                  54.7    1e-05   
gb|KIL00050.1|  hypothetical protein PAXRUDRAFT_822068                56.2    1e-05   
ref|XP_002491971.1|  hypothetical protein                             56.2    1e-05   
emb|CCX05037.1|  Similar to SCF E3 ubiquitin ligase complex F-box...  55.8    1e-05   
ref|XP_001959927.1|  GF11789                                          55.8    1e-05   
ref|NP_197725.1|  RNI-like superfamily protein                        55.8    1e-05   
ref|XP_009130116.1|  PREDICTED: F-box/LRR-repeat protein 4-like       55.5    2e-05   
emb|CDX88014.1|  BnaA06g26050D                                        55.5    2e-05   
ref|XP_004937953.1|  PREDICTED: protein AMN1 homolog isoform X5       54.7    2e-05   
ref|XP_008445892.1|  PREDICTED: F-box/LRR-repeat protein 20           55.5    2e-05   
ref|XP_004980134.1|  PREDICTED: F-box/LRR-repeat protein 3-like       55.8    2e-05   
emb|CCO28119.1|  SCF E3 ubiquitin ligase complex F-box protein gr...  55.8    2e-05   
ref|XP_004937952.1|  PREDICTED: protein AMN1 homolog isoform X4       55.1    2e-05   
ref|XP_416368.1|  PREDICTED: protein AMN1 homolog isoformX2           55.1    2e-05   
gb|KFO62552.1|  Protein AMN1                                          54.7    2e-05   
ref|XP_009983749.1|  PREDICTED: protein AMN1 homolog                  54.3    2e-05   
ref|XP_010626841.1|  PREDICTED: protein AMN1 homolog isoform X4       54.3    2e-05   
gb|ADE76117.1|  unknown                                               55.1    2e-05   
ref|XP_002006429.1|  GI21037                                          55.5    2e-05   
ref|XP_008636352.1|  PREDICTED: protein AMN1 homolog                  55.1    2e-05   
ref|XP_007896791.1|  PREDICTED: protein AMN1 homolog isoform X1       54.7    2e-05   
gb|EPB83733.1|  hypothetical protein HMPREF1544_09527                 55.5    2e-05   
ref|XP_004855100.1|  PREDICTED: protein AMN1 homolog isoform X8       53.9    2e-05   
ref|XP_009821206.1|  hypothetical protein H257_00298                  55.5    2e-05   
ref|XP_004855098.1|  PREDICTED: protein AMN1 homolog isoform X6       53.9    2e-05   
gb|KFP92900.1|  Protein AMN1                                          53.5    2e-05   
gb|KFV17592.1|  Protein AMN1                                          54.3    2e-05   
emb|CDM33335.1|  SCF E3 ubiquitin ligase complex F-box protein grrA   55.1    2e-05   
ref|XP_009392099.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.5    2e-05   
emb|CEL59872.1|  SCF E3 ubiquitin ligase complex F-box protein gr...  55.1    3e-05   
ref|XP_007067534.1|  PREDICTED: protein AMN1 homolog                  54.3    3e-05   
ref|XP_010626839.1|  PREDICTED: protein AMN1 homolog isoform X2       54.3    3e-05   
ref|XP_011178811.1|  PREDICTED: F-box/LRR-repeat protein 20           55.1    3e-05   
ref|XP_010626840.1|  PREDICTED: protein AMN1 homolog isoform X3       54.3    3e-05   
ref|XP_004588300.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  54.7    3e-05   
ref|XP_011297964.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  55.1    3e-05   
ref|XP_011297966.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  54.7    3e-05   
ref|XP_004855094.1|  PREDICTED: protein AMN1 homolog isoform X2       54.3    3e-05   
ref|XP_006817466.1|  PREDICTED: protein AMN1 homolog                  52.4    3e-05   
ref|XP_009474114.1|  PREDICTED: F-box/LRR-repeat protein 20           54.7    3e-05   
ref|XP_004855096.1|  PREDICTED: protein AMN1 homolog isoform X4       53.5    3e-05   
gb|KFO34898.1|  F-box/LRR-repeat protein 20                           55.1    3e-05   
gb|KHG11100.1|  F-box/LRR-repeat 4 -like protein                      54.7    3e-05   
ref|XP_004948637.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  54.7    3e-05   
ref|XP_011297967.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  54.7    3e-05   
ref|XP_010287222.1|  PREDICTED: protein AMN1 homolog                  53.5    3e-05   
ref|XP_010626836.1|  PREDICTED: protein AMN1 homolog isoform X1       54.3    3e-05   
gb|ELT99119.1|  hypothetical protein CAPTEDRAFT_20554                 53.5    3e-05   
ref|XP_006812292.1|  PREDICTED: uncharacterized protein LOC102803243  55.1    3e-05   
ref|XP_009917785.1|  PREDICTED: protein AMN1 homolog isoform X3       53.5    3e-05   
gb|KFO87286.1|  F-box/LRR-repeat protein 20                           54.7    4e-05   
ref|XP_009592242.1|  PREDICTED: F-box/LRR-repeat protein 2            54.7    4e-05   
ref|XP_007879777.1|  hypothetical protein PFL1_04062                  55.1    4e-05   
ref|XP_010130458.1|  PREDICTED: F-box/LRR-repeat protein 20           54.3    4e-05   
ref|XP_005051562.1|  PREDICTED: F-box and leucine-rich protein 22...  53.5    4e-05   
ref|XP_010564534.1|  PREDICTED: protein AMN1 homolog isoform X5       53.5    4e-05   
ref|XP_010564531.1|  PREDICTED: protein AMN1 homolog isoform X3       53.9    4e-05   
ref|XP_001235091.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  54.3    4e-05   
ref|XP_004855095.1|  PREDICTED: protein AMN1 homolog isoform X3       53.9    4e-05   
gb|KGL82444.1|  Protein AMN1                                          53.5    4e-05   
ref|NP_587702.1|  DNA repair protein                                  54.7    4e-05   
ref|XP_008111533.1|  PREDICTED: F-box/LRR-repeat protein 20           54.3    4e-05   
ref|XP_004588299.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  54.3    4e-05   
ref|XP_010958005.1|  PREDICTED: F-box/LRR-repeat protein 2            54.3    4e-05   
ref|XP_001862087.1|  f-box/leucine rich repeat protein                54.3    4e-05   
ref|XP_008309369.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...  54.7    4e-05   
ref|XP_010189680.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    4e-05   
ref|XP_010923015.1|  PREDICTED: uncharacterized protein LOC105046191  54.7    4e-05   
gb|KFQ67659.1|  Protein AMN1                                          53.5    4e-05   
ref|XP_004881083.1|  PREDICTED: protein AMN1 homolog                  53.9    4e-05   
ref|XP_010980354.1|  PREDICTED: F-box/LRR-repeat protein 2            54.3    5e-05   
gb|EHB00727.1|  AMN1-like protein                                     54.3    5e-05   
ref|XP_006200681.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  54.3    5e-05   
ref|XP_005031145.1|  PREDICTED: F-box/LRR-repeat protein 20           54.3    5e-05   
emb|CEP07399.1|  hypothetical protein                                 54.3    5e-05   
gb|EOA93203.1|  F-box/LRR-repeat protein 20                           53.9    5e-05   
gb|KFQ40153.1|  F-box/LRR-repeat protein 20                           53.9    5e-05   
ref|XP_002967722.1|  hypothetical protein SELMODRAFT_88742            54.3    5e-05   
ref|XP_008797210.1|  PREDICTED: F-box/LRR-repeat protein 20           54.3    5e-05   
ref|XP_011107698.1|  hypothetical protein H072_1707                   54.3    5e-05   
gb|KFV55236.1|  F-box/LRR-repeat protein 20                           54.3    5e-05   
gb|KFO97482.1|  F-box/LRR-repeat protein 20                           53.9    5e-05   
ref|XP_002964312.1|  hypothetical protein SELMODRAFT_142102           54.3    5e-05   
ref|WP_032113191.1|  hypothetical protein                             52.8    5e-05   
ref|XP_007245724.1|  PREDICTED: F-box/LRR-repeat protein 2            54.3    5e-05   
ref|XP_010080364.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    5e-05   
gb|EHJ64779.1|  hypothetical protein KGM_11122                        54.3    5e-05   
ref|XP_004948638.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    5e-05   
ref|XP_006022657.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    5e-05   
gb|ETE70898.1|  F-box/LRR-repeat protein 20                           53.9    5e-05   
ref|XP_009575812.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    5e-05   
gb|ETE64399.1|  Protein AMN1-like protein                             53.9    5e-05   
ref|XP_010119165.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  53.9    5e-05   
ref|XP_008503871.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    5e-05   
emb|CDY45764.1|  BnaC02g42180D                                        54.3    5e-05   
ref|XP_009897942.1|  PREDICTED: protein AMN1 homolog                  52.8    5e-05   
gb|EMC85379.1|  F-box/LRR-repeat protein 20                           53.9    5e-05   
ref|XP_009968197.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    5e-05   
ref|XP_009695601.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    5e-05   
gb|KFP42166.1|  F-box/LRR-repeat protein 20                           53.9    5e-05   
ref|XP_005508301.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    5e-05   
ref|XP_002423867.1|  F-box/LRR-repeat protein, putative               53.9    5e-05   
ref|XP_010618356.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    5e-05   
ref|XP_010564527.1|  PREDICTED: protein AMN1 homolog isoform X1       53.5    5e-05   
ref|XP_006747015.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
gb|KFQ73642.1|  F-box/LRR-repeat protein 20                           53.9    6e-05   
ref|XP_006126277.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
ref|XP_004707168.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
ref|XP_006126276.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
ref|XP_010166270.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
gb|ELK01573.1|  F-box/LRR-repeat protein 20                           53.9    6e-05   
emb|CCJ28639.1|  unnamed protein product                              53.9    6e-05   
ref|XP_010564530.1|  PREDICTED: protein AMN1 homolog isoform X2       53.5    6e-05   
ref|XP_009806846.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
ref|XP_009935688.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
ref|XP_005232720.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
dbj|BAG61062.1|  unnamed protein product                              53.9    6e-05   
ref|XP_009273124.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
ref|XP_006275039.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
ref|XP_005301877.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
gb|KFZ69292.1|  F-box/LRR-repeat protein 20                           53.5    6e-05   
gb|KFQ17114.1|  F-box/LRR-repeat protein 20                           53.9    6e-05   
ref|XP_009993006.1|  PREDICTED: F-box/LRR-repeat protein 20           53.9    6e-05   
ref|XP_004822225.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  53.9    6e-05   
ref|XP_007482381.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
ref|XP_004632237.1|  PREDICTED: protein AMN1 homolog                  53.1    6e-05   
ref|XP_006394600.1|  hypothetical protein EUTSA_v10004329mg           53.9    6e-05   
dbj|BAF84533.1|  unnamed protein product                              53.9    6e-05   
ref|XP_003220839.1|  PREDICTED: protein AMN1 homolog                  53.1    6e-05   
ref|XP_004434635.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
ref|XP_005861962.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
ref|XP_002050125.1|  GJ21964                                          53.9    6e-05   
ref|WP_032114111.1|  hypothetical protein                             53.9    6e-05   
ref|XP_008160940.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    6e-05   
ref|NP_001030268.1|  F-box/LRR-repeat protein 20                      53.9    6e-05   
ref|XP_005297762.1|  PREDICTED: uncharacterized protein LOC101945...  54.3    6e-05   
gb|KFQ06121.1|  F-box/LRR-repeat protein 20                           53.5    7e-05   
ref|XP_004395115.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    7e-05   
ref|XP_004395114.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    7e-05   
ref|XP_001652767.1|  AAEL007442-PA                                    53.9    7e-05   
ref|XP_007177599.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.9    7e-05   
ref|XP_002719383.2|  PREDICTED: F-box/LRR-repeat protein 20           53.9    7e-05   
ref|XP_008946933.1|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
dbj|BAG53862.1|  unnamed protein product                              53.5    7e-05   
ref|XP_005394359.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
dbj|BAG35499.1|  unnamed protein product                              53.5    7e-05   
tpg|DAA18590.1|  TPA: F-box/LRR-repeat protein 20                     53.5    7e-05   
ref|XP_009944408.1|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
ref|XP_006172018.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  53.5    7e-05   
ref|XP_003414736.2|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
ref|XP_005394360.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
gb|KFV66757.1|  Protein AMN1                                          53.1    7e-05   
ref|XP_007660275.1|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
ref|XP_008708807.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  53.5    7e-05   
ref|XP_004455013.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_010220499.1|  PREDICTED: protein AMN1 homolog                  53.1    7e-05   
ref|XP_004225495.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  53.5    7e-05   
ref|XP_009667757.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  53.9    7e-05   
ref|XP_004455014.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_008166709.1|  PREDICTED: uncharacterized protein LOC101945...  53.9    7e-05   
ref|XP_006100835.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_004684312.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_003786473.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|NP_116264.2|  F-box/LRR-repeat protein 20 isoform 1               53.5    7e-05   
ref|XP_007482382.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_006774359.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_003768320.1|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
ref|XP_002131798.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_005368353.1|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
ref|XP_009633416.1|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
ref|XP_001917600.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_008160942.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_008011063.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_004378080.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_007618499.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_009869314.1|  PREDICTED: F-box/LRR-repeat protein 20           53.5    7e-05   
ref|XP_006889440.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  53.5    7e-05   
ref|XP_004608784.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  53.5    7e-05   
ref|XP_006172020.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  53.5    8e-05   
ref|XP_003522022.2|  PREDICTED: F-box/LRR-repeat protein 3-like       53.9    8e-05   
ref|XP_003278353.2|  PREDICTED: F-box/LRR-repeat protein 20           53.5    8e-05   
gb|EFB19926.1|  hypothetical protein PANDA_004954                     53.5    8e-05   



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCPKL H++ +G   ITD+G+  LV SCE GLVKVNL+GCVNV D +VSAI + HG +L
Sbjct  502  RLCPKLTHLELSGLVGITDEGLFPLVQSCEAGLVKVNLSGCVNVTDKSVSAITELHGGSL  561

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC YVTD +LVAI+++C +L ELD+SK  ITDSGI +L  AVQL+L +LSLSGC
Sbjct  562  EFLNVDGCKYVTDATLVAISNNCWLLSELDLSKCGITDSGIASLAGAVQLNLQILSLSGC  621

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+SNK+LP L KLG +L+GLNIQ+C GISSS VD L E+LWR D+L+
Sbjct  622  SMLSNKSLPFLQKLGQTLMGLNIQHCNGISSSAVDLLLEQLWRCDILA  669



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCPKL +++ +G   ITD+G+  L+ SCE GLVK+NL+GCVNV D +VSAI + HG +L
Sbjct  502  RLCPKLTYLELSGLVGITDEGLFPLMQSCEAGLVKMNLSGCVNVTDKSVSAITELHGGSL  561

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC YVTD +LVAI+++C +L ELD+SK  ITDSGI +L  AVQL+L +LSLSGC
Sbjct  562  EFLNVDGCRYVTDATLVAISNNCWLLSELDLSKCGITDSGIASLAGAVQLNLQILSLSGC  621

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+S+K+LP L KLG +L+GLNIQ+C GISSS VD L E+LWR D+L+
Sbjct  622  SMLSDKSLPFLQKLGQTLMGLNIQHCNGISSSAVDLLLEQLWRCDILA  669



>emb|CDP13516.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            +KLCP LVH++ +    ITD+G+L LV S E GLVKVNL+GCVN+ D   +AIAK HG T
Sbjct  372  AKLCPNLVHLELSTLGGITDEGLLPLVESSEAGLVKVNLSGCVNLTDKVTAAIAKLHGCT  431

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            LE LNLDGC  VTD +L AIA+HCS+L ELDVSKSRITD+G  AL  A QL L +LSLSG
Sbjct  432  LEELNLDGCKCVTDATLFAIAEHCSLLSELDVSKSRITDAGTAALAGADQLCLRILSLSG  491

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C +VSN+ L  + KLG +L+GLNIQ+C G+ S  +D L E+LWR D+L
Sbjct  492  CNLVSNRGLLSVEKLGQTLMGLNIQHCYGVKSDALDLLAERLWRCDIL  539



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 134/168 (80%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCPKL H++ +G   +TD+G+  LV SCE GLVKVNL+GCVNV D +VS I + HG +L
Sbjct  498  RLCPKLTHLELSGLLQVTDEGLFPLVQSCEAGLVKVNLSGCVNVTDRSVSFITELHGGSL  557

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E+LN+D C YVTD++L+AI+++C +L ELDVSK  ITDSG+ +L   V+L+L +LSLSGC
Sbjct  558  ESLNVDECRYVTDMTLLAISNNCWLLKELDVSKCGITDSGVASLASTVRLNLQILSLSGC  617

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+S+K++P L KLG +L+GLNIQ+C G+SSS VD L E+LWR D+LS
Sbjct  618  SMLSDKSVPFLQKLGQTLMGLNIQHCNGVSSSCVDLLLEQLWRCDILS  665



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCPKL HV+ +G   +TD G+L ++ S E GLVKVNL+GC NV D  VS++A  HG TL
Sbjct  476  KLCPKLQHVELSGLDGVTDAGLLPVLESSEAGLVKVNLSGCTNVTDKVVSSLANLHGWTL  535

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SL+AIA++C++LC+LDVSK  ITD+GI AL  A Q++L +LSLSGC
Sbjct  536  ENLNLDGCKNISDASLMAIAENCALLCDLDVSKCSITDAGIAALAHAQQINLQILSLSGC  595

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            A+VS+++LP L K+G +L+GLNIQ+C  I+SS VD L E LWR D+LS
Sbjct  596  ALVSDRSLPALRKVGRTLLGLNIQHCNAINSSTVDMLVELLWRCDILS  643



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   +TD G+L+ + SCE GL KVNL+GCVN+ D  VSA+A+ HG TL
Sbjct  530  KLCPQLQHVDFSGLEGVTDSGLLSFLESCEAGLAKVNLSGCVNLTDKVVSAMAESHGWTL  589

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  ++DV LVAIAD C +L ELDVS+  ITD G+ AL  A  L+L +LSLSGC
Sbjct  590  EMLNLEGCVKISDVGLVAIADDCPLLSELDVSRCAITDFGLAALARANHLNLQILSLSGC  649

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +++++K++  L K G +LVGLN+Q+C  IS+S VD L  +LWR D+LS
Sbjct  650  SLITDKSMAALGKTGQTLVGLNLQHCKAISNSTVDRLLGELWRCDILS  697



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCPKL H++ +G   +TD+G+  LV SCE GLVKVNL+GCVNV D +VS I + HG +L
Sbjct  502  RLCPKLTHLELSGLLEVTDEGLFPLVQSCEAGLVKVNLSGCVNVTDRSVSFITELHGGSL  561

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E+LN+D C YVTD +L+AI+++C +L ELD+SK  ITDSGI +L   V+L+L +LSLSGC
Sbjct  562  ESLNVDECPYVTDATLLAISNNCWLLKELDISKCGITDSGIASLASTVRLNLQILSLSGC  621

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+S+K++P L KLG +LVGLNIQ+C G+SS  VD L E+LWR D+LS
Sbjct  622  SMLSDKSVPFLQKLGQTLVGLNIQHCNGVSSRCVDLLLEQLWRCDILS  669



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +V+ +G   +TD G L ++ +CE GLVKVNL+GCVN+ D  VS + +QHG TL
Sbjct  479  KLCPQLQNVELSGLQGVTDAGFLPVLENCEAGLVKVNLSGCVNLSDKVVSVMTEQHGWTL  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+  + QL+L VLS+SGC
Sbjct  539  EVLNLDGCRRITDASLVAIAENCFLLSDLDVSKCATTDSGIAAMARSNQLNLQVLSMSGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+S+K+L  L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  SMISDKSLLALIKLGRTLLGLNLQHCNAISSSTVDVLVERLWRCDILS  646



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   162 bits (409),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   ITD G+L L+ SCE GLVKVNL+GC+++ D  VSA+A+ HG TL
Sbjct  489  KLCPQLQHVDLSGLCGITDSGILPLLESCEAGLVKVNLSGCMSLTDEVVSALARLHGGTL  548

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIA++C  L +LD+SK  +TDSGI  ++ A QL+L VLSLSGC
Sbjct  549  ELLNLDGCRKITDASLVAIAENCLFLSDLDLSKCAVTDSGIAVMSSAEQLNLQVLSLSGC  608

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+LP L K+G +LVGLN+QNC  ISSS V+ L E LWR D+LS
Sbjct  609  SEVSNKSLPCLKKMGRTLVGLNLQNCSSISSSTVELLVESLWRCDILS  656



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +V+ +G   +TD G L ++ +CE GLVKVNL+GCVN+ D  VS + +QHG TL
Sbjct  479  KLCPQLQNVELSGLQGVTDAGFLPVLENCEAGLVKVNLSGCVNLSDKVVSVMTEQHGWTL  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+  + QL+L VLS+SGC
Sbjct  539  EVLNLDGCRRITDASLVAIAENCFLLSDLDVSKCAATDSGIAAMARSNQLNLQVLSMSGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVS+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  SMVSDKSLPALIKLGGTLLGLNLQHCNAISSSTVDVLVERLWRCDILS  646



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 132/168 (79%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +++ +G H +TD G + L+ +CE GLVKVNL+GCVN+ D  VSA+ +QHG TL
Sbjct  478  KLCPQLQNLELSGLHGVTDAGFIPLLENCEAGLVKVNLSGCVNLTDKVVSALTEQHGWTL  537

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGCG +TD SL AIA++C +L +LDVSK  I+DSG++ L  + QL+L + S++GC
Sbjct  538  EVLNLDGCGKITDESLTAIAENCLMLSDLDVSKCAISDSGLMVLARSNQLNLQIFSVAGC  597

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+S+K+LP ++K+G +L+GLNIQ+C  ISSS VD L E+LWR D+LS
Sbjct  598  SMISDKSLPAIVKMGHTLLGLNIQHCNAISSSTVDLLVERLWRCDILS  645



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 131/168 (78%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G   +TD G++ L+ SC  G+VKVNL+GC+N+ D AVSA+ +QHG TL
Sbjct  484  KLCPQLQHVELSGLQGVTDAGLIPLLDSCGAGMVKVNLSGCLNLSDKAVSALTEQHGWTL  543

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  +TD SL AIA++C +L ELDVSKS I+DSG++ L  + QL+L + S SGC
Sbjct  544  EVLNLEGCEKITDASLAAIAENCFLLSELDVSKSAISDSGLMVLARSKQLNLQIFSASGC  603

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+S+++LP L+KLG +L+GLN+Q+C  IS+S +D L E+LWR D+LS
Sbjct  604  SMISDRSLPALVKLGQTLLGLNLQHCNAISTSAIDLLVERLWRCDILS  651



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L H+D +G   ITD G+L L+ S + GLVKVNL  C+NV D  V ++A+ HGETL
Sbjct  475  KLCPQLHHLDLSGLTRITDAGLLPLLESSKAGLVKVNLTHCLNVTDEVVLSLARLHGETL  534

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL++ VQL+L VLSLSGC
Sbjct  535  ELLNLDGCRRVTDASLVAIADNCLLLNDLDVSKCSITDSGLAALSQGVQLNLQVLSLSGC  594

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV+NK+   L  LG SL+GLN+Q+C  I SS +++L E LWR D+LS
Sbjct  595  SMVTNKSFSSLRTLGESLIGLNLQHCNAIGSSRIEALVEDLWRCDILS  642



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L H+D +G   ITD G+L L+ S + GLVKVNL  C+NV D  V ++A+ HGETL
Sbjct  474  KLCPQLHHLDLSGLTRITDAGLLPLLESSKAGLVKVNLTHCMNVTDEVVLSLARLHGETL  533

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL++ VQ++L VLSLSGC
Sbjct  534  ELLNLDGCRKVTDASLVAIADNCLLLNDLDVSKCSITDSGVAALSQGVQMNLQVLSLSGC  593

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV+NK+   L  LG SL+GLN+Q+C  I SS V++L E LWR D+LS
Sbjct  594  SMVTNKSFSSLRTLGESLIGLNLQHCSSIGSSRVEALVEDLWRCDILS  641



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   ITD G+L L+ SCE GLVKVNL+GC+++ D  VSA+A+ HG TL
Sbjct  465  KLCPQLQHVDLSGLCGITDAGLLPLLESCEAGLVKVNLSGCLSLTDEVVSALARLHGGTL  524

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL+AIA++C  L +LDVSK  +TDSGI  L+ A QL+L VLSLSGC
Sbjct  525  ELLNLDGCRKITDASLLAIAENCLFLSDLDVSKCAVTDSGITILSSAEQLNLQVLSLSGC  584

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK LP L K+G +LVGLN+QNC  ISSS V+ L E LWR D+LS
Sbjct  585  SEVSNKILPCLKKMGRTLVGLNLQNCSSISSSTVELLVESLWRCDILS  632



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G   +TD G+L L+ S E GLVKVNL+GC NV +  VS++A  HG TL
Sbjct  477  KLCPQLQHVELSGLEGVTDAGLLPLLESSEAGLVKVNLSGCTNVTNKVVSSLANLHGWTL  536

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SL+AIA++C++LC+LDVSK  ITD+GI AL  A Q++L VLSLSGC
Sbjct  537  ENLNLDGCKNISDASLMAIAENCALLCDLDVSKCAITDAGIEALAHAKQINLQVLSLSGC  596

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+++LP L +LG +L+GLNIQ+C  I+SS VD+L E LWR D+LS
Sbjct  597  TLVSDRSLPALRELGHTLLGLNIQHCNAINSSTVDTLVELLWRCDILS  644



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD TG + ITD G+L L+ +CE GLVKVNL GC N+ D  VSA+A+ HG TL
Sbjct  472  KLCPQLQHVDLTGLYGITDAGLLPLLENCEAGLVKVNLTGCWNLTDHIVSALARLHGGTL  531

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL AIAD+C +L +LDVS+  ITD+GI  L+ A  LSL VLSLSGC
Sbjct  532  ELLNLDGCWNITDASLAAIADNCLLLNDLDVSRCAITDAGIAVLSNANHLSLQVLSLSGC  591

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+ P L  LG +L+GLN+QNC  ISS+ ++ L E LWR D+L+
Sbjct  592  SEVSNKSSPFLTTLGQTLLGLNLQNCNAISSNTIELLVENLWRCDILA  639



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCPKL HVD +G   ITD GVL  V   + GLVK+NL+GC N+ D  V  IAK HGETL
Sbjct  493  RLCPKLTHVDLSGLKGITDAGVLPFVQRADAGLVKLNLSGCANLTDNVVVEIAKVHGETL  552

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC +VTDVSL+AIA +C  + ELDVS+  ITD GI  L  A QLSL + S++GC
Sbjct  553  EVLNLDGCRFVTDVSLMAIAKNCLFMSELDVSQCGITDYGIAVLARAEQLSLQIFSIAGC  612

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            ++VS+K+L  L  LG SL+GLNIQ+C G+S   V+ L EKLWR D+LS
Sbjct  613  SLVSDKSLSSLGMLGKSLLGLNIQHCSGLSYGAVNLLLEKLWRCDILS  660



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   ITD G+L L+ SCE GLVKVNL+GC+++ D  VSA+A+ HG TL
Sbjct  489  KLCPQLQHVDLSGLCGITDSGILPLLESCEAGLVKVNLSGCMSLTDEVVSALARLHGGTL  548

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIA++C  L +LD+SK  +TDSGI  ++ A QL+L VLSLSGC
Sbjct  549  ELLNLDGCRKITDASLVAIAENCLFLSDLDLSKCAVTDSGIAVMSSAEQLNLQVLSLSGC  608

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+LP L K+G +LVGLN+Q C  ISSS V+ L E LWR D+LS
Sbjct  609  SEVSNKSLPCLKKMGRTLVGLNLQKCSSISSSTVELLVESLWRCDILS  656



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L HVDF+G   ITD G L L+ +CE GLVKVNL+GCVNV D  VS++AK HG TL
Sbjct  463  RLCPQLQHVDFSGLEGITDAGFLPLLENCEAGLVKVNLSGCVNVTDKMVSSMAKLHGWTL  522

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E +NL+GC  ++D  LVAIA +C +L +LDVS+  ITD GI +L  A QL+L +L++SGC
Sbjct  523  EMVNLEGCKMISDAGLVAIAGNCPLLSDLDVSRCAITDFGIASLACADQLNLQILAMSGC  582

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  583  PLVSDKSLPALVKMGQTLLGLNLQHCKAISSSTVDRLVEQLWRCDILS  630



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   ITD G+L L+ SCE GLVKVNL+GC+++ D  VSA+A+ HG TL
Sbjct  488  KLCPQLQHVDLSGLCGITDAGLLPLLESCEAGLVKVNLSGCLSLTDEVVSALARLHGGTL  547

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL+AIA++C  L +LDVSK  +TDSGI  L+ A QL+L VLSLSGC
Sbjct  548  ELLNLDGCRKITDASLLAIAENCLFLSDLDVSKCAVTDSGITMLSSAEQLNLQVLSLSGC  607

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK LP L K+G +LVGLN+QNC  ISSS V+ L E LWR D+LS
Sbjct  608  SEVSNKILPCLKKMGRTLVGLNLQNCCSISSSTVELLVESLWRCDILS  655



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG TL
Sbjct  480  KLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMAGLHGWTL  539

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  V+D  L AIA +C++L +LDVS+  ITD GI +L  A QL+L +LS+SGC
Sbjct  540  EVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCAITDFGIASLGHADQLNLQILSVSGC  599

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  600  PLVSDKSLPALVKMGQTLHGLNLQHCNAISSSTVDRLVEQLWRCDILS  647



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G   +TD G+L L+ S E GLVKVNL+GC N+ D  VS++A  HG TL
Sbjct  477  KLCPQLQHVELSGLEGVTDAGLLPLLESSEAGLVKVNLSGCTNITDKVVSSLANLHGWTL  536

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SL+AIA++C++LC+LDVSK  ITD+GI  L  A Q++L +LSLSGC
Sbjct  537  ENLNLDGCKNISDASLMAIAENCALLCDLDVSKCTITDAGIAVLAHAEQINLQILSLSGC  596

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+++L  L KLG +L+GLNIQ+C  I++S VD+L E LWR D+LS
Sbjct  597  TLVSDRSLTALRKLGHTLLGLNIQHCNAINNSTVDTLVEFLWRCDILS  644



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG TL
Sbjct  484  KLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMAGLHGWTL  543

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  V+D  L AIA +C++L +LDVS+  ITD GI +L  A QL+L +LS+SGC
Sbjct  544  EVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRCAITDFGIASLGHADQLNLQILSVSGC  603

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  604  PLVSDKSLPALVKMGQTLHGLNLQHCNAISSSTVDRLVEQLWRCDILS  651



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   158 bits (400),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG TL
Sbjct  479  KLCPQLEHVDFSGLEAITDAGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSLADLHGWTL  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + +NL+GC  V+D  L AIA +C++L +LDVSK  ITD GI +L  A QL+L +LS+SGC
Sbjct  539  KAVNLEGCRRVSDAGLAAIAGNCTLLSDLDVSKCAITDFGIASLAHADQLNLQILSVSGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  PLVSDKSLPALVKIGQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG TL
Sbjct  479  KLCPQLEHVDFSGLEAITDAGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSLADLHGWTL  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E +NLDGC  V+D  L AIA +C++L +LDVSK  ITD GI +L  A  L+L +LS+SGC
Sbjct  539  EVVNLDGCRRVSDAGLAAIAGNCTLLSDLDVSKCAITDFGIASLAHADLLNLQILSVSGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  PLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +VD +G   +TD G L ++ SCE GL KVNL+GCVN+ D  VS +A+ HG TL
Sbjct  478  KLCPQLQNVDLSGLQGVTDAGFLPVLESCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTL  537

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SL+AIAD+C +LC+LDVSK  +TD GI +L     L+L +LSLSGC
Sbjct  538  EMLNLDGCRKISDASLMAIADNCPLLCDLDVSKCAVTDFGIASLAHGNYLNLQILSLSGC  597

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVS+K+L  L KLG +L+GLN+Q+C  IS++ VD L E+LWR DVLS
Sbjct  598  SMVSDKSLGALRKLGQTLLGLNLQHCNAISTNSVDMLVEQLWRCDVLS  645



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +VD +G   +TD G L ++ SCE GL KVNL+GCVN+ D  VS +A+ HG TL
Sbjct  478  KLCPQLQNVDLSGLQGVTDAGFLPVLESCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTL  537

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SL+AIAD+C +LC+LDVSK  +TD GI +L     L+L +LSLSGC
Sbjct  538  EMLNLDGCRKISDASLMAIADNCPLLCDLDVSKCAVTDFGIASLAHGNYLNLQILSLSGC  597

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVS+K+L  L KLG +L+GLN+Q+C  IS++ VD L E+LWR DVLS
Sbjct  598  SMVSDKSLGALRKLGQTLLGLNLQHCNAISTNSVDMLVEQLWRCDVLS  645



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L HVDF+G   ITD G L L+ +CE GLVKVNL+GCVNV D  VS++AK HG TL
Sbjct  479  RLCPQLQHVDFSGLEGITDAGFLPLLENCEAGLVKVNLSGCVNVTDKMVSSMAKLHGWTL  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E +NL+GC  ++D  LVAI  +C +L +LDVS+  ITD GI +L  A QL+L +L++SGC
Sbjct  539  EMVNLEGCKMISDAGLVAITGNCPLLSDLDVSRCAITDFGIASLACADQLNLQILAMSGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  PLVSDKSLPALVKMGQTLLGLNLQHCKAISSSTVDRLVEQLWRCDILS  646



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG T+
Sbjct  479  KLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTM  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L  A QL+L +LS+SGC
Sbjct  539  EVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLAHADQLNLQMLSISGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  PLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            LCP+L +V+ +G   +TD G L+++ +CE GLVKVNL+GC+N+ D  VS + +QHG TLE
Sbjct  480  LCPQLRNVELSGLQGVTDAGFLSVLENCEAGLVKVNLSGCINLSDKVVSVMTEQHGWTLE  539

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+  + QL L VLS+SGC+
Sbjct  540  MLNLDGCRRITDASLVAIAENCFLLYDLDVSKCATTDSGIAAMARSKQLCLQVLSVSGCS  599

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            M+S+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D+L
Sbjct  600  MISDKSLPALVKLGQTLLGLNLQHCNAISSSTVDILVERLWRCDIL  645



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG T+
Sbjct  479  KLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTM  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L  A QL+L  LS+SGC
Sbjct  539  EVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLAHADQLNLQXLSISGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  PLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   156 bits (394),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG T+
Sbjct  479  KLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTM  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L  A QL+L  LS+SGC
Sbjct  539  EVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLAHADQLNLQXLSISGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  599  PLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  646



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G + ITD G+L L+ SCE GLVKVNL+GC+N+ D  V A+ + HG TL
Sbjct  525  KLCPQLQHVDLSGLYGITDAGLLPLLESCEAGLVKVNLSGCLNLTDEVVLALTRLHGGTL  584

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVA+AD+C  L +LDVS+  ITDSG+ AL+ A QL+L VLS SGC
Sbjct  585  ELLNLDGCRRITDASLVAVADNCVFLSDLDVSRCAITDSGVAALSHAEQLNLQVLSFSGC  644

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK++P L KLG +LVGLN+Q+C  ISS  V+ L E LWR D L
Sbjct  645  SGVSNKSMPFLKKLGKTLVGLNLQHCNSISSRTVELLVESLWRCDTL  691



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G + ITD G+  L+ SC+ GLVKVNL+GC+N+ D  V A+A+ H ETL
Sbjct  464  KLCPQLQHVDLSGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETL  523

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAI ++C  L  LDVSK  ITD GI AL+ A QL+L VLSLS C
Sbjct  524  ELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCAITDMGISALSHAEQLNLQVLSLSSC  583

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK++P L KLG +LVGLN+QNC  I+SS V  L E LWR D+LS
Sbjct  584  SEVSNKSMPALKKLGKTLVGLNLQNCNSINSSTVARLVESLWRCDILS  631



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            LCP+L +V+ +G   ITD G L+++ +CE GLVKVNL+GC+N+ D  V  + +QHG TLE
Sbjct  480  LCPQLRNVELSGLQGITDAGFLSVLENCEAGLVKVNLSGCINLSDKVVGVMTEQHGWTLE  539

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+  + QL L VLS+SGC+
Sbjct  540  MLNLDGCKRITDASLVAIAENCFLLYDLDVSKCATTDSGIAAMARSQQLCLQVLSVSGCS  599

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            M+S+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D+L
Sbjct  600  MISDKSLPALVKLGQTLLGLNLQHCNAISSSTVDILVERLWRCDIL  645



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            LCP+L +V+ +G   ITD G L+++ +CE GLVKVNL+GC+N+ D  V  + +QHG TLE
Sbjct  480  LCPQLRNVELSGLQGITDAGFLSVLENCEAGLVKVNLSGCINLSDKVVGVMTEQHGWTLE  539

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             LNLDGC  +TD SLVAIA++C +L +LDVSK   TDSGI A+  + QL L VLS+SGC+
Sbjct  540  MLNLDGCKRITDASLVAIAENCFLLYDLDVSKCATTDSGIAAMARSQQLCLQVLSVSGCS  599

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            M+S+K+LP L+KLG +L+GLN+Q+C  ISSS VD L E+LWR D+L
Sbjct  600  MISDKSLPALVKLGQTLLGLNLQHCNAISSSTVDILVERLWRCDIL  645



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G + ITD G+  L+ SC+ GLVKVNL+GC+N+ D  V A+A+ H ETL
Sbjct  465  KLCPQLQHVDLSGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETL  524

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAI ++C  L  LDVSK  ITD GI AL+ A QL+L VLSLS C
Sbjct  525  ELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCAITDMGISALSHAEQLNLQVLSLSSC  584

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK++P L KLG +LVGLN+QNC  I+SS V  L E LWR D+LS
Sbjct  585  SEVSNKSMPALKKLGKTLVGLNLQNCNSINSSTVARLVESLWRCDILS  632



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG T+
Sbjct  527  KLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTM  586

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L  A QL+L  LS+SGC
Sbjct  587  EVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLAHADQLNLQXLSISGC  646

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  647  PLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  694



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVDF+G   ITD G L LV +CE GLVKVNL+GCVN+ D  VS++A  HG T+
Sbjct  527  KLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTM  586

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  V+D  L AIA +C++L +LDVS+  IT+ GI +L  A QL+L  LS+SGC
Sbjct  587  EVLNLEGCRLVSDAGLAAIAGNCTLLSDLDVSRCAITNFGIASLAHADQLNLQXLSISGC  646

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +VS+K+LP L+K+G +L+GLN+Q+C  ISSS VD L E+LWR D+LS
Sbjct  647  PLVSDKSLPALVKMGQTLLGLNLQHCNAISSSTVDRLVEQLWRCDILS  694



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G + ITD G+  L+ SC+ GLVKVNL+GC+N+ D  V A+A+ H ETL
Sbjct  562  KLCPQLQHVDLSGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETL  621

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAI ++C  L  LDVSK  ITD GI AL+ A QL+L VLSLS C
Sbjct  622  ELLNLDGCRKITDASLVAIGNNCMFLSYLDVSKCAITDMGISALSHAEQLNLQVLSLSSC  681

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK++P L KLG +LVGLN+QNC  I+SS V  L E LWR D+LS
Sbjct  682  SEVSNKSMPALKKLGKTLVGLNLQNCNSINSSTVARLVESLWRCDILS  729



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L +VD +G + +TD G+L+L+ S EEGLVKVNLNGC+N+ D  V A+A+ HGETL
Sbjct  445  RLCPQLQNVDLSGLYGMTDAGILSLLESLEEGLVKVNLNGCLNLTDEVVVALARLHGETL  504

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E L+LDGC  +TD SL AIAD+C  L ELDVSK  ITDSG+  L  A +++L VLS+SGC
Sbjct  505  EVLSLDGCRKITDASLAAIADNCLFLRELDVSKCAITDSGLAFLACADRINLQVLSISGC  564

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + +S+K+L  L KLG +LVGLN+QNC  IS+  V+ L E LWR D+L+
Sbjct  565  SEISHKSLSSLKKLGKTLVGLNLQNCTAISNRSVELLVESLWRCDILA  612



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 127/169 (75%), Gaps = 0/169 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            ++ CPKL  +DF+G   ITD G+L LV + + GLVKVNL+G   + D  V AI++ HGET
Sbjct  498  ARFCPKLTQLDFSGLQGITDAGILPLVQNSDAGLVKVNLSGSAKLTDNVVMAISELHGET  557

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            LE L+LDGC Y+TD+S++AIA +CSVL ELDVS+  ITDSG+  L  A QLSL + SL+G
Sbjct  558  LEVLHLDGCQYITDLSMLAIARNCSVLSELDVSQCGITDSGVAVLASAEQLSLQIFSLAG  617

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            C++VS+K+LP L+ LG +LVGLNIQ+C GIS   VD L ++LWR D+LS
Sbjct  618  CSLVSDKSLPFLVLLGKTLVGLNIQHCRGISCGTVDLLVDQLWRCDILS  666



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +V+ +G H ITD G+L L+ SCE GLVKVNL+GCVN+ D AV  +A  HG TL
Sbjct  530  KLCPQLQNVELSGLHGITDAGILPLLESCEAGLVKVNLSGCVNLSDKAVCVMADLHGWTL  589

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E +NLDGC  ++D S+VAIA++C +L +LDVSK  ITDSGI AL  + Q++L +LS+SGC
Sbjct  590  EMINLDGC-KISDGSVVAIAENCLLLSDLDVSKCSITDSGIAALARSNQINLQILSVSGC  648

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
             MVS+K+LP L KLG +L+GLN+Q C  ISSS VD L E+LWR D+L
Sbjct  649  TMVSDKSLPSLGKLGQTLLGLNLQQCKAISSSAVDLLVEQLWRCDIL  695



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   ITD G+L L+ SCE GLVKVNL+GC+++ D  VS +A+ HG TL
Sbjct  484  KLCPQLQHVDLSGLCAITDSGLLPLLESCEAGLVKVNLSGCMSLTDEVVSVLARLHGGTL  543

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD S+ AIA  C  L +LD+SK  +TDSGI  L  A QL+L VLSLSGC
Sbjct  544  ELLNLDGCRKITDSSVAAIARGCLFLSDLDLSKCAVTDSGIAVLASADQLNLQVLSLSGC  603

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+ P L KLG +L+GLN+Q+C  ISSS VD L E LWR D+LS
Sbjct  604  SEVSNKSFPFLKKLGRTLLGLNLQHCSAISSSTVDLLVENLWRCDILS  651



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L HVDF+G   ITD G L L+ S E GLVKVNL+GCVN+ D AVS +A+ HG TL
Sbjct  478  QLCPQLQHVDFSGLEGITDAGFLKLLKSTEAGLVKVNLSGCVNLTDKAVSVMAELHGWTL  537

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E +NL+GC  ++D  LVAI ++C +L +LD+S+  ITD GI +L  A QL+L +LS+SGC
Sbjct  538  EKVNLEGCRMISDSGLVAIGENCPLLSDLDISRCAITDFGIASLALAGQLNLQILSVSGC  597

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VS+K+LP L+K+G +L+GLN+Q C  ISSS VD L E+LWR D+LS
Sbjct  598  SCVSDKSLPALVKMGETLLGLNLQQCNAISSSTVDRLVEQLWRCDILS  645



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 128/168 (76%), Gaps = 2/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCPKL  +D +G   ITD G+L L+ SCE GLVKVNL+ C+N+ D  V ++A +HGETL
Sbjct  472  KLCPKLHKLDLSGLCGITDAGLLPLLESCE-GLVKVNLSDCLNLTDQVVLSLAARHGETL  530

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIAD+CS+L +LDVSK  ITDSG+ AL+  VQ++L VLSLSGC
Sbjct  531  ELLNLDGCRKVTDASLVAIADNCSLLNDLDVSKCAITDSGVAALSRGVQVNLQVLSLSGC  590

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++P L KLG  L+GLN+Q+C  IS S V+ L E LWR D+ S
Sbjct  591  SMVSNKSVPSLKKLGECLLGLNLQHC-SISCSSVELLAEDLWRCDIFS  637



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L ++D +G + +TD G+L+L+ S EEGLVKVNLNGC+N+ D  V ++   HGETL
Sbjct  480  RLCPQLHNIDLSGLYGMTDAGILSLLESSEEGLVKVNLNGCLNLTDKXVVSLVSLHGETL  539

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIA++C  L ELDVSK  ITDSG+ AL+ A Q++L VLS+SGC
Sbjct  540  EVLNLDGCRKITDASLVAIANNCLFLRELDVSKCAITDSGLAALSSAEQINLQVLSISGC  599

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + +S+K+LP L KLG +L+GLN+Q+C  IS+  ++ L + LWR D+L+
Sbjct  600  SEISHKSLPSLKKLGXTLMGLNLQHCTAISNRSIELLVDSLWRCDILA  647



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 127/171 (74%), Gaps = 2/171 (1%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEG--LVKVNLNGCVNVGDLAVSAIAKQHG  618
            +KLCP+L  V+F G   ITD G+L+L+ SC+ G  LVKV L+GCVNV D  V A+AK HG
Sbjct  471  AKLCPQLQCVNFHGLPYITDAGLLSLIESCDAGAGLVKVGLSGCVNVTDNVVIALAKYHG  530

Query  617  ETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSL  438
             TLE LNL+GCG VTD  LVAIAD C VL ELDVSK  ITD G+  L  + QLSL +LSL
Sbjct  531  GTLEVLNLEGCGKVTDAGLVAIADDCLVLNELDVSKCAITDFGVATLARSKQLSLQILSL  590

Query  437  SGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            SGC+M+S+K LP L+KLG SL+G+N+QNC  ISSS +D L  +L+R D+LS
Sbjct  591  SGCSMLSDKCLPFLVKLGQSLMGMNLQNCNSISSSVIDMLVGRLFRCDILS  641



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCPKL  +D +G   ITD G+L L+ +CE GLVKVNL+ C+N+ D  V ++A +HGETL
Sbjct  472  KLCPKLHQLDLSGLCGITDAGLLPLLENCE-GLVKVNLSDCLNLTDQVVLSLAMRHGETL  530

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIAD+C +L +LDVSKS ITDSG+ AL+  VQ++L VLSLSGC
Sbjct  531  ELLNLDGCRKVTDASLVAIADYCPLLIDLDVSKSAITDSGVAALSRGVQVNLQVLSLSGC  590

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++  L KLG +L+GLN+Q+C  +S S V+ L E LWR D+LS
Sbjct  591  SMVSNKSVLSLKKLGENLLGLNLQHC-SVSCSSVELLVEALWRCDILS  637



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLV-LSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            LCP+L H+D +G   ITD G+L L+ +S + GLVKVN+ GC+N+ D  V ++A+ H ETL
Sbjct  479  LCPQLHHLDLSGLTGITDAGLLPLLEMSSKAGLVKVNITGCLNLTDEVVLSLARLHSETL  538

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL+  VQ++L +LS+SGC
Sbjct  539  EVLNLDGCRKVTDASLVAIADNCPLLNDLDVSKCSITDSGVAALSHGVQVNLQILSISGC  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV+NK++P L KLG SLVGLN+Q+C  ISSS V+ L E LWR D+LS
Sbjct  599  SMVTNKSVPALKKLGESLVGLNLQHCNAISSSRVEILVEDLWRCDILS  646



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   153 bits (386),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L +VD +G + +TD GVL+L+ S EEGLVKVNLNGC+N+ D  V A+ + HGETL
Sbjct  480  RLCPQLHNVDMSGLYGMTDAGVLSLLESLEEGLVKVNLNGCLNLTDEVVMALVRLHGETL  539

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL  IA++C  L ELDVSK  ITDSG+ AL+ A Q++L VLS+SGC
Sbjct  540  EVLNLDGCRKITDASLATIANNCLFLRELDVSKCAITDSGLAALSSADQINLQVLSISGC  599

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + +S+K+LP L KLG +LVGLN+Q+C  +S   ++ L E LWR D+L+
Sbjct  600  SEISHKSLPSLKKLGQTLVGLNLQHCTALSYRSIELLVESLWRCDILA  647



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   ITD G+L L+ S E GLVKVNL+GC+N+ D  +SA+A+ HG +L
Sbjct  481  KLCPQLQHVDLSGLCAITDSGLLPLLESSEAGLVKVNLSGCMNLTDEVISALARIHGGSL  540

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL AI  +C  L +LDVSK  +TDSGI  L+ A +L+L VLSLSGC
Sbjct  541  ELLNLDGCRKITDASLKAITHNCLFLSDLDVSKCAVTDSGIATLSSADRLNLQVLSLSGC  600

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+ P L KLG +L+GLN+QNC  ISS+ V+ L E LWR D+LS
Sbjct  601  SEVSNKSFPFLKKLGRTLMGLNLQNCSSISSNTVELLVESLWRCDILS  648



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +VDF+G   I D G L  + +C+ GLVK+NLNGCVN+ D  VS+I + HG TL
Sbjct  464  KLCPQLQNVDFSGLVGIDDCGFLAWLQNCQLGLVKINLNGCVNLTDEVVSSIMEHHGSTL  523

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L  A QL+L + S+SGC
Sbjct  524  KMLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLAHAKQLNLQIFSISGC  583

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VS K+L  L+ LG +LVGLNIQ+C  ISSS VD L E+LWR D+LS
Sbjct  584  SFVSEKSLADLINLGETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  631



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  V+ TG   +TD G+L L+ S E GLVKVNL+GCVN+ D  VS++   HG TL
Sbjct  476  KLCPQLQQVELTGLKGVTDAGLLPLLESSEAGLVKVNLSGCVNLTDKVVSSLVNLHGWTL  535

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  +++ SL AIA+HC +LC+LD S   I+DSGI AL  A Q++L +LSLSGC
Sbjct  536  EILNLEGCINISNASLAAIAEHCQLLCDLDFSMCTISDSGITALAHAKQINLQILSLSGC  595

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +V++++LP L KLG +L+GLNIQ+C  ISSS V+ L E LWR D+LS
Sbjct  596  TLVTDRSLPALRKLGHTLLGLNIQHCNSISSSAVEMLVEHLWRCDILS  643



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+  G H ITD GVL L+ SCE GL+KVNL+GCVN+ D  V  I+  HG TL
Sbjct  485  KLCPQLQHVELCGLHGITDAGVLLLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTL  544

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SLVAIA++C +L +LD+SK  ITDSGI AL     ++L +LS+SGC
Sbjct  545  ELLNLDGC-KISDASLVAIAENCQLLTDLDISKCTITDSGIAALAHFNPINLQILSVSGC  603

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            +MVS+K+LP L KLG +L+GLN+Q C  ISS  V+ L E+LWR D+L
Sbjct  604  SMVSDKSLPSLGKLGETLLGLNLQQCKAISSRAVELLTEQLWRCDIL  650



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L H+D +G   ITD G+L L+ SCE GL KVNL+ C N+ D  V A+A+ HGETL
Sbjct  480  KLCPQLHHLDLSGLCGITDAGLLPLLESCETGLAKVNLSDCSNLTDEVVLALARLHGETL  539

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL A+A+ C +L +LDVSK  ITD+G+VAL+   Q +L +LS SGC
Sbjct  540  ELLNLDGCQKITDASLAALAESCPLLNDLDVSKCSITDTGVVALSHGSQHNLQILSFSGC  599

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +M+SNK  P L +LG +LVGLN+Q+C  ISS+ ++ L E LWR D+LS
Sbjct  600  SMISNKCRPALEQLGRTLVGLNLQHCNSISSNSIELLTENLWRCDILS  647



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L HVD +G   ITD G+L L+ SCE GLVKVNL+GC+N+ D  V A+ + HG TL
Sbjct  469  RLCPQLQHVDLSGLCGITDAGLLPLLESCEAGLVKVNLSGCLNITDKVVLALTRLHGGTL  528

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL+AIA+ C  L +LDVS+S +TDSG+ AL+ A QL+L VLS SGC
Sbjct  529  ELLNLDGCRRITDASLMAIAESCVFLSDLDVSRSAVTDSGVAALSRAEQLNLQVLSFSGC  588

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK+L  L KLG +L+GLN+Q+C  IS   V+ L E LW+ D+L
Sbjct  589  SRVSNKSLSSLKKLGKTLLGLNLQHCNSISIRTVELLVETLWKCDIL  635



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +++ +G   ITD G+L LV +CE GLVKVNL+GC+N+ D  V+ +AK HG TL
Sbjct  504  KLCPRLQNIELSGLCGITDAGLLPLVENCEPGLVKVNLSGCLNLTDAVVTTMAKHHGGTL  563

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLDGC  +TD SL+AIA++CSVL +LD+SK  ITD G+ A++ A  L L +LSLSGC
Sbjct  564  QLLNLDGCRKITDASLIAIANNCSVLRDLDISKCVITDLGVAAMSSANLLDLQILSLSGC  623

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
              VS+K++P L  LG +LVGLN+Q C  ISSS ++ L E LWR D+LS
Sbjct  624  YQVSDKSMPFLKSLGQNLVGLNLQQCNSISSSTIELLMEHLWRCDILS  671



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP L HVD TG   ITD G+L LV      LVKVNL+GCVN+ D  V+ I K HG TL
Sbjct  502  RLCPGLTHVDLTGLQGITDSGILPLVQRSGVDLVKVNLSGCVNLTDNLVAEITKLHGGTL  561

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TDVSL AIA +CS+L ELDVS+ RITDSGI  L  A QL L VLS++GC
Sbjct  562  EILNLDGCRCITDVSLKAIARNCSLLSELDVSQCRITDSGIAILAGAEQLFLRVLSVAGC  621

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            ++VS+K+LP L  +G SLVGLNIQ+C GIS   V+ L E LWR D+LS
Sbjct  622  SLVSDKSLPFLALVGKSLVGLNIQHCCGISCGTVNQLLEHLWRCDILS  669



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +VDF+G   I D G L  + +C+ GLVK+NLNGCVN+ D  VS++ + HG TL
Sbjct  473  KLCPQLQNVDFSGLVGIEDCGFLAWLQNCQLGLVKINLNGCVNLTDEVVSSLMEHHGSTL  532

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L  A QL+L + S+SGC
Sbjct  533  KMLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLAHAKQLNLQIFSISGC  592

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VS K+L  L+ LG +LVGLNIQ+C  ISSS VD L E+LWR D+LS
Sbjct  593  SFVSEKSLADLINLGETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  640



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCPKL  +D +G   ITD G+L L+ SCE GLVKVNL+ C+N+ D  V ++A+ HGETL
Sbjct  471  KLCPKLHQLDLSGLCGITDAGLLPLLESCEAGLVKVNLSDCLNLTDRVVLSLARLHGETL  530

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIAD+C +L +LDVS   ITDSG+ AL+  VQ +L VLSLSGC
Sbjct  531  ELLNLDGCRKVTDASLVAIADNCPLLNDLDVSTCAITDSGVAALSCGVQANLQVLSLSGC  590

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++P L KLG +L+GLN+Q+C  +S S V+ L E LWR D+LS
Sbjct  591  SMVSNKSVPSLKKLGENLLGLNLQHC-SVSCSAVELLVEDLWRCDILS  637



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP L  V+ +G   ITD+G+L L+  CE GLVKVNL+GC+N+ D  VSA+AK HG TL
Sbjct  476  KICPHLQQVELSGLTGITDEGLLRLLECCEAGLVKVNLSGCINLTDQVVSAMAKLHGRTL  535

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E L LDGC  V+D+ L+AIA++C +L +LDVSK  I+D G++AL  + QLSL VLS+SGC
Sbjct  536  EVLILDGCTKVSDLGLLAIAENCQLLSDLDVSKCAISDFGLMALARSSQLSLQVLSVSGC  595

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            ++VS+K LP L K+G +L+GLN+Q+C  IS+  VD L E+LWR D+L+
Sbjct  596  SLVSDKCLPALKKVGRTLLGLNLQHCTAISTRSVDLLLEELWRCDILA  643



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L H++ TG + ITD G+L L+ +CE GLV VNL GC N+ D  VSA+A+ HG TL
Sbjct  472  KLCPRLQHLNLTGLYGITDAGLLPLLENCEAGLVNVNLTGCWNLTDKVVSALARLHGGTL  531

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIA++  VL +LDVSK  I+D+GI  L+ A   SL VLSLSGC
Sbjct  532  EVLNLDGCWKITDASLVAIANNFLVLNDLDVSKCAISDAGIALLSRASLPSLQVLSLSGC  591

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+ P L KLG +L+GLN+QNC  I SS ++ L EKLWR D+L+
Sbjct  592  SDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSSTMELLVEKLWRCDILA  639



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCPKL  +D +G   ITD G+L L+ +CE GLVKVNL+ C+N+ D  V ++A +HGETL
Sbjct  472  KLCPKLHQLDLSGLCGITDAGLLPLLENCE-GLVKVNLSDCLNLTDQVVLSLATRHGETL  530

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIAD+C +L +LDVSK  ITDSG+ AL+  VQ++L VLSLSGC
Sbjct  531  ELLNLDGCRKVTDASLVAIADYCPLLNDLDVSKCAITDSGVAALSRGVQVNLQVLSLSGC  590

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++P L KLG +L+GLN+Q+C  +S S V+ L E LWR D+LS
Sbjct  591  SMVSNKSVPSLKKLGENLLGLNLQHC-SVSCSSVELLVEDLWRCDILS  637



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L H++ TG + ITD G+L L+ +CE GLV VNL GC N+ D  VSA+A+ HG TL
Sbjct  472  KLCPQLQHLNLTGLYGITDAGLLPLLENCEAGLVNVNLTGCWNLTDNIVSALARLHGGTL  531

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIA++  VL +LDVSK  ITD+G+  L+ A   SL VLSLSGC
Sbjct  532  EVLNLDGCWKITDASLVAIANNFLVLNDLDVSKCAITDAGVAVLSRASLPSLQVLSLSGC  591

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+ P L KLG +L+GLN+QNC  I SS ++ L EKLWR D+L+
Sbjct  592  SDVSNKSAPFLTKLGQTLLGLNLQNCNSIGSSTMELLVEKLWRCDILA  639



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD TG + +TD G++ L+ +CE GLVKVNL GC N+ D  VS +A  HG TL
Sbjct  483  KLCPQLQHVDLTGLYGLTDAGLVPLLENCEAGLVKVNLVGCWNLTDNIVSVLATLHGGTL  542

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIAD+C +L +LDVSK  ITD+GI  L+ A QL+L VLSLS C
Sbjct  543  ELLNLDGCRKITDASLVAIADNCLLLNDLDVSKCAITDAGIAVLSSAKQLTLQVLSLSNC  602

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V+NK+ P L KLG +LVGLN+QNC  I  + V+ L E LWR D+L+
Sbjct  603  SGVTNKSAPSLKKLGQTLVGLNLQNCNSIGCNTVEFLVENLWRCDILA  650



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D +G   IT+ G L L+ SCE  L+KVNL+GC+N+ D  VSA+AK HG TL
Sbjct  500  KLCPQLQRLDLSGALRITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTL  559

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD S+ AIA++C++L +LDVSK+ ITD G+ AL  A  L++ +LSLSGC
Sbjct  560  EQLNLDGCQKITDASMFAIAENCALLSDLDVSKTAITDYGVAALASAKHLNVQILSLSGC  619

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            +++SN+++P L KLG +L+GLN+Q C  ISSS V+ L E+LWR D+L
Sbjct  620  SLISNQSVPFLRKLGQTLLGLNLQQCNTISSSMVNMLVEQLWRCDIL  666



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +VD +G   ITD G+L L+ + E GLVKVNL+GC+N+ D+ V+ +A+ HGETL
Sbjct  506  KLCPQLQYVDLSGLCGITDAGILPLIENSELGLVKVNLSGCMNLTDVVVTTMARLHGETL  565

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLDGC  +TD SL+AIA +C VL +LD+SK  ITD GIVAL+   QL L +LSLSGC
Sbjct  566  QLLNLDGCRKITDASLMAIASNCLVLRDLDISKCAITDFGIVALSSTKQLDLQILSLSGC  625

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
              VS+K++P L  +G +LVGLN+Q C  ISSS ++ L E LWR D+L
Sbjct  626  LHVSDKSMPFLKNMGQNLVGLNLQRCNSISSSTIEILVEHLWRCDIL  672



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLV-LSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            LCP+L H+D +G   ITD G+L L+ +S + GLVKVNL  C+N+ D  V ++A+ HGETL
Sbjct  478  LCPQLHHLDLSGLTGITDAGLLPLLEMSSKAGLVKVNLTDCLNLTDEVVLSLARLHGETL  537

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SLVAIA++C +L +LDVSK  ITDSG+ AL+  VQ++L +LS+SGC
Sbjct  538  ELLNLDGCRKVTDASLVAIANNCPLLNDLDVSKCSITDSGVAALSHGVQVNLQILSISGC  597

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV+ K++P L+KLG SLVGLN+Q+C  ISSS V+ + E LWR D+LS
Sbjct  598  SMVTKKSVPSLIKLGESLVGLNLQHCNAISSSRVEIIVEDLWRCDILS  645



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   150 bits (378),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 126/168 (75%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L +VD +G + +TD GVL+L+ S EEGLVKVNLNGC+N+ D  V A+ + HGETL
Sbjct  480  RLCPQLHNVDMSGLYGMTDAGVLSLLGSLEEGLVKVNLNGCLNLTDEVVMALVRLHGETL  539

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL  IA +C  L ELDVSK  ITDSG+ AL+ A Q++L VLS+SGC
Sbjct  540  EVLNLDGCRKITDASLATIASNCLFLRELDVSKCAITDSGLAALSSADQINLQVLSVSGC  599

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + +S+K+LP L KLG +LVGLN+Q+C  + +  ++ L E LWR D+L+
Sbjct  600  SEISHKSLPSLKKLGQTLVGLNLQHCTALGNGSIELLVESLWRCDILA  647



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 1/164 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+  G H ITD GVL L+ SCE GL+KVNL+GCVN+ D  V  I+  HG TL
Sbjct  485  KLCPQLQHVELCGLHGITDAGVLLLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTL  544

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SLVAIA++C +L +LD+SK  ITDSGI AL     ++L +LS+SGC
Sbjct  545  ELLNLDGC-KISDASLVAIAENCQLLTDLDISKCTITDSGIAALAHFNPINLQILSVSGC  603

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRY  297
            +MVS+K+LP L KLG +L+GLN+Q C  ISS  V+ L E+LWR+
Sbjct  604  SMVSDKSLPSLGKLGETLLGLNLQQCKAISSRAVELLTEQLWRF  647



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 124/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  V+ TG   + D G+L L+ S E GL+KVNL+GCVN+ D  VS++   HG TL
Sbjct  474  KLCPQLQQVELTGLKGVNDAGLLPLLESSEAGLIKVNLSGCVNLTDKVVSSLVNLHGWTL  533

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  +++ SLVAIA+HC +L +LDVS   I+D+GI +L  A QL+L VLSLSGC
Sbjct  534  ELLNLEGCKNISNASLVAIAEHCQLLSDLDVSMCAISDAGIASLAHAKQLNLQVLSLSGC  593

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             +V++++LP L KLG +L+GLNIQ+C  ISSS V+ L E LWR D+LS
Sbjct  594  TLVTDRSLPALRKLGHTLLGLNIQHCNSISSSAVEMLVELLWRCDILS  641



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L HV+  G H ITD GVL L+ SCE GL+KVNL+GCVN+ D  V  I+  HG TL
Sbjct  485  KLCPHLQHVELCGLHGITDAGVLPLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTL  544

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  ++D SLVAI ++C +L +LD+SK  ITDSGI AL     ++L +LS+SGC
Sbjct  545  ELLNLNGC-KISDASLVAIGENCQLLTDLDISKCTITDSGIAALAHFNPINLQILSVSGC  603

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            +MVS+K+LP L KLG +L+GLN+Q C  ISS  V+ L E+LWR D+L
Sbjct  604  SMVSDKSLPSLGKLGETLLGLNLQQCKAISSRAVELLTEQLWRCDIL  650



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L ++D +G + +TD G+L+L+ S EEGLVKVNLNGC+N+ D  V ++   HG+TL
Sbjct  480  RLCPQLHNIDLSGLYGMTDAGILSLLESLEEGLVKVNLNGCLNLTDKVVVSLVSLHGDTL  539

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLV IA++C  L ELDVSK  ITDSG+ AL+ A Q++L VLS+S C
Sbjct  540  EVLNLDGCRKITDASLVTIANNCLFLRELDVSKCAITDSGLAALSSAEQINLQVLSISSC  599

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + +S+K+LP L KLG +L+GLN+Q+C  IS+  ++ L + LWR D+L+
Sbjct  600  SEISHKSLPSLKKLGQTLMGLNLQHCTAISNRSIELLVDSLWRCDILA  647



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 127/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCPKL  +D +G   ITD G+L L+ SCE GLVKVNL+ C+N+ D  V ++A+ HGETL
Sbjct  471  KLCPKLHQLDLSGLCGITDAGLLPLLESCEAGLVKVNLSDCLNLTDQVVLSLARLHGETL  530

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  VTD SL+AIAD+C +L +LDVS   ITDSG+  L+  VQ++L VLSLSGC
Sbjct  531  ELLNLDGCRKVTDESLMAIADNCPLLNDLDVSTCAITDSGVAGLSCGVQVNLQVLSLSGC  590

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++P L KLG +L+GLN+Q+C  +S S V+ L E LWR D+LS
Sbjct  591  SMVSNKSVPYLKKLGENLLGLNLQHC-SVSCSAVELLVEDLWRCDILS  637



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +V+ +G H ITD G L L+ SCE GLVKVNL+GC N+GD  V  +A  HG TL
Sbjct  486  KLCPQLQNVELSGLHGITDVGFLPLLESCEAGLVKVNLSGCPNLGDKVVCKMADLHGWTL  545

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  V+D  LVAIA++C VL +LDVSK  ITDSGI AL  +  ++L +LS+SGC
Sbjct  546  EMLNLDGC-KVSDAGLVAIAENCRVLSDLDVSKCTITDSGIAALACSNLINLQILSVSGC  604

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
             +VS+K+LP L KLG +L+GLN+Q C  ISS  VD L E+LWR D+L
Sbjct  605  NLVSDKSLPSLGKLGQTLLGLNLQQCKAISSGAVDLLVEQLWRCDIL  651



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP L  VD +G + +TD+G+ +L+ S   GLVK+NLNGC+N+ D  V+A+A+ HGET+
Sbjct  448  KMCPNLRQVDLSGLYGMTDEGIHSLLESSLAGLVKLNLNGCINLSDECVTAVARLHGETI  507

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLDGC  +TDVSL  IA  C +L +LDVS S +TDSGI AL+ + QL+L +LS+SGC
Sbjct  508  KVLNLDGCRKITDVSLSTIASSCPLLSDLDVSNSAVTDSGIAALSCSEQLNLQILSISGC  567

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +SNK+LP L++LG SLVGLN+Q C  +SSS VD L   LWR D+L
Sbjct  568  SKISNKSLPYLIQLGKSLVGLNLQYCNSLSSSSVDMLMGNLWRCDIL  614



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            LCP+L HVD +G + ITD G+L L+ SC+EGL KVNL+GC+N+ D  V A+ + HG T+E
Sbjct  475  LCPQLQHVDLSGLYGITDAGLLPLLESCKEGLAKVNLSGCLNLTDEVVLALTRLHGGTVE  534

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             LNLDGC  +TD SLVA+AD+C  L +LDVS+  I+DSG+ AL+ A QL+L V+S SGC 
Sbjct  535  LLNLDGCRRITDASLVAVADNCVFLNDLDVSRCAISDSGVAALSHAEQLNLQVVSFSGCL  594

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
             VSNK++P L +LG +LVGLN+Q+C  IS+  V+ L E LWR D+L
Sbjct  595  GVSNKSMPFLKQLGKTLVGLNLQHCNSISARTVELLVECLWRCDIL  640



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G H I+D G+L L+ + E  LVKVNL+GCVN+ D AV  +A  HG TL
Sbjct  473  KLCPQLQHVELSGLHGISDAGLLPLLETREADLVKVNLSGCVNLSDKAVCIMADLHGWTL  532

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  ++D SLVAIA +C +L +LDVSK  ITDSGI AL  + Q+ L +LS+SGC
Sbjct  533  EMLNLEGC-KISDASLVAIAKNCQLLSDLDVSKCAITDSGIAALARSNQIKLQILSMSGC  591

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VS+K++P L KLG +L+GLN+Q C  ISSS VD   E+LWR D+L
Sbjct  592  SKVSDKSMPSLRKLGQTLLGLNLQQCKAISSSTVDLFVEQLWRCDIL  638



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            +KLCP L HVD +G   +TD   + L+ +C+ GLVK+N++GC N+ D A+SA+A+ HG T
Sbjct  467  AKLCPNLQHVDLSGLQAVTDASFIPLLENCDGGLVKINVSGCSNLTDKAISAVAEMHGWT  526

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            LE LNL+GC  V + SLVAIA++C +L +LDVS   +TD G+ AL  A QL+L +LSLSG
Sbjct  527  LEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVSLCAVTDFGVAALARADQLNLQILSLSG  586

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C  +S K LP L KLG  LVGLN+Q+C GIS   VD L E+LWR D+L
Sbjct  587  CTEISEKCLPALRKLGQLLVGLNLQHCSGISKKSVDLLVEQLWRCDIL  634



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 127/168 (76%), Gaps = 0/168 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            SKLCP+L HV+F+G + ITD G+L L ++C+ GLVKVNL+GCVN+ D  +S++ K HG T
Sbjct  478  SKLCPQLQHVEFSGLNAITDSGLLPLFMNCKAGLVKVNLSGCVNLTDKVISSLTKLHGWT  537

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            LE LNLDGC  VTD SLVAIA++C +L +LDVSK  ITD G+ AL +A Q +L +LS+ G
Sbjct  538  LELLNLDGCLKVTDSSLVAIAENCPLLNDLDVSKCCITDFGVAALAQANQFNLQLLSVYG  597

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++++L  L+KLG SL+GLN+Q+C  IS+  ++ L  +L R D+L
Sbjct  598  CSALTDQSLLALVKLGDSLLGLNLQHCNSISTRSIELLLAQLHRCDIL  645



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            +KLCP L HVD +G   +TD   + L+ +C+ GLVK+N++GC N+ D A+SA+A+ HG T
Sbjct  485  AKLCPNLQHVDLSGLQAVTDASFIPLLENCDGGLVKINVSGCSNLTDKAISAVAEMHGWT  544

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            LE LNL+GC  V + SLVAIA++C +L +LDVS   +TD G+ AL  A QL+L +LSLSG
Sbjct  545  LEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVSLCAVTDFGVAALARADQLNLQILSLSG  604

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C  +S K LP L KLG  LVGLN+Q+C GIS   VD L E+LWR D+L
Sbjct  605  CTEISEKCLPALRKLGQLLVGLNLQHCSGISKKSVDLLVEQLWRCDIL  652



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  VD +G + +TD G+L+L+ S E+GLVK+NL+GCVN+ D    A A+ H ETL
Sbjct  473  KLCPQLRTVDLSGLYAMTDAGILSLLESLEDGLVKLNLSGCVNLTDEVAVAAARLHRETL  532

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SL AIA +C  L ELDVSKS ITDSG+  L+   Q++L VLS+SGC
Sbjct  533  EVLNLDGCRKITDASLEAIAANCLFLRELDVSKSGITDSGLAVLSCTEQVALQVLSISGC  592

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VSNK+L  L ++G SL+GLN+Q+C  IS+  V+ L E LWR D+L+
Sbjct  593  SEVSNKSLSSLKRMGQSLLGLNLQHCTAISNRSVELLIESLWRCDILA  640



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            LCP+L HVD +G + ITD G+L L+ SC EGL KVNL+GC+N+ D  V A+ + HG TLE
Sbjct  475  LCPQLQHVDLSGLYGITDAGLLPLLESCREGLAKVNLSGCLNLTDEIVLALTRLHGGTLE  534

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             LNLDG   +TD SLVA+AD+C  L +LDVS+  I+DSG+ AL+ A QL+L V+S SGC 
Sbjct  535  LLNLDGRPRITDASLVAVADNCVFLSDLDVSRCAISDSGVAALSHAEQLNLQVVSFSGCL  594

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
             VSNK++P L +LG +LVGLN+Q+C  IS+  V+ L E LWR D+L
Sbjct  595  GVSNKSMPFLKQLGKTLVGLNLQHCNSISARTVELLVESLWRCDIL  640



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  VD TG + +TD G+L L+ + E GLVKVNL GC N+ D  VS +A+ HG TL
Sbjct  483  KLCPQLQCVDLTGLYGVTDAGLLPLLENSEAGLVKVNLAGCGNLSDNIVSELARLHGGTL  542

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIAD+C +L +LDVSK  ITD+GI  L+ A QL+L VLSLS C
Sbjct  543  ELLNLDGCRKITDASLVAIADYCHLLKDLDVSKCGITDAGIAVLSNARQLTLQVLSLSNC  602

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V+ K+ P L  LG +LVGLN+Q C  I S+ V+ L E LWR D+L+
Sbjct  603  SGVTCKSGPSLTNLGQTLVGLNLQYCNSIGSNTVELLVENLWRCDILA  650



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +VDF+G   I D G L  + +C+ GLVK+NL+GCVN+ D  +S+I + HG TL
Sbjct  473  KLCPQLQNVDFSGLVGIDDCGFLAWLQNCQSGLVKINLSGCVNLTDEVISSIIEHHGWTL  532

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L  A Q +L + S+SGC
Sbjct  533  KVLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLACAKQPNLQIFSISGC  592

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VS+K+L  L+KLG +LVGLNIQ+C  ISSS VD L E+LWR D+LS
Sbjct  593  SFVSDKSLADLIKLGETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  640



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +VDF+G   I D G L  + +C+ GLVK+NL+GCVN+ D  +S+I + HG TL
Sbjct  523  KLCPQLQNVDFSGLVGIDDCGFLAWLQNCQSGLVKINLSGCVNLTDEVISSIIEHHGWTL  582

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLD C  +TD S+ +IA++C +L +LDVSK  ITDSGI  L  A Q +L + S+SGC
Sbjct  583  KVLNLDSCKKITDASMTSIANNCPLLSDLDVSKCSITDSGIATLACAKQPNLQIFSISGC  642

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + VS+K+L  L+KLG +LVGLNIQ+C  ISSS VD L E+LWR D+LS
Sbjct  643  SFVSDKSLADLIKLGETLVGLNIQHCNAISSSTVDLLVEQLWRCDILS  690



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L HVD +G   ITD G+L L+ +CE GLVKVNL+GC+N+ D  V  + K HG TL
Sbjct  478  RLCPQLQHVDLSGLCGITDAGLLPLLENCEAGLVKVNLSGCLNLTDEVVLHLTKLHGATL  537

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  +TD SL A+A++C  L +LDVS+  ITD GI AL+ A QL+L VLS SGC
Sbjct  538  ELLNLNGCRRITDASLAAVAENCVFLSDLDVSRCAITDVGIAALSHAEQLNLQVLSFSGC  597

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK++  L KLG +LVGLN+Q+C  IS+  ++ L E LWR D+L
Sbjct  598  SGVSNKSMTFLKKLGKTLVGLNLQHCNSISTQTIELLVESLWRCDIL  644



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP L HVD +G   ITD  +L LV S E+GLV+V L+GC  + D  V+ IAK HG+TL
Sbjct  473  KICPNLTHVDLSGNKEITDACILPLVESSEDGLVEVKLSGCDKLTDNTVTVIAKLHGDTL  532

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + L LDGC  VTD SL+ IA +C VL ELDVS+  ITDSGI  L EAVQ+SL   S++GC
Sbjct  533  DLLKLDGCRCVTDASLIEIASNCMVLSELDVSRCGITDSGIKVLAEAVQMSLLTFSIAGC  592

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            ++VS+++LP L++LG ++VGLN+Q C GI+S  VD L ++LWR D+LS
Sbjct  593  SLVSDESLPFLVELGKTMVGLNVQYCGGITSGAVDLLVDQLWRCDILS  640



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G   +TD G L L+ S E GLVKVNLNGCVN+ D  V ++   HG TL
Sbjct  468  KLCPRLQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSDRVVLSMVNSHGWTL  527

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E L+LDGC  V D SL+AIA  C +L +LDVS+  ITD+GI AL    Q++L VLSL+GC
Sbjct  528  EVLSLDGCKRVGDASLMAIAGSCPLLADLDVSRCAITDTGIAALARGKQINLEVLSLAGC  587

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            A+VS+K++P L K+G SL GLNI+ C GISS  V+ L E L   D+L
Sbjct  588  ALVSDKSVPALKKMGCSLAGLNIKRCKGISSRSVNKLQEHLCMCDIL  634



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L H+D      +TD G+  L+ + E GLVKVNL+ C+N+ D AVS + + HG TL
Sbjct  417  KLCPHLEHIDLISLCGLTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTL  476

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  V+D SLVAIAD+C +L +LD+SK  ITDSG+  L+ A  L+L VLSL+GC
Sbjct  477  ELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCSITDSGVSVLSLAGHLNLQVLSLAGC  536

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++P L KL  SL+GLN+Q+C  ISS  V+ L E LWR D+LS
Sbjct  537  SMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGMVEQLAESLWRCDILS  584



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  V F G + ITD G+L LV + +  LVKVNL+GC N+ D  VSAI+ Q   TL
Sbjct  474  KLCPRLQDVVFCGLNGITDSGLLQLVQTSQLSLVKVNLSGCSNLTDRVVSAISVQSDWTL  533

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  +TD SL++IA++C +L +LDVS   +TD G+  L  + +LSL +LSLSGC
Sbjct  534  EALNLEGCTKITDASLISIAENCQILSDLDVSNCAVTDFGVQGLASSNKLSLQILSLSGC  593

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            +MV++K++P L KLG +L+GLN+QNC  IS++ VD L E+LWR D+L
Sbjct  594  SMVTDKSMPALGKLGRTLLGLNVQNCQSISTANVDLLIEQLWRCDIL  640



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+  G + ITD  +  L+ +CE GLVKVNL+GC+N+ D  VS + + HG T+
Sbjct  491  KLCPQLQHVELIGLYGITDASMFPLLETCE-GLVKVNLSGCINLTDETVSTLVRLHGGTI  549

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIAD C +L ELD SK  +TD+G+  L+ + Q++L VLSLSGC
Sbjct  550  EVLNLDGCRKITDASLVAIADACLLLNELDASKCAVTDAGLAVLSSSEQINLQVLSLSGC  609

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK+LP L +LG SLVGLN++NC  ISS  V ++ E LWR D+L
Sbjct  610  SEVSNKSLPFLERLGKSLVGLNLKNCHSISSGTVGTIVENLWRCDIL  656



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L H+D      +TD G+  L+ + E GLVKVNL+ C+N+ D AVS + + HG TL
Sbjct  490  KLCPHLEHIDLISLCGLTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTL  549

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  V+D SLVAIAD+C +L +LD+SK  ITDSG+  L+ A  L+L VLSL+GC
Sbjct  550  ELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCSITDSGVSVLSLAGHLNLQVLSLAGC  609

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++P L KL  SL+GLN+Q+C  ISS  V+ L E LWR D+LS
Sbjct  610  SMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGMVEQLAESLWRCDILS  657



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 121/168 (72%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L H+D      +TD G+  L+ + E GLVKVNL+ C+N+ D AVS + + HG TL
Sbjct  487  KLCPHLEHIDLISLCGLTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTL  546

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  V+D SLVAIAD+C +L +LD+SK  ITDSG+  L+ A  L+L VLSL+GC
Sbjct  547  ELLNLDGCRKVSDASLVAIADNCLLLNDLDMSKCSITDSGVSVLSLAGHLNLQVLSLAGC  606

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSNK++P L KL  SL+GLN+Q+C  ISS  V+ L E LWR D+LS
Sbjct  607  SMVSNKSVPFLKKLAGSLIGLNLQHCRSISSGMVEQLAESLWRCDILS  654



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP+L HVD +G   ITD G+L L+ +CE GLVKVNL+GC+N+ D  V  + K HG TL
Sbjct  478  RLCPQLQHVDLSGLCAITDAGLLPLLENCEAGLVKVNLSGCLNLTDEVVLHLTKLHGATL  537

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  +TD SL A A++C  L +LDVS   ITD GI AL+ A QL+L VLS SGC
Sbjct  538  ELLNLNGCRRITDASLAAAAENCVFLSDLDVSSCAITDVGIAALSHAEQLNLQVLSFSGC  597

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK++  L KLG +LVGLN+Q+C  IS+  ++ L E LWR D+L
Sbjct  598  SGVSNKSMTFLKKLGKTLVGLNLQHCNSISTQTIELLVESLWRCDIL  644



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L +V+ +G H IT  G   L+ SCE GLVKVNL+GC N+G+  V  +A  HG TL
Sbjct  486  KLCPQLQNVELSGLHGITHVGFFPLLESCEAGLVKVNLSGCPNLGNKVVCKMADLHGWTL  545

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D  LVAIA++C +L +LDVSK  ITDSGI AL  +  ++L +LS+SGC
Sbjct  546  EMLNLDGC-KISDAGLVAIAENCQLLSDLDVSKCTITDSGIAALARSNLINLQILSVSGC  604

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
             +VS+K+LP L KLG +L+GLN+Q C  ISS  VD L E+LWR D+L
Sbjct  605  NLVSDKSLPSLGKLGQTLLGLNLQQCKAISSGAVDLLVEQLWRCDIL  651



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+  G + ITD  +  L+ +CE GLVKVNL+GC+N+ D  VS + + HG T+
Sbjct  495  KLCPQLQHVELIGLYGITDASMFPLLETCE-GLVKVNLSGCINLTDETVSTLVRLHGGTI  553

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  ++D SLVAIAD C +L ELD SK  ITD+G+  L+ + Q++L VLSLSGC
Sbjct  554  EVLNLDGCRKISDASLVAIADACLLLNELDASKCAITDAGLAVLSSSEQINLQVLSLSGC  613

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK+LP L +LG SLVGLN++NC  ISS  V ++ E LWR D+L
Sbjct  614  SEVSNKSLPFLERLGKSLVGLNLKNCHSISSGTVGTIVENLWRCDIL  660



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 124/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L H++ TG + ITD G+L L+ +CE GLV VNL GC N+ D  VSA+A+ HG TL
Sbjct  472  KLCPQLRHLNLTGLYGITDAGLLPLLENCEAGLVNVNLAGCWNLTDNIVSALARLHGGTL  531

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLV IA++C VL +LDVSK  ITD+GI  L+ A  LSL VLSLSGC
Sbjct  532  EVLNLDGCMKITDASLVTIANNCLVLNDLDVSKCAITDAGIAVLSRASLLSLQVLSLSGC  591

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK +P L  LG +L+GLNIQNC  ISSS ++ L EKLWR D+L
Sbjct  592  SDVSNKCVPFLTILGQTLIGLNIQNCNSISSSTMELLVEKLWRCDIL  638



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            SKLCP+L HV+F+G + I D G+L L ++C+ GLV VNL+GCVN+ D  +S++ K HG T
Sbjct  478  SKLCPQLQHVEFSGLNGIRDSGLLPLFMNCKAGLVNVNLSGCVNLTDKVISSLTKLHGWT  537

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            LE LNLDGC  VTD SLVAIA++C +L +LDVSK  ITD G+ AL +A Q +L +LS+ G
Sbjct  538  LELLNLDGCLKVTDSSLVAIAENCPLLNDLDVSKCCITDFGVAALAQANQFNLQLLSVFG  597

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++++L  L+KLG SL+GLN+Q+C  IS+  ++ L  +L R D+L
Sbjct  598  CSALTDQSLLALVKLGDSLLGLNLQHCNSISTRSIELLLAQLHRCDIL  645



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L HVD +G    TD G+L L+ S E GLV VNL+GCV++ D  V+A+ K HG TL
Sbjct  506  KICPQLQHVDLSGLVGATDAGLLPLIESSEAGLVTVNLSGCVDLTDAVVTALVKAHGTTL  565

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL+GC  VTD SL+ IAD CS+L +LD+S+  I D G+  L  A QL L VLSL+GC
Sbjct  566  QMLNLEGCKKVTDKSLLVIADSCSLLDDLDMSRCMIGDYGVAILASASQLKLRVLSLAGC  625

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + ++ K+LPLL  +G SLVGLN+QNC  IS+ G+ +L EKLW  D+L
Sbjct  626  SKLTQKSLPLLGNMGRSLVGLNLQNCKLISTQGIGALEEKLWWCDIL  672



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L HVD +G    TD G+L L+ S E GLV VNL GCV++ D  V+A+ K HG TL
Sbjct  495  KICPQLQHVDLSGLVSATDAGLLPLIESSEVGLVTVNLRGCVDLTDAVVTALVKAHGSTL  554

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL+GC  VTD SL+ IAD CS L +LD+S+  I D GI  L  A QL L VLSL+GC
Sbjct  555  QMLNLEGCKKVTDKSLLVIADSCSFLDDLDMSRCMIGDYGIAVLASASQLKLRVLSLAGC  614

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + ++ K LP L  +G SLVGLN+QNC  IS+ G+ +L EKLW  D+ 
Sbjct  615  SNLTQKILPFLGNMGRSLVGLNLQNCKLISTQGIGALEEKLWWCDIF  661



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L H+       ITD G+L LV S + GLVKVNL+GC NV D  +++IA+ HG+TLE
Sbjct  516  ICPGLTHLTLNDLPDITDAGILPLVRSSKIGLVKVNLSGCYNVTDDIIASIAELHGKTLE  575

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             LNLDGC  +TD+SL AIA++CSVL ELD+S SRITD GI  L  A QLS+ + SL GC+
Sbjct  576  ILNLDGCKSITDLSLAAIAENCSVLSELDISTSRITDIGISTLAAAKQLSMQIFSLGGCS  635

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDV  291
             V+ K+LP L+ LG +L+GLNI+ C GIS   +D L + LWR ++
Sbjct  636  SVTGKSLPSLVSLGRTLIGLNIRQCDGISFETIDILLDDLWRCNI  680



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   +TD G+L L+ SCE GL KVNL+GC+N+ D  V A+A+ HGETL
Sbjct  496  KLCPQLHHVDLSGLDGMTDAGLLPLLESCEAGLAKVNLSGCLNLTDEVVLAMARLHGETL  555

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIAD+C +L +LD+SK  ITDSGI AL+   +L+L +LS+SGC
Sbjct  556  ELLNLDGCRKITDASLVAIADNCLLLNDLDLSKCAITDSGIAALSCGEKLNLQILSVSGC  615

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK++P L KLG +L+GLN+Q+C  ISSS V+ L E LWR D+L
Sbjct  616  SKVSNKSMPSLCKLGKTLLGLNLQHCNKISSSSVELLMESLWRCDIL  662



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  VD TG   ITD G+L L+ +CE GLVKVNL GC N+ D  VS +A+ HG TL
Sbjct  432  KLCPQLQDVDLTGLCGITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTL  491

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVA+ D+C +L +LDVSK  ITD+GI  LT A  +S+ VLS+S C
Sbjct  492  EILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCAITDAGIAVLTRADHVSMRVLSMSDC  551

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +SN  +P L+KLG +L+GLNI+ C  I S+ ++ L E LWR D+L
Sbjct  552  SGISNNCVPFLMKLGQALLGLNIKYCNAIGSNEIEFLVENLWRCDIL  598



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  VD TG   ITD G+L L+ +CE GLVKVNL GC N+ D  VS +A+ HG TL
Sbjct  436  KLCPQLQDVDLTGLCGITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTL  495

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVA+ D+C +L +LDVSK  ITD+GI  LT A  +S+ VLS+S C
Sbjct  496  EILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCAITDAGIAVLTRADHVSMRVLSMSDC  555

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +SN  +P L+KLG +L+GLNI+ C  I S+ ++ L E LWR D+L
Sbjct  556  SGISNNCVPFLMKLGQALLGLNIKYCNAIGSNEIEFLVENLWRCDIL  602



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            LCP+L HVD +G + ITD G+L L+   EEGLV VNL+GC+N+ D  V A+AK HGETLE
Sbjct  476  LCPQLQHVDLSGLYGITDAGILPLLERPEEGLVSVNLSGCLNLTDEVVVALAKLHGETLE  535

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             LNLDGC  +TD SL AIA++C +L +LD+SK  ITDS I AL  + +++L VLSLSGC+
Sbjct  536  MLNLDGCRKITDASLAAIAENCLLLSDLDLSKCAITDSSISALASSKKINLQVLSLSGCS  595

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+NK+   L KLG +LVGLN+Q+C  ISSS  + L E LWR D+L+
Sbjct  596  DVTNKSASCLKKLGETLVGLNLQHCNSISSSTAELLVESLWRCDILA  642



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  VD TG   ITD G+L L+ +CE GLVKVNL GC N+ D  VS +A+ HG TL
Sbjct  487  KLCPQLQDVDLTGLCGITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTL  546

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVA+ D+C +L +LDVSK  ITD+GI  LT A  +S+ VLS+S C
Sbjct  547  EILNLDGCQNITDASLVAVEDNCLLLNDLDVSKCAITDAGIAVLTRADHVSMRVLSMSDC  606

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +SN  +P L+KLG +L+GLNI+ C  I S+ ++ L E LWR D+L
Sbjct  607  SGISNNCVPFLMKLGQALLGLNIKYCNAIGSNEIEFLVENLWRCDIL  653



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 111/167 (66%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G   +TD G L L+   E GL  VNL GC+NV D  V  I   HG TL
Sbjct  476  KLCPQLRHVELSGLQRVTDAGFLPLLECSETGLTTVNLRGCINVTDRVVLPIVNSHGWTL  535

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + L LDGC  VTD S++AIA +C +L +LDVSK  ITD+GI AL    Q+SL +LSL+GC
Sbjct  536  QVLCLDGCKRVTDASMMAIAGNCPMLSDLDVSKCAITDTGIAALARGNQISLEILSLAGC  595

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
              VS+K++P L KLG SL GLNI+ C  ISS GV  L E LW  D+L
Sbjct  596  ISVSDKSMPALKKLGQSLAGLNIKRCSAISSRGVSKLQEHLWTCDIL  642



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L H+D +G   ITD G+L L+ SC+ GL +VNL+ C N+ +  V A+A+ HG TL
Sbjct  469  KLCPNLHHLDLSGLCGITDGGLLPLLESCQTGLARVNLSHCSNLTEEVVFALARCHGGTL  528

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+ C  +TD SL A+AD C +L +LD+++  ITD+G+ AL+  V  +L +LSLSGC
Sbjct  529  ELLNLENCQKITDESLTALADSCPLLNDLDLARCTITDAGVNALSRGVHTNLQILSLSGC  588

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MVSN+++  L K+G +L+GLNIQ+C  ISS  ++ L E LWR D+LS
Sbjct  589  SMVSNESMHALEKMGKTLLGLNIQHCNSISSGKIEILTENLWRCDILS  636



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            +++C +L  +DF+G   ITD G+L +V     GLVKVNL+GC N+ D AV++I + HGE 
Sbjct  428  ARICLRLTSLDFSGLPDITDAGILPVVQVSGFGLVKVNLSGCHNLTDNAVASIVELHGEN  487

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            LE LNLDGCG +TD+SL AIA +C  L ELD+S+ RITD+GI  L  A +L++ VLSL  
Sbjct  488  LEVLNLDGCGNITDLSLDAIARNCWSLNELDISRCRITDTGIAILAAAKRLNMKVLSLGS  547

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C +V++K+L  L+ LG +LVGLNIQ+C GISS  +  L + LWR DVL
Sbjct  548  CPLVTDKSLNSLIALGRTLVGLNIQHCRGISSETISVLLDDLWRCDVL  595



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+  G H ITD G L L+ S   GLVKVNL  CVN+ D  V  +   H  TL
Sbjct  447  KLCPQLQHVELRGLHGITDAGFLQLLKSRNAGLVKVNLKDCVNLSDKGVCRLTNLHRWTL  506

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            ETLNLDGC  ++D SL AIA++C +L +LDVSK  ITDSGI AL  +  +++ +LS+SGC
Sbjct  507  ETLNLDGC-KISDASLFAIAENCRLLGDLDVSKCAITDSGIAALAHSDLINVQILSVSGC  565

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            +MVS+K+LP L  LG +L+GLN+Q C  IS S +D L ++LWR ++L
Sbjct  566  SMVSDKSLPSLRNLGKTLLGLNLQQCKAISRSAIDLLVQQLWRCNIL  612



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L HVD +G    TD G+L L+ S   GLV VNL+GCV++ D A++A+AK HG TL
Sbjct  494  KICPQLQHVDLSGLVGATDAGLLPLIES-SVGLVTVNLSGCVDLTDAAITALAKAHGTTL  552

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL+ C  VTD SL+AIAD CS+L +LD+S+  I+D G+  L  A+QL L VLSL+GC
Sbjct  553  QMLNLESCKNVTDKSLLAIADCCSLLDDLDMSRCTISDHGVADLASAMQLKLRVLSLAGC  612

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + ++ K+LP L  +G SLVGLN+QNC  IS+ G+ +L EKLW  D+L
Sbjct  613  STLTQKSLPFLGNMGRSLVGLNLQNCNLISTQGIGALEEKLWWCDIL  659



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 127/167 (76%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD +G   +TD G+L L+ SCE GL KVNL+GC+N+ D  V A+A+ HG TL
Sbjct  471  KLCPQLHHVDLSGLDGMTDAGLLPLLESCEAGLAKVNLSGCLNLTDEVVLAMARLHGXTL  530

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVAIAD+C +L +LD+SK  ITDSGI AL+   +L+L +LS+SGC
Sbjct  531  ELLNLDGCRKITDASLVAIADNCLLLNDLDLSKCAITDSGIAALSCGEKLNLQILSVSGC  590

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + VSNK++P L KLG +L+GLN+Q+C  ISSS V+ L E LWR+ ++
Sbjct  591  SKVSNKSMPSLCKLGKTLLGLNLQHCNKISSSSVELLMESLWRFSII  637



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 123/168 (73%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLV-KVNLNGCVNVGDLAVSAIAKQHGET  612
            K+CP L  VD TG + +TDDG+L L+ +C+ G++ K+NLN C+N+ D +V AI + HGE+
Sbjct  457  KMCPNLRQVDLTGLYGMTDDGILALLENCQPGIITKLNLNSCINLSDASVLAIVRLHGES  516

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            ++ L+LDGC  +TD SL AIA +C +L +LDVS   +TDSGI AL+ + +L+L +LS+SG
Sbjct  517  VKELSLDGCRKITDTSLFAIAGNCPLLNDLDVSNCSVTDSGIAALSSSQKLNLQILSISG  576

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C  +SNK+LP L++LG  L+GLN+++C  +S S VD L   LWR D+L
Sbjct  577  CTNISNKSLPYLIQLGKRLIGLNLKHCSSLSLSTVDMLVGNLWRCDIL  624



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L HVD +G    TD G+L L+ S   GLV VNL+GCV++ D A++A+AK HG TL
Sbjct  494  KICPQLQHVDLSGLVGATDAGLLPLIES-SVGLVTVNLSGCVDLTDAAITALAKAHGTTL  552

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL+ C  VTD SL+AIAD CS+L +LD+S+  I+D G+  L  A+QL L VLSL+GC
Sbjct  553  QMLNLESCKNVTDKSLLAIADCCSLLDDLDMSRCTISDHGVAVLAYAMQLKLRVLSLAGC  612

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + ++ K+LP L  +G SLVGLN+QNC  IS+ G+ +L EKLW  D+L
Sbjct  613  SGLTQKSLPFLGNMGRSLVGLNLQNCNLISTQGIGALEEKLWWCDIL  659



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L HVD +G    TD G+L L+ S E GLV VNL+GCV++ D  V+A+ K HG TL
Sbjct  495  KICPQLQHVDLSGLVGATDAGLLPLIESSEVGLVTVNLSGCVDLTDAVVTALVKAHGSTL  554

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL+GC  VTD SL+ IAD CS L +LD+S+  I D GI  L  A QL + VLSL+GC
Sbjct  555  QMLNLEGCKKVTDKSLLLIADSCSFLDDLDMSRCMIGDYGIAVLASASQLKMRVLSLAGC  614

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + ++ K +P L  +G SLVGLN+QNC  IS+  + +L EKLW  D+ 
Sbjct  615  SNLTQKIVPFLGNMGRSLVGLNLQNCKLISTQEIGALEEKLWWCDIF  661



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP++ HV+ +G   +TD G L L+ S E GLVKVNL+GCVN+ D  V ++   HG TL
Sbjct  469  KLCPRIQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLSGCVNLTDRVVLSMVNSHGWTL  528

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E L+LDGC  V+D SL+AIA  C VL +LDVS+  ITD+GI AL    Q +L VLSL+GC
Sbjct  529  EVLSLDGCKRVSDASLMAIAGSCPVLADLDVSRCAITDTGIAALARGKQFNLEVLSLAGC  588

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            A+VS+K++P L KLG SL GLNI+ C  ISS  VD L   L   D+L
Sbjct  589  ALVSDKSVPALKKLGRSLAGLNIKLCNAISSRSVDKLLGHLCMCDIL  635



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD TG   ITD G+L L+ +CE GLV+VNL GC N+ D  VS +A+ HG TL
Sbjct  466  KLCPQLQHVDLTGLCGITDAGLLPLLENCEAGLVEVNLTGCWNLTDYIVSKVARLHGGTL  525

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVA+AD C +L +LDVSK  ITD+GI  L+ A  LS+ VLS+S C
Sbjct  526  EILNLDGCQNITDASLVAVADDCLLLNDLDVSKCAITDAGIAVLSRADHLSMRVLSMSDC  585

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + +SNK +P L+KLG +L GLNI+NC  I S+ ++ L E LWR D+L+
Sbjct  586  SGISNKCVPFLVKLGPALSGLNIKNCNSIDSNAIEFLVENLWRCDILA  633



>dbj|BAF01819.1| putative glucose regulated repressor protein [Arabidopsis thaliana]
Length=384

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 122/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G   IT+ G L+L+   +  LVK+N +GC N+ D  +SAI  ++G TL
Sbjct  220  KLCPQLEDIDLCGLKGITESGFLHLI---QSSLVKINFSGCSNLTDRVISAITARNGWTL  276

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSGI AL  + +L L +LS++GC
Sbjct  277  EVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALASSDKLKLQILSVAGC  336

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K+LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D+LS
Sbjct  337  SMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  384



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G   IT+ G L+L+ +    LVKVN +GC N+ D  +SAI  ++G TL
Sbjct  469  KLCPQLEEIDLCGLKGITESGFLHLIQNSLNSLVKVNFSGCSNLTDKVISAITARNGWTL  528

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  ++D S+V+IA +C +L +LD+SK  I+DSGI AL  + +L L +LS++GC
Sbjct  529  EVLNIDGCSNISDASMVSIAANCQILSDLDLSKCSISDSGIQALASSEKLKLQILSMAGC  588

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K+LP +++LGS+L+GLN+Q C  IS+S VD L E+L++ D+LS
Sbjct  589  SMVTDKSLPAIVRLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  636



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 122/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G   IT+ G L+L+   +  LVK+N +GC N+ D  +SAI  ++G TL
Sbjct  440  KLCPQLEDIDLCGLKGITESGFLHLI---QSSLVKINFSGCSNLTDRVISAITARNGWTL  496

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSGI AL  + +L L +LS++GC
Sbjct  497  EVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALASSDKLKLQILSVAGC  556

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K+LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D+LS
Sbjct  557  SMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  604



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 0/169 (0%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            S+LC +L H+   G   ITD+G+  LV +C   LV VNL+GCVN+ D++VS I  + G++
Sbjct  445  SRLCHRLTHIKLIGLLSITDEGIFPLVKNCAANLVAVNLSGCVNITDISVSYIVNKCGKS  504

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            L+ L +DGC  VTD +LV I + C  L  LDVSK  ITDSGI  L+ A+QL L +LSLSG
Sbjct  505  LKYLLVDGCKNVTDATLVEIWNSCWTLNVLDVSKCGITDSGITTLSSAIQLQLQILSLSG  564

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            C +VS+ +LP LL L  +L GLNIQ+CP ISS  VD+L E   R D+LS
Sbjct  565  CPLVSDNSLPFLLDLTQNLQGLNIQHCPNISSKTVDALVEINPRCDILS  613



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 122/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G   IT+ G L+L+   +  LVK+N +GC N+ D  +SAI  ++G TL
Sbjct  464  KLCPQLEDIDLCGLKGITESGFLHLI---QSSLVKINFSGCSNLTDRVISAITARNGWTL  520

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSGI AL  + +L L +LS++GC
Sbjct  521  EVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALASSDKLKLQILSVAGC  580

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K+LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D+LS
Sbjct  581  SMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  628



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   135 bits (340),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HVD TG   ITD G+L L+ +CE GLV+VNL GC N+ D  VS +A+ HG TL
Sbjct  466  KLCPQLQHVDLTGLCGITDAGLLPLLENCEAGLVEVNLTGCWNLTDYIVSKVARLHGGTL  525

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD SLVA+AD C +L +LDVSK  ITD+GI  L+ A  LS+ VLS+S C
Sbjct  526  EILNLDGCQNITDASLVAVADDCLLLNDLDVSKCAITDAGIAVLSRADHLSMRVLSMSDC  585

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +SNK +P L+KLG +L GLNI+NC  I S+ ++ L E LWR D+L
Sbjct  586  SGISNKCVPFLVKLGPALSGLNIKNCNSIDSNAIEFLVENLWRCDIL  632



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LCP++ +++  G + ITD G L L+ S +  LVKVNL GC N+ D  VS I+ Q G TL
Sbjct  473  QLCPQIENLELCGLNGITDSGFLQLLHSTQLSLVKVNLAGCSNLTDKVVSVISAQSGWTL  532

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  +TD +LV+IA  C +L +LDVS   ITD G+ AL  + QL+L +LSL+GC
Sbjct  533  EALNLEGCTKITDATLVSIAGSCQILSDLDVSNCSITDFGVQALASSNQLTLQILSLAGC  592

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
             +V++K++P L KLG +L+GLN+Q C  ISS+ +D L E LWR D+L
Sbjct  593  PLVTDKSVPALRKLGRTLLGLNVQQCRSISSATIDLLIEHLWRCDIL  639



>gb|ACF81449.1| unknown [Zea mays]
Length=206

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GL+KV+L+GC N+ D+AVS++ K+HG++L+
Sbjct  40   ICPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLK  99

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L  A  L L VLSLSGC+
Sbjct  100  KVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLASARHLKLRVLSLSGCS  159

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  160  KVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  206



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+  G + +TD GVL+L+ S   GLVK+NLNGCVNV D  VSA++  HG TL
Sbjct  448  KFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVTDNTVSAVSFSHGSTL  507

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+L+LDGC  +TD SLV +A +C  + +LDVS + ++D GI AL  +   LSL VLSL G
Sbjct  508  ESLSLDGCKNITDASLVTVAKNCYSVNDLDVSNTLVSDHGIKALASSPNHLSLQVLSLGG  567

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VDSL E+LWR D+L
Sbjct  568  CSGITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDSLLEQLWRCDIL  615



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G   IT+ G L+LV   +  LVKVN NGC N+ D  +SAI  ++G TL
Sbjct  464  KLCPQLEDIDLCGLKGITESGFLHLV---QNSLVKVNFNGCSNLTDRVISAITARNGWTL  520

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  ++D SLV+IA +C +L +LD+SK  I+D GI AL  +  L L +LSL+GC
Sbjct  521  EVLNVDGCSKISDASLVSIAANCQILSDLDLSKCSISDCGIQALASSDNLKLQILSLAGC  580

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++++LP ++ LGS+L+GLN+Q C  IS+S VD L E+L++ D+LS
Sbjct  581  SMVTDESLPAIVSLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  628



>ref|XP_006648432.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=490

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L  VD +G   +TD G+L L+ S E GLVKV+L+GC N+ D AVSA+ K HG++L+
Sbjct  324  VCPYLEQVDLSGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSALVKGHGKSLK  383

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GCG +TD SL+AI+++CS L ELD+SK  ++D+G+  L  A  L L VLSLSGC+
Sbjct  384  QVSLEGCGKITDASLLAISENCSELAELDLSKCMVSDNGVAMLASAKHLKLRVLSLSGCS  443

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K +P L  +G SL GLN+Q C  I +  + SL ++LW  D+L+
Sbjct  444  KVTQKIVPFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  490



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D +G   IT+ G L L+ SCE  L+KVNL+GC+N+ D  VSA+AK HG TL
Sbjct  468  KLCPQLQRLDLSGALRITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTL  527

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNLDGC  +TD S+ AIA++C++L +LDVSK+ ITD G+ AL  A  L++ +LSLSGC
Sbjct  528  EQLNLDGCQKITDASMFAIAENCALLSDLDVSKTAITDYGVAALASAKHLNVQILSLSGC  587

Query  428  AM  423
            ++
Sbjct  588  SL  589



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+  G + +TD GVL+L+ S   GLVK+NLNGCVNV D AVSA++  HG TL
Sbjct  448  KFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVSDNAVSAVSFSHGSTL  507

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+L+LDGC  +TD SLV ++ +C  + +LDVS + ++D GI AL  +   L+L VLSL G
Sbjct  508  ESLSLDGCKNITDASLVTVSKNCYSVNDLDVSNTLVSDHGIKALASSPNHLNLQVLSLGG  567

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VDSL E+LWR D+L
Sbjct  568  CSGITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDSLLEQLWRCDIL  615



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 86/122 (70%), Gaps = 0/122 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G   +TD G L L+ S E GLVKVNLNGCVN+ D  V ++   HG TL
Sbjct  513  KLCPRLQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSDRVVLSMVNSHGWTL  572

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E L+LDGC  V D SL+AIA  C +L +LDVS+  ITD+GI AL    Q++L VLSL+GC
Sbjct  573  EVLSLDGCKRVGDASLMAIAGSCPLLADLDVSRCAITDTGIAALARGKQINLEVLSLAGC  632

Query  428  AM  423
            A+
Sbjct  633  AI  634



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            + CP++  +DF+G   I+DDG+  L  SC+  LVK+NL+GC+ V D AV  I    G+TL
Sbjct  368  RACPQVQSIDFSGLAGISDDGLFALFGSCKTSLVKLNLSGCIEVTDRAVFVIVNLFGKTL  427

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
             +LNL+GC  VTD SL  IA +C++L ELD+SK  ITD+G+V+L  A    L +LSLSGC
Sbjct  428  LSLNLEGCRKVTDQSLGFIAHYCAILQELDISKCGITDNGLVSLASAASYCLQILSLSGC  487

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
              +++K LP + K+G +L+GLN+Q C GISS   D L   LWR D+L
Sbjct  488  MQITDKGLPFIGKIGETLIGLNLQQCRGISSRARDLLATHLWRCDLL  534



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 123/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCPKL  ++  G   IT+ G L+L+   +  LVKVN +GC N+ D  +SAI+ ++G TL
Sbjct  469  KLCPKLEDIELYGLKGITESGFLHLL---QNSLVKVNFSGCSNLTDKVISAISARNGWTL  525

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E L +DGC  +TD SLV+IA++C +L +LD+SK  I+D GI AL  + +L L +LS+SGC
Sbjct  526  EVLTVDGCNKITDASLVSIAENCQILSDLDLSKCSISDIGIQALASSDKLKLQILSMSGC  585

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K+LP L++LGS+L+GLN+Q C  +SSS VD L E+L++ D+LS
Sbjct  586  SMVTDKSLPALVRLGSTLLGLNLQQCRSVSSSTVDFLVERLYKCDILS  633



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score =   131 bits (330),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 118/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLC +L  ++  G + +TD GV  LV S   GLVKVNL+GC+NV D AVSAI+  HG TL
Sbjct  453  KLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVNLSGCINVSDNAVSAISVCHGRTL  512

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LN+DGC  +TD SLVA+A +C  + +LDVS + ++D G+ AL  +   L+L VLS+ G
Sbjct  513  ESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTLVSDQGVKALASSPNHLNLQVLSVGG  572

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR D+L
Sbjct  573  CSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  620



>dbj|BAJ34438.1| unnamed protein product [Thellungiella halophila]
Length=430

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+ +G + +TD GVL L+ S   GLVKVNL+GC+NV D  VSAI+  HG  +
Sbjct  262  KFCHQLQDVELSGLNGVTDAGVLELLQSNNVGLVKVNLSGCINVSDNTVSAISMCHGRFM  321

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ G
Sbjct  322  ESLNLDGCKNITDASLVAVAKNCYSVSDLDISNTLVSDHGIKALASSPNHLNLQVLSVGG  381

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR D+L
Sbjct  382  CSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  429



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 122/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G   IT+ G L+L+ S    LVKVN +GC N+ D  +SAI  ++G TL
Sbjct  465  KLCPQLEEIDLCGLKGITESGFLHLIKS---SLVKVNFSGCSNLTDRVISAITARNGWTL  521

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  +TD SLV+IA +C +L +LD+SK  I+DSG+ AL  + +L L +LS++GC
Sbjct  522  EVLNIDGCSNITDASLVSIAANCQILSDLDLSKCAISDSGVHALASSDKLKLQILSVAGC  581

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K++P ++ LGS+L+GLN+Q C  IS+S V+ L E+L++ D+LS
Sbjct  582  SMVTDKSMPAIVGLGSTLLGLNLQQCRSISNSTVEFLVERLYKCDILS  629


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 55/118 (47%), Gaps = 3/118 (3%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            + CP L  +       I+D+G+L +   C + L K++LN C  + D  + AIAK     L
Sbjct  175  RSCPSLGSLSLWNLSTISDNGLLEIAEGCPQ-LEKLDLNQCSTITDKGLVAIAKSC-PNL  232

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSL  438
              L L+ C  + D  L AIA  CS L  + +     + D GI +L      SL  L L
Sbjct  233  SELTLEACSKIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKL  290



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G   IT+ G L+L    +  LVKVN +GC ++ D  VSAI  ++G TL
Sbjct  468  KLCPQLEEIDLCGLKGITESGFLHLT---QNSLVKVNFSGCSSLTDKVVSAITARNGWTL  524

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  ++D S+V+IA +C +L +LD+SK  I+DSGI AL  + +L L +LS++GC
Sbjct  525  EVLNIDGCSNISDASMVSIAANCQILSDLDLSKCSISDSGIQALASSDKLKLQILSMAGC  584

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K+L  +++LGS+L+GLN+Q C  IS+S VD L E+L++ D+LS
Sbjct  585  SMVTDKSLAAIVRLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  632


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (51%), Gaps = 4/108 (4%)
 Frame = -3

Query  746  HCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETLNLDGCGYVTDV  567
            H +T  G    +L+C E L   +L  C+ + DLA    A  H   L +L++  C    D 
Sbjct  402  HRVTQFGFFGSLLNCGEKLKAFSLVNCLGIRDLATGLPASPHCSALRSLSIRNCPGFGDA  461

Query  566  SLVAIADHCSVLCELDVSKSR-ITDSGIVALTEAVQLSLHVLSLSGCA  426
            +L A+   C  L E+D+   + IT+SG + LT   Q SL  ++ SGC+
Sbjct  462  NLAALGKLCPQLEEIDLCGLKGITESGFLHLT---QNSLVKVNFSGCS  506



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CP+L ++D +G   +TDDG + L+ S E  L+K NL+GC+N+ D +V A+AK HGE+L
Sbjct  482  KACPQLQNLDLSGLCGVTDDGFVALLESREALLLKANLSGCINLTDRSVMALAKLHGESL  541

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E L+ +GCG VTD  L+A++  C  L +LD+S+  ITD+G+  L+ A  L L +LSLS C
Sbjct  542  ELLSFEGCGKVTDSGLMAVSSFCVCLKDLDISRCTITDNGLAYLSRAKGLRLQILSLSAC  601

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
              +++K+LPLL     SLVGLN+QNC  +S+  V+ LGE+LWR D+L
Sbjct  602  LGITDKSLPLLGNFAGSLVGLNLQNCKMVSNGAVELLGEQLWRCDIL  648



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+ +G + +TD GVL L+ S   GLVKVNL+GC+NV D  VSAI+  HG  +
Sbjct  453  KFCHQLQDVELSGLNGVTDAGVLELLQSNNVGLVKVNLSGCINVSDNTVSAISMCHGRFM  512

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ G
Sbjct  513  ESLNLDGCKNITDASLVAVAKNCYSVSDLDISNTLVSDHGIKALASSPNHLNLQVLSVGG  572

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR D+L
Sbjct  573  CSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  620



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 118/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+  G + +TD GVL+L+ S   GLVK+NLNGCVNV D  VSA++  HG TL
Sbjct  448  KFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVSDNTVSAVSFSHGSTL  507

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+L+LDGC  +TD S+V ++ +C  + +LDVS + ++D GI AL  +   L+L VLSL G
Sbjct  508  ESLSLDGCKNITDASVVTVSKNCYSVNDLDVSNTLVSDHGIKALASSPNHLNLQVLSLGG  567

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VDSL E+LWR D+L
Sbjct  568  CSGITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDSLLEQLWRCDIL  615



>ref|NP_001132560.1| F-box family member [Zea mays]
Length=375

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GL+KV+L+GC N+ D+AVS++ K+HG++L+
Sbjct  209  ICPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLK  268

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L  A  L L VLSLSGC+
Sbjct  269  KVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLASARHLKLRVLSLSGCS  328

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  329  KVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  375



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLC +L  ++  G + +TD GV  LV S   GLVKVNL+GC+NV D  VSA++  HG TL
Sbjct  454  KLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVNLSGCINVSDNTVSAVSVCHGRTL  513

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LN+DGC  +TD SLVA+A +C  + +LDVS + ++D G+ AL  +   L+L VLS+ G
Sbjct  514  ESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTLVSDQGVKALASSPNHLNLQVLSIGG  573

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ V++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR D+L
Sbjct  574  CSGVTDKSKACIQKLGRTLLGLNIQRCGRISSSTVDNLLEHLWRCDIL  621



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  ++  G + +TD G+L L+     GL+KVNL+ C+N+ D AVSAI  +HG TL
Sbjct  456  KFCHQLQDLELCGLNGVTDSGLLELIQFNSAGLLKVNLSCCLNLTDSAVSAIVTRHGLTL  515

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVAL-TEAVQLSLHVLSLSG  432
            E+LNLDGC  +TD SLV++A +C  + +LDVS SR++D GI AL T    L+L + S+ G
Sbjct  516  ESLNLDGCRNITDASLVSVAKNCYSINDLDVSNSRVSDLGIEALATSPNHLNLQIFSIGG  575

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ V++++   + KLG +L+GLNIQ C  ISSS +D+L E+LWR D+L
Sbjct  576  CSAVTDESQASIQKLGRTLLGLNIQRCSKISSSTIDALLEQLWRCDIL  623



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L ++D +G   +TD  +L L+ S + G V+VNLNGCVNV D  V+ + K HG TL
Sbjct  487  KICPQLQNIDLSGQVGVTDTFLLPLIKSSDVGFVQVNLNGCVNVTDDLVTTLVKAHGSTL  546

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL GC  +TD SL+AIAD CSV+ +LD+S   ++D G+  L  A QL L +LSL+ C
Sbjct  547  KMLNLRGCKKITDRSLLAIADGCSVIEDLDLSSCSVSDYGVAVLASARQLQLQILSLASC  606

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V+ K+LP L  LG S+VGLN+Q+C  IS+ G+  L EKLW  D++S
Sbjct  607  SKVTVKSLPFLGNLGQSMVGLNLQHCSLISTRGMKLLEEKLWWCDIIS  654



>ref|NP_001046222.1| Os02g0200900 [Oryza sativa Japonica Group]
 dbj|BAD15850.1| putative F-box protein [Oryza sativa Japonica Group]
 dbj|BAF08136.1| Os02g0200900 [Oryza sativa Japonica Group]
Length=511

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L  VD +G   +TD G+L L+ S E GLVKV+L+GC N+ D AVS + K HG++L+
Sbjct  345  VCPYLEQVDLSGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLK  404

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL AI+++C+ L ELD+SK  ++D+G+  L  A  L L VLSLSGC+
Sbjct  405  QVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLASAKHLKLRVLSLSGCS  464

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++  L  +G SL GLN+Q C  I +  + SL ++LW  D+L+
Sbjct  465  KVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  511



>gb|ACR35519.1| unknown [Zea mays]
Length=520

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GL+KV+L+GC N+ D+AVS++ K+HG++L+
Sbjct  354  ICPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLK  413

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L  A  L L VLSLSGC+
Sbjct  414  KVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLASARHLKLRVLSLSGCS  473

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  474  KVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  520



>ref|XP_002437255.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
 gb|EER88622.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
Length=303

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L +V+ +G   +TD+G L L+ S E GLV V+LNGC N+ D AVSA+ K HG +L 
Sbjct  138  ICPQLENVNLSGLGAVTDNGFLPLLKSSESGLVNVDLNGCENLTDAAVSALVKAHGASLA  197

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L  A QL L +LSLSGC 
Sbjct  198  HLSLEGCSKITDASLFAISESCSQLAELDLSNCMVSDYGVAVLAAAKQLKLRILSLSGCM  257

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + SSL GLN+Q    I +  + SL ++LWR D+L+
Sbjct  258  KVTQKSVPFLGSMSSSLEGLNLQF-NFIGNRNIASLEKQLWRCDILA  303



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 116/169 (69%), Gaps = 1/169 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L H+D +G +  TD G+L L+ +   GLV VNL  C N+ D  V ++AK  G TL
Sbjct  469  KLCPNLQHLDLSGLYGTTDAGLLPLIENNRAGLVTVNLTSCFNLTDGVVYSLAKLQGGTL  528

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEA-VQLSLHVLSLSG  432
            E LNL+GC  +TD SL A+A++C  L +LDVSK  ITDSGI +L+ A  +L+L VLS+SG
Sbjct  529  EVLNLNGCRRITDSSLSAMAENCMFLRDLDVSKCGITDSGIASLSRAEKRLNLQVLSVSG  588

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            C+ VSNK+L  L KLG +L+GLNI+ C  I++  V  L E LWR D+LS
Sbjct  589  CSEVSNKSLVSLKKLGRTLLGLNIRGCDSITNETVQRLVESLWRCDILS  637



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D +G   IT+ G L L+ SCE  L+KVNL+GC+N+ D  VSA+AK HG TL
Sbjct  600  KLCPQLQRLDLSGALRITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTL  659

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSG  432
            E LNLDGC  +TD S+ AIA++C++L +LDVSK+ ITD G+ AL  A  L++ +LSLSG
Sbjct  660  EQLNLDGCQKITDASMFAIAENCALLSDLDVSKTAITDYGVAALASAKHLNVQILSLSG  718



>ref|XP_004170235.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like, 
partial [Cucumis sativus]
Length=509

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LC +L H+D  G + +TD   + L+ SCE GLVKVNL+GC+N+ D ++ A+A+ HG TL
Sbjct  343  RLCSQLQHLDLVGLYGLTDAVFVPLLESCE-GLVKVNLSGCLNLTDESIIALARLHGATL  401

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + +NLDGC  +TD SLVAIAD+  VL ELDVS   ++D G++AL  A  ++L +LSL+GC
Sbjct  402  QLVNLDGCRKITDQSLVAIADNLLVLNELDVSNCAVSDRGLIALARAQHINLSILSLAGC  461

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
              ++  +LP L  LG +LVGLN++ C  IS+  ++ L E LWR D+L
Sbjct  462  CGITGTSLPCLEILGKTLVGLNLEGCNSISNGSIEVLVENLWRCDIL  508



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 116/168 (69%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLC +L  ++  G + +TD GV  LV S   GLVKV L+GC+NV D  VSA++  HG TL
Sbjct  454  KLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVKLSGCINVADNTVSAVSVCHGRTL  513

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LN+DGC  +TD SLVA+A +C  + +LDVS + ++D G+ AL  +   L+L VLS+ G
Sbjct  514  ESLNVDGCKNITDASLVAVAKNCYSVNDLDVSNTLVSDQGVKALASSPNHLNLQVLSIGG  573

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ V++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR D+L
Sbjct  574  CSGVTDKSKACIQKLGRALLGLNIQRCGRISSSTVDNLLEHLWRCDIL  621



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 116/167 (69%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
             C +L  V+  G + +TD GV  L+ S   GLVKVNL+GC+NV D  VSA++  HG TLE
Sbjct  454  FCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLE  513

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSGC  429
            +LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ GC
Sbjct  514  SLNLDGCKNITDTSLVAVAKNCYSVNDLDISNTLVSDQGIKALASSPNHLNLQVLSVGGC  573

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +++K+   + KLG +L+GLNIQ C  ISSS VD+L E+LWR D+L
Sbjct  574  SAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLLEQLWRCDIL  620



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L  VD +G   +TD G+L L+ S E GLVKV+L+GC N+ D AVS + K HG++L+
Sbjct  494  VCPYLEQVDLSGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLK  553

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL AI+++C+ L ELD+SK  ++D+G+  L  A  L L VLSLSGC+
Sbjct  554  QVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLASAKHLKLRVLSLSGCS  613

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++  L  +G SL GLN+Q C  I +  + SL ++LW  D+L+
Sbjct  614  KVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  660



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 116/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GL+KV+L+GC N+ D+AVS++ K+HG++L+
Sbjct  477  ICPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLK  536

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L  A  L L VLSLSGC+
Sbjct  537  KVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDYGVAMLASARHLKLRVLSLSGCS  596

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  597  KVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKKLWWCDILA  643



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L  +D +G   +TD  ++ L+ S E G V+VNL+GCVN+ D  V+ + K HG TL
Sbjct  488  KICPQLQKLDLSGQVGVTDASLIPLIQSSEVGFVEVNLSGCVNLTDALVTMLVKAHGSTL  547

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLDGC  +TD SLVAIAD CSV  +LD+S S I+D G+  L  A QL+L  LSL+ C
Sbjct  548  KMLNLDGCKRITDQSLVAIADSCSVFDDLDLSCSSISDYGVAVLASARQLNLCTLSLASC  607

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V++K+LP L  +G S+VGLN+Q+C  IS  G+  L EKLW  D++S
Sbjct  608  SKVTDKSLPFLGNMGKSMVGLNLQHCSLISIHGIGLLEEKLWWCDIIS  655



>gb|ADW83728.1| EIN3-binding F-box protein 1 [Musa acuminata AAA Group]
Length=453

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L  +D +G   +TD  ++ L+ S E G V+VNL+GCVN+ +  V+ + K HG TL
Sbjct  286  KICPQLQKLDLSGQVGVTDASLIPLIQSSEVGFVEVNLSGCVNLTEALVTMLVKAHGSTL  345

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNLDGC  +TD SLVAIAD CSV  +LD+S S I+D G+  L  A QL+L  LSL+ C
Sbjct  346  KMLNLDGCKRITDQSLVAIADSCSVFDDLDLSCSSISDYGVAVLASARQLNLCTLSLASC  405

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V++K+LP L  +G S+VGLN+Q+C  IS  G+  L EKLW  D++S
Sbjct  406  SKVTDKSLPFLGNMGKSMVGLNLQHCSLISIHGIGLLEEKLWWCDIIS  453



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GL+KV+L+GC N+ D+AVS++ K HG++L+
Sbjct  488  ICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLIKVDLSGCKNITDVAVSSLVKAHGKSLK  547

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  IA+ C  L ELD+S   ++D G+  L+ A  L L VLSLSGC+
Sbjct  548  KVSLEGCSKITDASLFTIAESCMELAELDLSNCMVSDYGVAILSSARHLKLRVLSLSGCS  607

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  LG SL GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  608  KVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIVSLEKKLWWCDILA  654



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LC +L H+D  G + +TD   + L+ SCE GLVKVNL+GC+N+ D ++ A+A+ HG TL
Sbjct  448  RLCSQLQHLDLVGLYGLTDAVFVPLLESCE-GLVKVNLSGCLNLTDESIIALARLHGATL  506

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + +NLDGC  +TD SLVAIAD+  VL ELDVS   ++D G++AL  A  ++L +LSL+GC
Sbjct  507  QLVNLDGCRKITDQSLVAIADNLLVLNELDVSNCAVSDRGLIALARAQHINLSILSLAGC  566

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
              ++  +LP L  LG +LVGLN++ C  IS+  ++ L E LWR D+L
Sbjct  567  CGITGTSLPCLEILGKTLVGLNLEGCNSISNGSIEVLVENLWRCDIL  613



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+  G + +TD GV  L+ S   GLVKVNL+ C+NV D  VSAI+  HG TL
Sbjct  422  KFCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTL  481

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ G
Sbjct  482  ESLNLDGCKNITDTSLVAVAKNCYSVNDLDISNTLVSDHGIKALASSPNHLNLQVLSVGG  541

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR D+L
Sbjct  542  CSAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLIENLWRCDIL  589



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  ++  G   IT+ G L+L+   +  LVKVN +GC  + D  VSAI+ ++G TL
Sbjct  458  KLCPQLEDIELCGLKGITESGFLHLL---QNSLVKVNFSGCSGLTDRVVSAISARNGLTL  514

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  ++D SLV+IA +C +L +LD+SK  ++D GI AL  + +L L +LS++GC
Sbjct  515  EVLNMDGCSKISDASLVSIAANCQILSDLDLSKCSVSDFGIQALASSDKLKLQILSMAGC  574

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            AMV++K+LP ++KLGS+L+GLN+Q C  +S S VD L E+L++ D+LS
Sbjct  575  AMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCSTVDFLVERLYKCDILS  622



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KL P+L ++D  G +  TD G+L ++ +   GLV VNL+GC N+ D  V  +AK HGETL
Sbjct  464  KLSPQLQNLDLGGLYGTTDAGLLPIIENNRAGLVSVNLSGCFNLTDEVVYYLAKFHGETL  523

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEA-VQLSLHVLSLSG  432
            E LNL+GC  +TD SL AIA+ C  L +LD+SK  ITDSG+ AL+ A  +L+L VLS+SG
Sbjct  524  EVLNLEGCRRITDSSLSAIAESCLFLKDLDMSKCGITDSGVAALSRAEKRLNLQVLSVSG  583

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            C+ VSNK+L  L KLG +L+GLNI+ C  I++  +  L E LWR D+LS
Sbjct  584  CSEVSNKSLVPLKKLGRTLLGLNIRGCNSITNRIIQLLKESLWRCDILS  632



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +LC +L H+D  G + +TD  ++ L+ SCE GLVKVNL+GC+N+ D ++ A+A+ HG TL
Sbjct  448  RLCSQLQHLDLVGLYGLTDAVLVPLLESCE-GLVKVNLSGCLNLTDKSILALARLHGATL  506

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + +NL+GC  +TD SLVAIAD+  VL ELDVS   ++D G++AL  A  ++L +LSL+GC
Sbjct  507  QLVNLEGCRKITDQSLVAIADNLLVLNELDVSNCAVSDRGLIALARAQHINLLILSLAGC  566

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
              +++++LP L +LG +LVGLN++ C  IS+  ++ L E LWR D+L
Sbjct  567  CGITSRSLPSLERLGKTLVGLNLKGCNSISNGSIEVLVENLWRCDIL  613



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 120/168 (71%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L  V+  G   IT+ G L+L+   +  LVKVN +GC N+ D  +SAI+ ++G TL
Sbjct  466  KLCPLLEDVELYGLKGITESGFLHLL---QNSLVKVNFSGCSNLTDRVISAISARNGWTL  522

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  ++D SLVAIA +C +L +LD+SK  I+D GI AL  +  L L +LS++GC
Sbjct  523  EVLNVDGCTQISDASLVAIAANCQILSDLDISKCAISDCGIQALASSDNLKLQILSMAGC  582

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            ++V++K+LP +++LGS+L+GLN+Q C  IS S VD L E+L++ D+LS
Sbjct  583  SLVTDKSLPAIVRLGSTLLGLNLQQCRSISFSTVDFLVEQLYKCDILS  630



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 122/168 (73%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLC +L  +D  G   IT+ G L+L+   +  LVK+N +GC ++ D  +SAI  ++G TL
Sbjct  467  KLCLQLEEIDLCGLKGITESGFLHLI---QNSLVKMNFSGCSSLTDKVISAITARNGWTL  523

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  ++D S+V+IA +C +L +LD+SK  I+DSGI AL  + +L L +LS++GC
Sbjct  524  EVLNIDGCSNISDASMVSIAANCQILSDLDLSKCSISDSGIQALASSEKLKLQILSMAGC  583

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K+LP +++LGS+L+GLN+Q C  IS+S VD L E+L++ D+LS
Sbjct  584  SMVTDKSLPAIVRLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDILS  631



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 121/168 (72%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  ++  G   IT+ G L+L+   +  LVKVN +GC  + D  VSAI+ ++G TL
Sbjct  459  KLCPQLEDIELCGLKGITESGFLHLL---QNSLVKVNFSGCSGLTDRVVSAISARNGLTL  515

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN+DGC  ++D SLV+IA +C +L +LD+SK  ++D GI AL  + +L L +LS++GC
Sbjct  516  EVLNMDGCSKISDASLVSIAANCQILSDLDLSKCSVSDFGIQALASSEKLKLQILSMAGC  575

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            AMV++K+LP ++KLGS+L+GLN+Q C  +S S VD + E+L++ D+LS
Sbjct  576  AMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCSTVDFVVERLYKCDILS  623



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L +V+ +G   +TD+G L L+ S E GLV V+LNGC N+ D AVSA+ K HG +L 
Sbjct  463  ICPQLENVNLSGLGAVTDNGFLPLIKSSESGLVNVDLNGCENLTDAAVSALVKAHGASLA  522

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L  A QL L +LSLSGC 
Sbjct  523  HLSLEGCSRITDASLFAISESCSQLAELDLSNCMVSDYGVAVLAAAKQLKLRILSLSGCM  582

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + SSL GLN+Q    I +  + SL ++LWR D+L+
Sbjct  583  KVTQKSVPFLGSMSSSLEGLNLQ-FNFIGNHNIASLEKQLWRCDILA  628



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 114/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
             C +L  V+  G   +TD GV  L+ S   GLVKVNL+GC+NV D  VSA++  HG TLE
Sbjct  455  FCHQLQDVELCGLDGVTDAGVRELLQSNNVGLVKVNLSGCINVSDSTVSAVSVCHGHTLE  514

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSGC  429
            +LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ GC
Sbjct  515  SLNLDGCKNITDASLVAVAKNCYSVNDLDISNTLVSDHGIKALASSPNHLNLQVLSVGGC  574

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +++K+   + KLG +L+GLNIQ C  ISSS VD+  E+LWR D+L
Sbjct  575  SAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTFLEQLWRCDIL  621



>ref|NP_001145991.1| uncharacterized protein LOC100279520 [Zea mays]
 gb|ACL52991.1| unknown [Zea mays]
Length=522

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GLVKV+L+GC N+ D+AVS++ K HG++L+
Sbjct  356  ICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLK  415

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             +NL+GC  +TD  L  +++ C+ L EL++S   ++D G+  L  A  L L VLSLSGC+
Sbjct  416  KINLEGCSKITDAILFTMSESCTELAELNLSNCMVSDYGVAILASARHLKLRVLSLSGCS  475

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++  L  LG S+ GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  476  KVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHNIASLEKKLWWCDILA  522



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L  VD +    +TD G+L L+ S E GLVKV+L+GC N+ D AVS + K HG++L+
Sbjct  487  VCPYLEQVDLSRLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLK  546

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL AI+++C+ L ELD+SK  ++D+G+  L  A  L L VLSLSGC+
Sbjct  547  QVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLASAKHLKLRVLSLSGCS  606

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++  L  +G SL GLN+Q C  I +  + SL ++LW  D+L+
Sbjct  607  KVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  653



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 115/168 (68%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+  G + +TD GV  L+ S   GLVKVNL+ C+NV D  VSAI+  HG TL
Sbjct  455  KFCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTL  514

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LNLDGC  +T+ SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ G
Sbjct  515  ESLNLDGCKNITNASLVAVAKNCYSVNDLDISNTLVSDHGIKALASSPNHLNLQVLSIGG  574

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ +++K+   + KLG +L+GLNIQ C  ISSS VD+L E LWR D+L
Sbjct  575  CSSITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLLENLWRCDIL  622



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K+CP+L +VD +G   +TD  ++ L+ + + G V+VNL+ CVNV D+ V+ + K HG TL
Sbjct  483  KICPQLQNVDLSGQIGVTDASLIPLIGNSKGGFVEVNLSNCVNVTDVLVAMLVKSHGGTL  542

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            +  NLDGC  +TD SL+AIAD CS L  LD+S   I+D G+  L  A QL+L +LSL+ C
Sbjct  543  KVFNLDGCKQITDRSLLAIADGCSELDNLDLSSCSISDYGVAVLASARQLNLRILSLASC  602

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V+ K+LP L  +GSS+VGLN+Q+C  IS+ G+  L EKLW  D+LS
Sbjct  603  SKVTQKSLPFLGNMGSSMVGLNLQHCRLISTYGIGLLEEKLWWCDILS  650



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
             C +L  ++  G   +TD GV  L+ S   GLVKVNL+GC+NV D  VSA++  HG TLE
Sbjct  455  FCHQLQDIELCGLDGVTDAGVRELLQSNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLE  514

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSGC  429
            +LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ GC
Sbjct  515  SLNLDGCKNITDASLVAVAKNCYSVNDLDISNTLVSDHGIKALASSPNHLNLQVLSVGGC  574

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +++K+   + KLG +L+GLNIQ C  ISSS VD+  E+LWR D+L
Sbjct  575  SAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTFLEQLWRCDIL  621



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 112/167 (67%), Gaps = 0/167 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L  ++  G   ITD G ++L+   +  L  VNL+GC+N+ D+ V ++ K H  TL
Sbjct  474  KLCPTLQCLELIGLEGITDPGFISLLQRSKASLGNVNLSGCINLTDVGVLSMVKLHCSTL  533

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
              LNL+GC  V D SL AIAD+C VL +LDVS+  ITD+GI ALT  V  +L VLSL+GC
Sbjct  534  GVLNLNGCKKVGDASLTAIADNCIVLSDLDVSECAITDAGISALTRGVLFNLDVLSLAGC  593

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            ++VSNK+L  L KLG SL GLNI+NC  ISS  V+ L E LW  D+L
Sbjct  594  SLVSNKSLSALKKLGDSLEGLNIKNCKSISSRTVNKLVEHLWMCDIL  640



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 102/168 (61%), Gaps = 24/168 (14%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L H+D +G   ITD  +L L+ SCE  LVKVNL+ C  + D  + A+A+ HG TL
Sbjct  485  KLCPQLHHLDLSGLCGITDAALLPLLESCES-LVKVNLSDCGILTDKVIIALAELHGATL  543

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LNL+GC  VTD SLVAIAD C  L +LDVSK  ITDSG+ AL+  V L+L  L     
Sbjct  544  ELLNLEGCKKVTDASLVAIADSCLFLNDLDVSKCSITDSGVAALSNGVHLNLQTL-----  598

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
                              VGLN+Q+C  ISSS ++ L E LWR D+LS
Sbjct  599  ------------------VGLNLQHCNSISSSSIERLVENLWRCDILS  628



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GL+KV+L+GC N+ D+AVS++ K HG++L+
Sbjct  489  ICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLIKVDLSGCKNITDVAVSSLVKGHGKSLK  548

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  +++ C+ L ELD+S   ++D G+  L  A  L L VLSLSGC+
Sbjct  549  KVSLEGCSKITDASLFTMSESCTELAELDLSNCMVSDHGVAILASARHLKLRVLSLSGCS  608

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  LG SL GLN+Q C  I +  + SL ++LW  D+L+
Sbjct  609  KVTQKSVPFLGNLGQSLEGLNLQFCNMIGNHNIASLEKQLWWCDILA  655



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GLVKV+L+GC N+ D+AVS++ K HG++L+
Sbjct  485  ICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLK  544

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             +NL+GC  +TD  L  +++ C+ L EL++S   ++D G+  L  A  L L VLSLSGC+
Sbjct  545  KINLEGCSKITDAILFTMSESCTELAELNLSNCMVSDYGVAILASARHLKLRVLSLSGCS  604

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++  L  LG S+ GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  605  KVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHNIASLEKKLWWCDILA  651



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
             C +L  V+  G   +TD GV  L+     GLVKVNL+GC+NV D  VSA++  HG TLE
Sbjct  451  FCHQLQDVELCGLDGVTDAGVRELLQRNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLE  510

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSGC  429
            +LNLDGC  +TD SLVA+A +C  + +LD+S + ++D GI AL  +   L+L VLS+ GC
Sbjct  511  SLNLDGCKNITDASLVAVAKNCYSVNDLDISNTLVSDHGIKALASSPNHLNLQVLSVGGC  570

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            + +++K+   + KLG +L+GLNIQ C  ISSS VD+  E+LWR D+L
Sbjct  571  SAITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTFLEQLWRCDIL  617



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            ++CP+L ++D +G   +TD+ ++ L+ S E G V++NL GCVNV D  V+ + K HG +L
Sbjct  487  RICPQLQNIDLSGQVGVTDESLIPLIESSEVGFVEINLTGCVNVTDDLVTMLIKVHGSSL  546

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL GC  +TD SL+AI + CSVL +LD+S   ++D G+  L  A QL+LH+LSL+ C
Sbjct  547  KMLNLHGCRKITDRSLLAITESCSVLDDLDLSSCSVSDYGVALLASARQLNLHILSLASC  606

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V+ K+LP L  LG S+VGLN+Q+C  IS+ G+  L EKLW  D++S
Sbjct  607  SQVTLKSLPFLGNLGLSIVGLNLQDCSLISAHGLRLLEEKLWWCDIIS  654



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L +V+ +G   +TD G L L+ S   GLV V+LNGC N+ D AVSA+ K HG +L 
Sbjct  461  ICPQLENVNLSGLSAVTDSGFLPLIKSSNSGLVNVDLNGCENLTDAAVSALVKAHGASLA  520

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L  A QL L VLSLSGC 
Sbjct  521  HLSLEGCSKITDASLFAISESCSQLAELDLSNCMVSDYGVAVLAAAKQLRLRVLSLSGCM  580

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + SSL GLN+Q    I +  + SL ++LWR D+L+
Sbjct  581  KVTQKSVPFLGSMSSSLEGLNLQ-FNFIGNHNIASLEKQLWRCDILA  626



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E GLVKV+L+GC N+ D+AVS++ K HG++L+
Sbjct  588  ICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLK  647

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             +NL+GC  +TD  L  +++ C+ L EL++S   ++D G+  L  A  L L VLSLSGC+
Sbjct  648  KINLEGCSKITDAILFTMSESCTELAELNLSNCMVSDYGVAILASARHLKLRVLSLSGCS  707

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++  L  LG S+ GLN+Q C  I +  + SL +KLW  D+L+
Sbjct  708  KVTQKSVLFLGNLGQSIEGLNLQFCDMIGNHNIASLEKKLWWCDILA  754



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 116/168 (69%), Gaps = 1/168 (1%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K C +L  V+  G   +TD G+L L+     GL+KVNL+GC+N+ D AV  I  +HG TL
Sbjct  456  KFCHQLQEVELCGLSGVTDVGLLGLLQYNSAGLLKVNLSGCINITDNAVLTIVTRHGCTL  515

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSG  432
            E+LNLD C  +TD SL+A++ +C  + +LDVS SR++D GI AL  +   L+L + S+ G
Sbjct  516  ESLNLDTCKNITDTSLIAVSKNCYSINDLDVSNSRVSDVGIEALASSPNHLNLQIFSIGG  575

Query  431  CAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            C+ V++K+L  L KLG +L+GL+I++C  ISSS +D+L E+LWR D+L
Sbjct  576  CSAVTDKSLASLQKLGHTLLGLSIRHCSKISSSAIDALLEQLWRCDIL  623



>gb|EMS45959.1| hypothetical protein TRIUR3_29988 [Triticum urartu]
Length=383

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L ++D +G   +TDDG+L L+ S E GL+ V+LNGC N+ D A+SA+ K HG +L 
Sbjct  218  ICPHLENLDLSGLGAVTDDGLLPLIRSSESGLIHVDLNGCENLTDAAISALVKAHGTSLA  277

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L+ A +L L VLSLSGC 
Sbjct  278  HLSLEGCSKITDASLFAISESCSELAELDLSNCMVSDYGVAVLSSAERLKLRVLSLSGCL  337

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D+L+
Sbjct  338  KVTPKSVPFLGSMPASLEGLNLQF-NFIGNHNIASLEKQLWWCDILA  383



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            ++C +L  +D +G   +TD  ++ L+ S E G V+VNL GCV++ D  V+ + K HG TL
Sbjct  485  RICSQLQKIDLSGQAGVTDASLIQLIGSSEVGFVEVNLCGCVDLTDDLVTLLVKAHGSTL  544

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + LNL+GC  +TD SL+A+AD CS+L +LD+S   ++D G+  L  A QL+LHVLSLS C
Sbjct  545  KMLNLNGCKKITDRSLLAVADSCSMLDDLDLSCCSVSDYGVAVLASARQLNLHVLSLSSC  604

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            + V+ K +P L  LG S+VGLN+QNC  IS+ G+  L EKLW  D++S
Sbjct  605  SKVTQKIVPFLGNLGKSMVGLNLQNCSLISTHGIVLLEEKLWWCDIIS  652



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 116/168 (69%), Gaps = 3/168 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  +D  G    T+ G L+L+   +  LVK+ L+GC N+ D  +SAI  ++G TL
Sbjct  465  KLCPQLEDIDLCGLKGTTESGNLHLI---QSSLVKIKLSGCSNLTDRVISAITARNGWTL  521

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            E LN DGC  +TD SLV+IA +C +L +LD+S+  I+DSGI AL  + +L L +LS++GC
Sbjct  522  EVLNRDGCSNITDASLVSIAANCQILSDLDISECAISDSGIQALASSDKLKLQILSVAGC  581

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +MV++K LP ++ LGS+L+GLN+Q C  IS+S VD L   L++ D LS
Sbjct  582  SMVTDKRLPAIVGLGSTLLGLNLQQCRSISNSPVDFLVGSLYKCDALS  629



>gb|KHM99176.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=161

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 107/152 (70%), Gaps = 0/152 (0%)
 Frame = -3

Query  740  ITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETLNLDGCGYVTDVSL  561
            IT+ G+L L+ +CE GLV VNL GC N+    VSA+ K HG TLE LNLDGC  +TD S 
Sbjct  10   ITNVGLLPLLQNCEAGLVNVNLIGCWNLIANIVSALVKIHGGTLELLNLDGCWKITDASS  69

Query  560  VAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgs  381
            VAIA +  V+ +LDVSK  IT++GI  L+ A Q SL VLSLSGC+ VSNK+ P L KLG 
Sbjct  70   VAIAKNFIVINDLDVSKCAITNAGIAILSRANQPSLQVLSLSGCSDVSNKSAPFLTKLGQ  129

Query  380  slvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            +L+GLN+QNC  I S  ++ L EKLWR  +L+
Sbjct  130  TLLGLNLQNCNSIGSDIMELLVEKLWRCHILA  161



>gb|EMT32544.1| hypothetical protein F775_30491 [Aegilops tauschii]
Length=452

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L ++D +G   +TDDG+L L+ S E GLV V+LNGC N+ D A+SA+ K HG +L 
Sbjct  287  ICPHLENLDLSGLGAVTDDGLLPLIRSSESGLVHVDLNGCENLTDAAISALVKAHGTSLA  346

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  ++D SL AI++ CS L ELD+S   ++D G+  L  A +L L VLSLSGC 
Sbjct  347  HLSLEGCSKISDASLFAISESCSELAELDLSNCMVSDYGVAVLASAERLKLRVLSLSGCL  406

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D+L+
Sbjct  407  KVTPKSVPFLGSMPASLEGLNLQF-NFIGNHNIASLEKQLWWCDILA  452



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L +VD +G   +TD+G+L L+ S E GLV V+LNGC N+ D  VSA+ K HG +L 
Sbjct  425  ICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLA  484

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L  A QL L VLSLSGC 
Sbjct  485  RLSLEGCSKITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLASARQLKLRVLSLSGCL  544

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D+L+
Sbjct  545  KVTQKSVPFLGSMSASLEGLNLQF-NFIGNHNIASLEKQLWWCDILA  590



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 110/168 (65%), Gaps = 2/168 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLS-CEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            +CP+L  +D +G   +TD+G L L+    E GLV+V LNGC ++ D AVSA+AK HG +L
Sbjct  460  ICPQLESIDLSGLGAVTDNGFLPLMKKGSESGLVRVGLNGCESLTDAAVSALAKAHGASL  519

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
              L+L+GC  +TD SL AI++ CS L ELD+S   ++D G+  L  A QL L VLSLSGC
Sbjct  520  AHLSLEGCSKITDASLFAISESCSQLAELDLSNCMVSDYGVAVLAAARQLKLRVLSLSGC  579

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
              V+ K++P L  + SSL  LN+Q    I +  + SL ++LWR D+L+
Sbjct  580  MKVTQKSVPFLGSMSSSLEALNLQF-NFIGNHNIASLEKQLWRCDILA  626



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L +VD +G   +TD+G+L L+ S E GLV V+LNGC N+ D  VSA+ K HG +L 
Sbjct  462  ICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLA  521

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L  A QL L VLSLSGC 
Sbjct  522  RLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLASARQLKLRVLSLSGCL  581

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D+L+
Sbjct  582  KVTQKSVPFLGSMSASLEGLNLQF-NFIGNHNIASLEKQLWWCDILA  627



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L +VD +G   +TD+G+L L+ S E GLV V+LNGC N+ D  VSA+ K HG +L 
Sbjct  499  ICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLA  558

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L  A QL L VLSLSGC 
Sbjct  559  RLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLASARQLKLRVLSLSGCL  618

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D+L+
Sbjct  619  KVTQKSVPFLGSMSASLEGLNLQF-NFIGNHNIASLEKQLWWCDILA  664



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 106/167 (63%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   ITD+G+L L+ S E   VKV+L+GC N+ DLAVS++ K HG++++
Sbjct  490  ICPQLEQVDLSGLGEITDNGLLPLIGSSEGAFVKVDLSGCKNITDLAVSSLVKVHGKSVK  549

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL +I+++C+ L ELD+S   ++DSG+ +L       L VLSL GC+
Sbjct  550  QVSLEGCSKITDASLFSISENCTELAELDLSNCMVSDSGVASLASTSNFKLRVLSLFGCS  609

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
                +     L     L GLNIQ C  I +  + SL ++LW  D+L+
Sbjct  610  -NVTQRSVPFLGNMGKLEGLNIQFCNMIGNHNIASLEKQLWWCDILA  655



>gb|AFA36487.1| EIN3-binding F-box protein, partial [Lolium perenne]
Length=263

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 108/167 (65%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L ++D +G   +TD+G+L L+ S E GLV V+LNGC N+ D A+SA+ K HG +L 
Sbjct  98   ICPHLENLDLSGLGAVTDNGLLPLIRSSESGLVNVDLNGCENLTDAAISALVKAHGGSLA  157

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+ C  +TD SL AI++ C  L ELD+S   ++D G+  L  A  L L +LSLSGC 
Sbjct  158  HLSLESCSKITDASLFAISESCYELAELDLSNCMVSDYGVAVLASAAGLKLRILSLSGCL  217

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D+L+
Sbjct  218  KVTQKSVPFLGSMPASLEGLNLQF-NFIGNHNIASLEKQLWWCDILA  263



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 109/167 (65%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP L +VD +G   +TD+G+L L+ S E GL+ V+LNGC N+ D ++SA+ K HG +L 
Sbjct  477  ICPHLENVDLSGLAAVTDNGLLPLIKSSESGLIHVDLNGCENLTDASISALVKAHGNSLT  536

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             L+L+GC  ++D SL AI++ C  L ELD+S   ++D G+  L  A QL L VLSLSGC 
Sbjct  537  HLSLEGCSKISDASLFAISESCCELAELDLSNCMVSDYGVAVLASAGQLKLRVLSLSGCF  596

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
             V+ K++P L  +  SL GLN+Q    I +  + SL ++LW  D+L+
Sbjct  597  KVTQKSVPFLGSMPVSLEGLNLQF-NFIGNHNIASLEKQLWWCDILA  642



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 107/167 (64%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E  LVKV+L+GC N+ D+AVS++ K HG++++
Sbjct  774  ICPQLEQVDLSGLGEVTDNGLLLLIKSSEGSLVKVDLSGCKNITDVAVSSLVKAHGKSVK  833

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  I+++C+ L ELD+S   ++DSG+ +L  A    L VLSL GC+
Sbjct  834  QVSLEGCSKITDASLFCISENCTELAELDLSNCMVSDSGVASLASAKHFKLRVLSLFGCS  893

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
                +     L     L GLN+Q C  I +  + SL ++LW  D+L+
Sbjct  894  -KVTQVGVQFLGSMGKLEGLNLQYCNMIGNHNIASLEKQLWWCDILA  939



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 106/167 (63%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   ITD+G+L L+ S E  LVKV+L+GC N+ D+ VS++ K HG++++
Sbjct  484  ICPQLEQVDLSGLGEITDNGLLPLIKSSEGSLVKVDLSGCKNITDVTVSSLVKAHGKSVK  543

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  I+++C+ L ELD+S   ++DSG+ +L  A    L VLSL GC+
Sbjct  544  QVSLEGCSKITDASLFCISENCTELAELDLSNCMVSDSGVASLASAKHFKLRVLSLFGCS  603

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
                +     L     L GLN+Q C  I +  + SL ++LW  D+++
Sbjct  604  -NVTQASVQFLGSMGKLEGLNLQYCNMIGNHNIASLEKQLWWCDIVA  649



>gb|EMS68820.1| hypothetical protein TRIUR3_29831 [Triticum urartu]
Length=484

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 105/167 (63%), Gaps = 1/167 (1%)
 Frame = -3

Query  785  LCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLE  606
            +CP+L  VD +G   +TD+G+L L+ S E  LVKV+L+GC N+ D+AVS++ K HG++++
Sbjct  319  ICPQLEQVDLSGLGEVTDNGLLPLINSSEGSLVKVDLSGCKNITDVAVSSLVKAHGKSVK  378

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCA  426
             ++L+GC  +TD SL  I+++C+ L  LD+S   ++DSG+ +L  A    L  LSL GC+
Sbjct  379  QISLEGCSKITDASLFCISENCTELAGLDLSNCMVSDSGVASLASAKHFKLRALSLFGCS  438

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
                +     L     L GLN+Q C  I +  + SL ++LW  D+L+
Sbjct  439  -KVTQVSVQFLGSMGKLEGLNLQYCNMIGNHNIASLEKQLWWCDILA  484



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 0/154 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP L  ++  G   ITD G ++L+   +  L  VNL+GC+N+ D+ V ++ K H  TL
Sbjct  474  KLCPTLQCLELIGLEGITDPGFISLLQRSKASLGNVNLSGCINLTDVGVLSMVKLHCSTL  533

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
              LNL+GC  V D SL AIAD+C VL +LDVS+  ITD+GI ALT  V  +L VLSL+GC
Sbjct  534  GVLNLNGCKKVGDASLTAIADNCIVLSDLDVSECAITDAGISALTRGVLFNLDVLSLAGC  593

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGV  327
            ++VSNK+L  L KLG SL GLNI+NC  ISS  V
Sbjct  594  SLVSNKSLSALKKLGDSLEGLNIKNCKSISSRTV  627



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L HV+ +G   +TD G L L+   E GL  VNL GC+NV D  V  I   HG T 
Sbjct  477  KLCPQLRHVELSGLQRVTDAGFLPLLECSETGLTTVNLRGCINVTDKVVLPIVNSHGCTR  536

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVAL  477
            + L LDGC  VTD S +AIA +C +L +LDVSK  ITD+GI AL
Sbjct  537  QVLCLDGCTRVTDASTMAIAGNCPMLSDLDVSKCAITDTGIAAL  580



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L ++D +    + D+ +++++  C E LV +NL  C N+ D+AV+AIA + G+ LE 
Sbjct  453  CPSLENLDLSQLTDLNDEAIISIIEVCGEHLVNLNLTNCKNITDVAVAAIASRCGD-LER  511

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAM  423
            L LDGC  V D  L  +A  C +L ELD+S + ITDSG+ +L  +  L L  L+ +GC  
Sbjct  512  LILDGCYQVGDNGLQTLATECPLLKELDLSGTSITDSGLRSLVTSQGLFLQGLTFTGCIN  571

Query  422  vsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  294
            +++++L  +      L  LN++NCP ++  G+ SL  +LW  D
Sbjct  572  LTDESLSSIEDFCPLLGSLNLRNCPLLTREGLSSLESQLWSCD  614



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 100/169 (59%), Gaps = 4/169 (2%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEG----LVKVNLNGCVNVGDLAVSAIAKQHGE  615
            C ++ H+   G   ITD GV+NL+ +        LV V+++G   + DL+V AI    GE
Sbjct  475  CIQVKHLTLVGLKLITDQGVINLIQTLNTNTVHRLVSVDMSGSSGITDLSVYAITSIVGE  534

Query  614  TLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLS  435
             L  L LDGC  ++D+SL  I++ C  L +L +S+  I+D GI  LT      L VLSL 
Sbjct  535  KLRCLILDGCERLSDLSLKMISERCPCLIDLGLSRCCISDDGIFCLTSTQMRCLKVLSLG  594

Query  434  GCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            GC  ++++ L  LL +  SLVGL++++CP ++  G+D++ E LW  D+L
Sbjct  595  GCVGITDRCLNYLLMIRGSLVGLDLKHCPQLTKEGIDAISETLWWCDLL  643



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 98/170 (58%), Gaps = 3/170 (2%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCE---EGLVKVNLNGCVNVGDLAVSAIAKQHG  618
            + C ++ H+  TG   ITD GV NL+ + E      + V+L+GC  + D +V  I    G
Sbjct  485  RACLQVKHLTLTGLKSITDQGVENLIRALETEQNRRISVDLSGCSRITDWSVFVITSLIG  544

Query  617  ETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSL  438
            + L +L LD C  +TD+SL  IA+ C+ L +L +S  RI+D G+  L  +    L V+S 
Sbjct  545  DKLRSLMLDWCEKLTDLSLKMIAERCACLLDLGLSGCRISDDGVYCLVASKLQCLEVVSF  604

Query  437  SGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVL  288
            +GC  +S+++L  L  L   LVGLN+ +CP ++  G+D + E LW  D+L
Sbjct  605  AGCVGISDQSLHYLRMLRCYLVGLNLMHCPKLTKEGIDRMRENLWWCDLL  654



>ref|XP_001783097.1| predicted protein [Physcomitrella patens]
 gb|EDQ52100.1| predicted protein [Physcomitrella patens]
Length=633

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L ++D +    + D+ +++++  C E LV +NL  C N+ D+ V+AIA   G+ LE 
Sbjct  463  CPLLENLDLSQMVDLNDEAIISVIEGCGEHLVSLNLTNCKNITDVVVAAIASHCGD-LER  521

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAM  423
            L LDGC  V D  L  +A  C  L ELD+S + ITDSG+ +L  +  L L  L+L+GC  
Sbjct  522  LILDGCYQVGDSGLQMLAAACPSLKELDLSGTSITDSGLRSLVISRGLWLQGLTLTGCIN  581

Query  422  vsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  294
            +++++L L+     SL  LN++NCP +S  G+ +L  +LW  D
Sbjct  582  LTDESLSLIEDYCPSLGALNLRNCPLLSREGLSALESQLWSCD  624



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 102/168 (61%), Gaps = 27/168 (16%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            KLCP+L  ++  G   +T+ G L+L+   +  LVKVN +GC  + D  VSAI+ ++    
Sbjct  459  KLCPQLEDIELCGLKGVTESGFLHLL---QNSLVKVNFSGCSGLTDRVVSAISARNA---  512

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
                                 +C +L +LD+SK  ++D GI AL  + +L L +LS++GC
Sbjct  513  ---------------------NCQILSDLDLSKCSVSDFGIQALASSEKLKLQILSMAGC  551

Query  428  AMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            AMV++K+LP ++KLGS+L+GLN+Q C  +S S VD L E+L++ D+LS
Sbjct  552  AMVTDKSLPSIVKLGSTLLGLNLQQCRSVSCSTVDFLLERLYKCDILS  599



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = -3

Query  779  PKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETL  600
            P + H+D  G   ++D G+L  + +    LV +NL+ CV + D A+  ++++  E L+T+
Sbjct  482  PAVQHLDLCGISKLSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGVSRKCFE-LQTV  540

Query  599  NLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMv  420
             LDGC  V+D S+  +A  C  L ELDVS   ITD GIVA+  +V  +L  LSLSGC+ V
Sbjct  541  ILDGCVKVSDKSVGVLASQCRSLQELDVSNCSITDDGIVAVVISVGPTLKTLSLSGCSRV  600

Query  419  snktlplllklgsslvglNIQNCPGISSSGVDSLGEKL-WRYDVL  288
            ++++LP + K+  SL  LN++NC G +++ ++     L  R D+L
Sbjct  601  TDESLPTIQKMCDSLTALNLKNCSGFTAAALEKFESDLGTRCDIL  645



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 101/165 (61%), Gaps = 2/165 (1%)
 Frame = -3

Query  779  PKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETL  600
            P + H+D  G   ++D G+L  + +    LV +NL+ CV + D A+  ++++  E L+T+
Sbjct  430  PAVQHLDLCGISKLSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGVSRKCFE-LQTV  488

Query  599  NLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMv  420
             LDGC  V+D S+  +A  C  L ELDVS   ITD GIVA+  +V  +L  LSLSGC+ V
Sbjct  489  ILDGCVKVSDKSVGVLASQCRSLQELDVSNCSITDDGIVAVVISVGPTLKTLSLSGCSRV  548

Query  419  snktlplllklgsslvglNIQNCPGISSSGVDSLGEKL-WRYDVL  288
            ++++LP + K+  SL  LN++NC G +++ ++     L  R D+L
Sbjct  549  TDESLPTIQKMCDSLTALNLKNCSGFTAAALEKFVSDLGTRCDIL  593



>ref|NP_001058023.1| Os06g0605900 [Oryza sativa Japonica Group]
 dbj|BAF19937.1| Os06g0605900, partial [Oryza sativa Japonica Group]
Length=122

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = -3

Query  653  DLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  474
            D  VSA+ K HG +L  L+L+GC  +TD SL AI++ C+ L ELD+S   ++D G+  L 
Sbjct  1    DATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA  60

Query  473  EAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYD  294
             A QL L VLSLSGC  V+ K++P L  + +SL GLN+Q    I +  + SL ++LW  D
Sbjct  61   SARQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQ-FNFIGNHNIASLEKQLWWCD  119

Query  293  VLS  285
            +L+
Sbjct  120  ILA  122



>ref|XP_002963689.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
 gb|EFJ35560.1| hypothetical protein SELMODRAFT_62165, partial [Selaginella moellendorffii]
Length=542

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 91/156 (58%), Gaps = 1/156 (1%)
 Frame = -3

Query  767  HVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETLNLDG  588
             +D +GF  ++D+ ++  +L+   GL  +NL+GC  + + A++A+A     +L  L LDG
Sbjct  385  ELDVSGFTALSDESLVPFLLASGSGLTSLNLSGCTRLTNRALAAVA-SFCPSLGLLTLDG  443

Query  587  CGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnkt  408
            C  VTD  +  +A     + EL ++   +TD G+VAL  A   SL  LSL+GC  V++++
Sbjct  444  CASVTDQGIRYVAQGPQAVQELSLAGCDVTDDGMVALVLAKGSSLKTLSLAGCGRVTDRS  503

Query  407  lplllklgsslvglNIQNCPGISSSGVDSLGEKLWR  300
            L ++    ++L  LN+++C G+S + ++     LWR
Sbjct  504  LLVMKTACNALEALNVKDCKGLSRAKLEWFEAGLWR  539



>ref|XP_009386195.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 63/120 (53%), Gaps = 2/120 (2%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLV--LSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            C ++  V FT    ITD G+   +  L     + +V+L GC  VG+ +V AI ++   +L
Sbjct  438  CKQVTDVSFTRMDSITDRGIRCFLSQLKGSNKMARVDLTGCTRVGNWSVWAITRECKASL  497

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
            + L L GCG V D     IA  C+ L ELD+    I+D G+  L     + L V+SL+GC
Sbjct  498  KRLVLRGCGRVNDRGAAVIARRCAKLVELDLGGCDISDEGVKKLARDEPIDLEVISLAGC  557



>ref|XP_006849175.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
 gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 97/165 (59%), Gaps = 0/165 (0%)
 Frame = -3

Query  779  PKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETL  600
            P +  +D TG   +T+ G++ L+   +E   +V+L+GC  V D +V A+    G  + TL
Sbjct  456  PAIKRLDLTGLTMVTNLGIMALLDVRKEVWTEVSLSGCARVSDDSVVALCNGCGGGIRTL  515

Query  599  NLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMv  420
            +LDGC  V D SL AIA  C+ + +LD+S+  ++D G+  L      SL + SLSGC+ +
Sbjct  516  SLDGCVQVGDASLEAIARLCTCINDLDLSQCAVSDLGLEFLARMGCTSLRIFSLSGCSRI  575

Query  419  snktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDVLS  285
            SN  +  L ++G+ LVGLN+ +C G+S   ++ L   L + D+ S
Sbjct  576  SNGCMSFLKEVGAGLVGLNLMHCGGLSRMAIERLKGSLSKCDIAS  620



>ref|XP_009032915.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
 gb|EGB11841.1| hypothetical protein AURANDRAFT_11299, partial [Aureococcus anophagefferens]
Length=330

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 71/123 (58%), Gaps = 4/123 (3%)
 Frame = -3

Query  791  SKLCPKLVHVDFTG---FHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQH  621
            ++ C +L +++       H  +D  +L++   C + LV+++LNGC  V D+ VS +A Q 
Sbjct  55   AEKCHRLEYINMARSELLHKTSDVALLSIAEGCGKTLVELDLNGCEMVTDVGVSWVAHQA  114

Query  620  GETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKS-RITDSGIVALTEAVQLSLHVL  444
            G TLE  NL GC  +T+    AIADHC V+  +D+  + R+TD G+  L  A+  +L  L
Sbjct  115  GATLEVFNLRGCNRLTNAGCRAIADHCHVIRVVDLRGARRVTDVGVRVLGAALGDTLETL  174

Query  443  SLS  435
             +S
Sbjct  175  DIS  177



>ref|XP_009523402.1| hypothetical protein PHYSODRAFT_489031 [Phytophthora sojae]
 gb|EGZ20685.1| hypothetical protein PHYSODRAFT_489031 [Phytophthora sojae]
Length=1227

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 86/163 (53%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D G+  +   C   L  + L GC +V  +A+ A+A+Q  + L
Sbjct  187  KCCPKLRVLDLFGCQHVHDPGIRAIAKGCPL-LTTLKLTGCRDVSSIAIRALAQQCTQ-L  244

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+ AL +    SL  LSL+G
Sbjct  245  EVLSLSGCIKTTNSDLQLLATNCPQLTWLDISGSPNIDARGVRALAQNCT-SLTYLSLAG  303

Query  431  C-----AMvsnktlplllklgsslvglNIQNCPGISSSGVDSL  318
            C     A +S  T      L  SL  L++ +CP ++ SGVD+L
Sbjct  304  CQHVGDAALSELTSAGAGGLTKSLGELSLADCPRVTESGVDAL  346



>ref|XP_002974778.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
 gb|EFJ24298.1| hypothetical protein SELMODRAFT_442539 [Selaginella moellendorffii]
Length=630

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 88/156 (56%), Gaps = 1/156 (1%)
 Frame = -3

Query  767  HVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETLNLDG  588
             ++ +G   ++D+ ++  + +   GL  +NL+GC  + + A++A+A     +L  L LDG
Sbjct  471  ELNVSGLSALSDESLVPFLSASGSGLTSLNLSGCTRLTNRALAAVA-SFCPSLGLLTLDG  529

Query  587  CGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAMvsnkt  408
            C  VTD  +  +A     + EL ++   +TD G+VAL  A   SL  LSL+GC  V++++
Sbjct  530  CASVTDQGIRYVAQGPQAVQELSLAGCDVTDDGMVALVLAKGSSLKTLSLAGCGRVTDRS  589

Query  407  lplllklgsslvglNIQNCPGISSSGVDSLGEKLWR  300
            L  +    ++L  LN+++C G+S + ++     LWR
Sbjct  590  LLAMKTACNTLEALNVKDCKGLSRAKLEWFEAGLWR  625



>ref|XP_009414462.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=615

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 59/121 (49%), Gaps = 2/121 (2%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLV--LSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            C  +  V F     ITD G+ + +  L     + +V+L+GC  +GD +V A+ ++    L
Sbjct  449  CKSVADVSFVRMGSITDRGITSFLKQLKGWNEITRVDLSGCTRLGDRSVWAVTRECKGRL  508

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
             +L L GCG VTD     I   C  L ELD+    I D  +  L E     L  LSL+GC
Sbjct  509  RSLALKGCGRVTDRGASVITRRCGRLVELDLGGCNIGDEAVEKLVEGDPSDLESLSLAGC  568

Query  428  A  426
            A
Sbjct  569  A  569



>emb|CDQ65477.1| unnamed protein product [Oncorhynchus mykiss]
Length=245

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 68/120 (57%), Gaps = 5/120 (4%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHG-ETLE  606
            CP+L  +   G   IT DGV  L  SC  GL  V+L  C  V D  V A+A  HG  +LE
Sbjct  77   CPQLRMILLRGQPSITSDGVRALAASCP-GLQVVDLTECAAVTDEGVLALA--HGCSSLE  133

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSGC  429
             L+L GC  V D +L+A+A +C +L  L++S +++TD G++ L  A    SL  L L+ C
Sbjct  134  VLSLWGCSAVGDAALLALAGNCRLLHSLNLSGTQVTDEGVIGLATAPCSNSLKELQLARC  193



>ref|XP_001635812.1| predicted protein [Nematostella vectensis]
 gb|EDO43749.1| predicted protein [Nematostella vectensis]
Length=263

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGF----HCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQH  621
            ++C KL  +D          IT +G++ +  SC + L  V L  C ++GD AV A+A ++
Sbjct  86   QVCKKLRKLDLNAVKDRRENITSNGIITISQSCHD-LQTVYLRRCTSIGDEAVIALA-EN  143

Query  620  GETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALT  474
               L  LNL GC  +TD SL A+A H   L  L+VSK++ITD+GI +LT
Sbjct  144  CPQLMHLNLGGCLQITDRSLKALAKHSKFLQSLNVSKTKITDTGIFSLT  192



>ref|XP_002908196.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61279.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=1213

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/162 (36%), Positives = 83/162 (51%), Gaps = 9/162 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL+ +D  G   + D GV  +   C   L  + L GC +V   A+ A+A Q  + L
Sbjct  187  KCCPKLLVLDLYGCQHVHDSGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAHQCAQ-L  244

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +CS L  LD+S S   D+ G+ AL +     L  LSL+ 
Sbjct  245  EVLSLSGCIKTTNSDLELLATNCSQLTWLDISGSPNIDARGVRALAQNCTF-LTYLSLAA  303

Query  431  C-----AMvsnktlplllklgsslvglNIQNCPGISSSGVDS  321
            C     A +S  T      L  SL GL++ +CP I+  GVD+
Sbjct  304  CQRVGDAALSELTSAGAGGLAKSLGGLSLADCPRITEHGVDA  345



>gb|ETP54439.1| hypothetical protein F442_00817 [Phytophthora parasitica P10297]
Length=1507

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  286  KCCPKLRVLDLFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  343

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+ AL +    SL  LSL+G
Sbjct  344  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRALAQNCT-SLTYLSLAG  402

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  403  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  445



>gb|ETP26438.1| hypothetical protein F441_00841 [Phytophthora parasitica CJ01A1]
Length=1507

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  286  KCCPKLRVLDLFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  343

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+ AL +    SL  LSL+G
Sbjct  344  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRALAQNCT-SLTYLSLAG  402

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  403  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  445



>gb|ETL49854.1| hypothetical protein L916_00795 [Phytophthora parasitica]
Length=1507

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  286  KCCPKLRVLDLFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  343

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+ AL +    SL  LSL+G
Sbjct  344  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRALAQNCT-SLTYLSLAG  402

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  403  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  445



>gb|ETK96431.1| hypothetical protein L915_00805 [Phytophthora parasitica]
Length=1507

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  286  KCCPKLRVLDLFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  343

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+ AL +    SL  LSL+G
Sbjct  344  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRALAQNCT-SLTYLSLAG  402

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  403  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  445



>gb|ETI56676.1| hypothetical protein F443_00864 [Phytophthora parasitica P1569]
 gb|ETM56153.1| hypothetical protein L914_00794 [Phytophthora parasitica]
Length=1507

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  286  KCCPKLRVLDLFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  343

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+ AL +    SL  LSL+G
Sbjct  344  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRALAQNCT-SLTYLSLAG  402

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  403  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  445



>ref|XP_008891235.1| hypothetical protein PPTG_20788 [Phytophthora parasitica INRA-310]
 gb|ETN24367.1| hypothetical protein PPTG_20788 [Phytophthora parasitica INRA-310]
Length=833

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 59/163 (36%), Positives = 84/163 (52%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  270  KCCPKLRVLDLFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  327

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+ AL +    SL  LSL+G
Sbjct  328  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRALAQNCT-SLTYLSLAG  386

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  387  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  429



>ref|XP_009859252.1| PREDICTED: protein AMN1 homolog [Ciona intestinalis]
Length=236

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 61/109 (56%), Gaps = 6/109 (6%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHC----ITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQ  624
            SK CP L+ +D          IT  GV NL   C + L  V L  CV+V D AV A+A +
Sbjct  59   SKSCPNLLKIDLNALKGSQTEITSVGVQNLSKGCRK-LRVVYLRRCVHVNDSAVIALA-E  116

Query  623  HGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVAL  477
            + + L+ +NL GC  +TD+S+ A+  HC  L  L++S + ITD GI  L
Sbjct  117  NCKALKQVNLAGCSEITDLSVKALWVHCHFLAHLNISNTPITDDGISGL  165



>ref|XP_009065234.1| hypothetical protein LOTGIDRAFT_184154 [Lottia gigantea]
 gb|ESO84107.1| hypothetical protein LOTGIDRAFT_184154 [Lottia gigantea]
Length=263

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 59/107 (55%), Gaps = 7/107 (7%)
 Frame = -3

Query  782  CPKLVHVDFTG----FHC-ITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHG  618
            CP LV +D         C IT  G++NL  SC   L  V L  C NV D  V A+A ++ 
Sbjct  89   CPNLVKIDINAPNPEIRCGITSQGIMNLARSCPY-LQIVFLRKCSNVTDDGVIALA-ENC  146

Query  617  ETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVAL  477
              L  LNL GC  +TD S++AI +H S +  L++S +++TD GI  L
Sbjct  147  PRLRHLNLRGCTQLTDKSVIAIGEHLSFISSLNISMTQVTDDGIFKL  193



>gb|ETO85437.1| hypothetical protein F444_00872 [Phytophthora parasitica P1976]
Length=1507

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 58/163 (36%), Positives = 83/163 (51%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +D  G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  286  KCCPKLRVLDLFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  343

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+  L +    SL  LSL+G
Sbjct  344  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRTLAQNCT-SLTYLSLAG  402

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  403  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  445



>ref|XP_010903725.1| PREDICTED: protein AMN1 homolog [Esox lucius]
Length=247

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHG-ETLE  606
            CP+L  +   G  CIT +G+  L  SC   L  V+L GC  V D  V A+A  HG  +LE
Sbjct  79   CPQLRRILLRGNLCITSEGMRALAASCPR-LQVVDLTGCTAVTDEGVLALA--HGCSSLE  135

Query  605  TLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEA  468
             L+L GC  V D +L+ +  +CS L  L++S +++TD G++ L  A
Sbjct  136  VLSLWGCSDVGDRALLELLGNCSFLHTLNLSGTQVTDEGVIGLATA  181



>ref|XP_008035164.1| RNI-like protein [Trametes versicolor FP-101664 SS1]
 gb|EIW61436.1| RNI-like protein [Trametes versicolor FP-101664 SS1]
Length=810

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 6/121 (5%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP LV +D TG   +TD  V+ +  S +  L  +NL GC  + D ++ A+A Q+   L  
Sbjct  67   CPNLVALDLTGVAEVTDSTVVAVARSAKR-LQGINLTGCKKLTDASIVALA-QNCPLLRR  124

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVAL-TEAVQLSLHVLSLSGC  429
            + L     +TD SL A+A  C +L E+D++   RI+DSG+  L T +VQ  +  + LS C
Sbjct  125  VKLSNVEQITDQSLSALARSCPLLLEIDLNNCKRISDSGLRDLWTYSVQ--MREMRLSHC  182

Query  428  A  426
            A
Sbjct  183  A  183


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 45/165 (27%), Positives = 75/165 (45%), Gaps = 34/165 (21%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            C +L  +       ++D+G++ ++  C   LV ++L G   V D  V A+A+   + L+ 
Sbjct  41   CVRLERLTLMNCTALSDEGLMRVLPQCPN-LVALDLTGVAEVTDSTVVAVARS-AKRLQG  98

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGCA  426
            +NL GC  +TD S+VA+A +C +L  + +S   +ITD  + AL  +  L L +       
Sbjct  99   INLTGCKKLTDASIVALAQNCPLLRRVKLSNVEQITDQSLSALARSCPLLLEI-------  151

Query  425  MvsnktlplllklgsslvglNIQNCPGISSSGVDSLGEKLWRYDV  291
                                ++ NC  IS SG+      LW Y V
Sbjct  152  --------------------DLNNCKRISDSGL----RDLWTYSV  172



>ref|WP_032112559.1| hypothetical protein [Candidatus Paracaedibacter symbiosus]
Length=246

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 4/119 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            C  L  +   G   I D  ++ L  SC   L  +NL GC  + D A+  +A +    L +
Sbjct  109  CTNLTSLTLEGCWQIKDAALIKLAESCS-NLTSLNLRGCEKITDTAIIKLA-ESCSNLAS  166

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGC  429
            LNL GCG +TD +++ +A+ CS L  L++ +  +ITD+ I+ L E+   +L  L+L  C
Sbjct  167  LNLRGCGKITDAAIIKLAESCSNLTSLNLRECEKITDAAIIKLAESCS-NLTSLNLREC  224



>ref|XP_001783600.1| predicted protein [Physcomitrella patens]
 gb|EDQ51564.1| predicted protein [Physcomitrella patens]
Length=371

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 66/120 (55%), Gaps = 3/120 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L  +D +    IT+ G+L LV  C   L  +NL GC + G  AV     +H + L++
Sbjct  154  CPMLEKLDLSACTGITEAGLLELVQRCS-NLRHLNLWGCTDAGTDAVLQALAKHCKALQS  212

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGCA  426
            LNL  C  VTD  ++A A  CS L  +D+ + +RITD  ++ L++  +  L  L LS CA
Sbjct  213  LNLGCCEQVTDKGIIAFARGCSDLRVIDLCRCNRITDQSVIFLSDKCR-HLCALGLSTCA  271



>gb|ELU01858.1| hypothetical protein CAPTEDRAFT_191279 [Capitella teleta]
Length=467

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 68/124 (55%), Gaps = 4/124 (3%)
 Frame = -3

Query  791  SKLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGET  612
            S+ C  L H++ +    ITD+GV+ LV  C +    +   GCV + D A   +A+Q    
Sbjct  190  SEGCHFLEHINLSWCSNITDEGVVTLVKGCRKFRTFI-CKGCVQLTDEAFQHLAQQ-CPH  247

Query  611  LETLNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLS  435
            L  LNL GC  VTD  +VA+++HC  L  L VS  S +TD+ +VAL +  +  L  L +S
Sbjct  248  LHVLNLQGCSSVTDECVVAVSEHCPDLYSLCVSNCSHLTDASLVALAQGCR-KLRTLEVS  306

Query  434  GCAM  423
             C+ 
Sbjct  307  RCSQ  310



>ref|XP_003727308.1| PREDICTED: protein AMN1 homolog [Strongylocentrotus purpuratus]
Length=264

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = -3

Query  740  ITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETLNLDGCGYVTDVSL  561
            ITD G+  L  SC   L  V L  CV++ D +  A+A+   + +E LNL GC  +TD SL
Sbjct  107  ITDQGIQALATSCPY-LSIVYLRRCVSLEDPSTIALAQSCHQLME-LNLGGCIRLTDASL  164

Query  560  VAIADHCSVLCELDVSKSRITDSGIVALTEAV-QLSLHVLSLSGC  429
             AI  +C +L  L++S++++TD GI +L   V + SL  L L+ C
Sbjct  165  QAIGQNCRMLKSLNISRTKVTDEGIFSLCNGVCKQSLKELHLNNC  209



>ref|XP_002981401.1| hypothetical protein SELMODRAFT_420841 [Selaginella moellendorffii]
 gb|EFJ17589.1| hypothetical protein SELMODRAFT_420841 [Selaginella moellendorffii]
Length=416

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 2/103 (2%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L  ++      +TD+ + +L   C   L  + L GC N+ D ++  +AK+ G+ L+ 
Sbjct  251  CPALKGINLLDCSKLTDESIASLARQCW-SLESLLLGGCRNLTDASIQVVAKERGQVLKH  309

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVAL  477
            L LD C  VTD SLVAI   C VL  LD    ++ITD  + AL
Sbjct  310  LQLDWCSEVTDESLVAIFSGCDVLERLDAQSCAKITDLSLDAL  352



>gb|ETM02924.1| hypothetical protein L917_00764 [Phytophthora parasitica]
Length=1507

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 57/163 (35%), Positives = 82/163 (50%), Gaps = 9/163 (6%)
 Frame = -3

Query  788  KLCPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETL  609
            K CPKL  +   G   + D GV  +   C   L  + L GC +V   A+ A+A+Q  + L
Sbjct  286  KCCPKLRVLALFGCQHVHDPGVRAVAKGCPL-LTTLRLTGCRDVSSSAIRALAQQCTQ-L  343

Query  608  ETLNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDS-GIVALTEAVQLSLHVLSLSG  432
            E L+L GC   T+  L  +A +C  L  LD+S S   D+ G+  L +    SL  LSL+G
Sbjct  344  EVLSLAGCIKTTNSDLELLATNCPQLTWLDISGSPNIDARGVRTLAQNCT-SLTYLSLAG  402

Query  431  CAMvsnktlplllkl-----gsslvglNIQNCPGISSSGVDSL  318
            C  V +  L  L          SL  L++ +CP I+ +GVD+L
Sbjct  403  CQRVGDTALSELTSAGAGGLAKSLGELSLADCPRITENGVDAL  445



>ref|XP_004345962.1| leucine rich repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21418.1| leucine rich repeat domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=2461

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = -3

Query  779   PKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETL  600
             P+L H+ F     IT+ GVL+LV +    LV + L+GC  + +  +  +AK    +L  L
Sbjct  2286  PQLRHLSFKNCPRITNRGVLDLVKTTTS-LVSLCLDGCEKISNKPIIYLAKG-CPSLRHL  2343

Query  599   NLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGC  429
             +L GC  ++D S+  IA+H + L  L VS  R+TD+ +V + + +   L+ L+++ C
Sbjct  2344  SLMGCKKISDKSITEIANHTTNLASLRVSSERVTDASLVLMGKKLP-QLYSLTMANC  2399



>gb|KDQ64252.1| hypothetical protein JAAARDRAFT_118397, partial [Jaapia argillacea 
MUCL 33604]
Length=547

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP LV VD TG    TD  V+ L LSC+  L  +NL GC  V +  V A+A+ +   L  
Sbjct  192  CPNLVAVDLTGVEETTDRAVIALALSCQR-LQGINLGGCKKVTNKGVLALAR-NCPLLRR  249

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGI  486
            + L G   VT+ S+ A+A  C +L E+D++   R+TD GI
Sbjct  250  VKLSGVDSVTNDSVSALARSCPLLLEIDLNGCKRVTDEGI  289



>dbj|GAM19532.1| hypothetical protein SAMD00019534_027070 [Acytostelium subglobosum 
LB1]
Length=2252

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 3/107 (3%)
 Frame = -3

Query  740   ITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETLNLDGCGYVTDVSL  561
             ITD+ V+ +   C   L  ++L  C  V D ++  IAK   + L  L L  C  VTD+S+
Sbjct  1969  ITDEAVMTIAQRCHM-LKNLDLTKCKLVTDSSIIEIAKSKAQELSRLVLYSCNLVTDMSI  2027

Query  560   VAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGCAM  423
             V +A HCS L  LDVS   +ITD  I  +   + L L VL +  C +
Sbjct  2028  VEVAKHCSSLIHLDVSMCEKITDISITKIAHGLPL-LRVLCMEECVI  2073



>gb|EFA03310.1| hypothetical protein TcasGA2_TC013252 [Tribolium castaneum]
Length=861

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 52/181 (29%), Positives = 86/181 (48%), Gaps = 28/181 (15%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCE-------------------------EGLVKVN  678
            CP L H++ +  + +T++GV  L   C                          + L  VN
Sbjct  593  CPNLTHINISWSNNVTENGVEALARGCRKLKSFISKGCKQITSRAVICLARFCDQLEVVN  652

Query  677  LNGCVNVGDLAVSAIAKQHGETLETLNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRI  501
            L GC ++ D AV A+A++    L  L L GC  +TD SL+A+A  C++L  L+V+  S+ 
Sbjct  653  LLGCCHITDEAVQALAEK-CPKLHYLCLSGCSALTDASLIALAQKCTLLSTLEVAGCSQF  711

Query  500  TDSGIVALTEAVQLSLHVLSLSGCAMvsnktlplllklgsslvglNIQNCPGISSSGVDS  321
            TD+G  AL  + +  L  + L  C ++++ TL  L      +  L + +C  I+  G+  
Sbjct  712  TDAGFQALARSCRY-LEKMDLDECVLITDNTLIHLAMGCPRIEYLTLSHCELITDEGIRH  770

Query  320  L  318
            L
Sbjct  771  L  771


 Score = 60.8 bits (146),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 48/156 (31%), Positives = 78/156 (50%), Gaps = 4/156 (3%)
 Frame = -3

Query  773  LVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETLNL  594
            L  +   G   I D  +  L   C   +  +NLNGC  + D + +A +K H   L+ LNL
Sbjct  518  LRQLSLRGCQSIADGSMKTLAQLCPN-VEDLNLNGCKKLTDASCTAFSK-HCSKLQKLNL  575

Query  593  DGCGYVTDVSLVAIADHCSVLCELDVSKS-RITDSGIVALTEAVQLSLHVLSLSGCAMvs  417
            DGC  +TD SL A++D C  L  +++S S  +T++G+ AL    +  L      GC  ++
Sbjct  576  DGCSAITDNSLKALSDGCPNLTHINISWSNNVTENGVEALARGCR-KLKSFISKGCKQIT  634

Query  416  nktlplllklgsslvglNIQNCPGISSSGVDSLGEK  309
            ++ +  L +    L  +N+  C  I+   V +L EK
Sbjct  635  SRAVICLARFCDQLEVVNLLGCCHITDEAVQALAEK  670



>ref|XP_010908612.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=569

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 56/97 (58%), Gaps = 0/97 (0%)
 Frame = -3

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAM  423
            L+L GC  VTD SL AIA  C  L ELD+S  RI+D G+  L       L  LSL+GCA 
Sbjct  464  LDLSGCRLVTDRSLRAIAQRCQELEELDLSGCRISDQGVECLASEGPSWLQALSLAGCAE  523

Query  422  vsnktlplllklgsslvglNIQNCPGISSSGVDSLGE  312
            +++K+L  L  L  SL  LN+  CPGIS   + S  E
Sbjct  524  ITDKSLEALQTLCVSLESLNVTRCPGISQEAISSFKE  560



>ref|XP_002969928.1| hypothetical protein SELMODRAFT_410553 [Selaginella moellendorffii]
 gb|EFJ29052.1| hypothetical protein SELMODRAFT_410553 [Selaginella moellendorffii]
Length=416

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 2/103 (2%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L  ++      +TD+ + +L   C   L  + L GC N+ D ++  +AK+ G+ L+ 
Sbjct  251  CPALKGINLLDCSKLTDESIASLARQCW-SLESLLLGGCRNLTDASIQVVAKERGQVLKH  309

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVAL  477
            L LD C  VTD SLVAI   C  L  LD    ++ITD  + AL
Sbjct  310  LQLDWCSEVTDESLVAIFSGCDFLERLDAQSCAKITDLSLDAL  352



>ref|XP_001630901.1| predicted protein [Nematostella vectensis]
 gb|EDO38838.1| predicted protein, partial [Nematostella vectensis]
Length=225

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 60/105 (57%), Gaps = 3/105 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L  ++ TG   IT+ G+  +  SC + L ++ L+GC  V D  V  +A +  + LE 
Sbjct  92   CPGLQRLNLTGKSLITNRGLGAIARSCGD-LEQLFLSGCSRVSDRGVRTLASKCPK-LEK  149

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTE  471
            L+L  C  +TD SL AI+  CS L  LD+S   +ITD GI AL+ 
Sbjct  150  LSLSNCLRLTDKSLSAISRKCSSLKTLDLSGCVKITDRGIKALSR  194



>ref|XP_317696.4| AGAP007807-PA [Anopheles gambiae str. PEST]
 gb|EAA12920.4| AGAP007807-PA [Anopheles gambiae str. PEST]
Length=422

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 4/121 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L  ++ +  + IT++GV  L   C + + K +  GC  V D AV A+A  +   +E 
Sbjct  154  CPNLSEINVSWCNLITENGVEALARGCNK-IKKFSSKGCKQVNDRAVIALA-LYCPGIEV  211

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGCA  426
            LNL  C  +TD S+  IA+ C  L +L VSK + +TD  + AL    Q  L+ L ++GCA
Sbjct  212  LNLHSCDSITDASISKIAEKCCNLKQLCVSKCTELTDQSLTALAMNNQY-LNTLEVAGCA  270

Query  425  M  423
             
Sbjct  271  Q  271



>ref|XP_008604897.1| hypothetical protein SDRG_01159 [Saprolegnia diclina VS20]
 gb|EQC41183.1| hypothetical protein SDRG_01159 [Saprolegnia diclina VS20]
Length=384

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 67/119 (56%), Gaps = 6/119 (5%)
 Frame = -3

Query  779  PKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETL  600
            P+L H++  G   I+DDG   L    +  L  ++L+ C  +GD  +  +       LE+L
Sbjct  122  PRLTHLNLHGCKRISDDGCKYLAQLSQ--LQFLDLSFCPRIGDFGLQHL---RALRLESL  176

Query  599  NLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLSGCAM  423
             L+ C  VTD  L+A+ D  S+L EL +S ++IT  G+++L      +LHVL LSGCA+
Sbjct  177  KLNMCRNVTDGGLLALQDMPSLL-ELGLSCTQITSVGLLSLANNSAANLHVLDLSGCAV  234



>gb|KIJ70119.1| hypothetical protein HYDPIDRAFT_172019 [Hydnomerulius pinastri 
MD-312]
Length=849

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 63/119 (53%), Gaps = 4/119 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            C +L  +     H I+DD  L+ VL C   LV ++L G     D  V+ +A    + L+ 
Sbjct  95   CDRLERLTLVNCHAISDDA-LSRVLPCLPNLVAIDLTGVTETSDRVVTGLASA-AKRLQG  152

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGC  429
            +NL GC  VTD+ + A+A +C +L  + +S   ++TD  + AL ++  L L +  L+ C
Sbjct  153  INLSGCKNVTDIGVFALAANCPLLRRVKLSGLEQVTDPPVSALAKSCPLLLEI-DLNNC  210


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = -3

Query  779  PKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETL  600
            P LV +D TG    T D V+  + S  + L  +NL+GC NV D+ V A+A  +   L  +
Sbjct  122  PNLVAIDLTGV-TETSDRVVTGLASAAKRLQGINLSGCKNVTDIGVFALAA-NCPLLRRV  179

Query  599  NLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITD  495
             L G   VTD  + A+A  C +L E+D++   RITD
Sbjct  180  KLSGLEQVTDPPVSALAKSCPLLLEIDLNNCKRITD  215



>gb|KIJ58308.1| hypothetical protein HYDPIDRAFT_55403, partial [Hydnomerulius 
pinastri MD-312]
Length=830

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 63/119 (53%), Gaps = 4/119 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            C +L  +     H I+DD  L+ VL C   LV ++L G     D  V+ +A    + L+ 
Sbjct  95   CDRLERLTLVNCHAISDDA-LSRVLPCLPNLVAIDLTGVTETSDRVVTGLASA-AKRLQG  152

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGC  429
            +NL GC  VTD+ + A+A +C +L  + +S   ++TD  + AL ++  L L +  L+ C
Sbjct  153  INLSGCKNVTDIGVFALAANCPLLRRVKLSGLEQVTDPPVSALAKSCPLLLEI-DLNNC  210


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = -3

Query  779  PKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLETL  600
            P LV +D TG    T D V+  + S  + L  +NL+GC NV D+ V A+A  +   L  +
Sbjct  122  PNLVAIDLTGV-TETSDRVVTGLASAAKRLQGINLSGCKNVTDIGVFALAA-NCPLLRRV  179

Query  599  NLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITD  495
             L G   VTD  + A+A  C +L E+D++   RITD
Sbjct  180  KLSGLEQVTDPPVSALAKSCPLLLEIDLNNCKRITD  215



>gb|ETN67343.1| f-box/leucine rich repeat protein [Anopheles darlingi]
Length=419

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP L  ++ +  + IT++GV  L   C + + K +  GC  V D AV A+A  +   +E 
Sbjct  151  CPNLAEINVSWCNLITENGVEALARGCNK-IKKFSSKGCKQVNDRAVIALA-LYCPGIEV  208

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVALTEAVQLSLHVLSLSGCA  426
            LNL  C  +TD S+  IA+ C  L +L VSK + +TD  ++AL+      L+ L ++GCA
Sbjct  209  LNLHSCDSITDASISKIAEKCINLKQLCVSKCTELTDQSLIALSTNNHY-LNTLEVAGCA  267



>ref|XP_009393361.1| PREDICTED: F-box/LRR-repeat protein 4 [Musa acuminata subsp. 
malaccensis]
Length=605

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 64/116 (55%), Gaps = 3/116 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            C  L  VD  G + + D G++ L  +C++ L  +NL  C  + D  +   A+ HG +L++
Sbjct  160  CKFLKSVDLQGCY-VGDKGLIALGQNCKQ-LEDLNLRFCEGLTDTGLVGFAQSHGSSLKS  217

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSKSRITDSGIVALTEAVQLSLHVLSLS  435
            L +  C +++DVSL A+A HC  L  L +    + ++G++++ +  + SL  L L 
Sbjct  218  LGIAACAWISDVSLQAVASHCKFLENLSLDSELMRNTGVISVAQGCR-SLKALKLQ  272



>emb|CDO71371.1| hypothetical protein BN946_scf184908.g129 [Trametes cinnabarina]
Length=923

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            CP LV +D T    +TD  ++ +  S +  L  +NL GC  + D +V A+A Q+   L  
Sbjct  180  CPNLVALDLTSVAEVTDRTIVAIAKSAKR-LQGINLTGCKKLTDASVMALA-QNCSLLRR  237

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSK-SRITDSGIVAL-TEAVQLSLHVLS  441
            + L     +TD S+  +A  C +L E+D++   RITDSG+  L T ++Q+    LS
Sbjct  238  VKLSNVELITDQSISVLARSCPLLLEIDLNNCKRITDSGVRELWTHSIQMREMRLS  293


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 62/119 (52%), Gaps = 4/119 (3%)
 Frame = -3

Query  782  CPKLVHVDFTGFHCITDDGVLNLVLSCEEGLVKVNLNGCVNVGDLAVSAIAKQHGETLET  603
            C +L  +       ++D+G+  ++  C   LV ++L     V D  + AIAK   + L+ 
Sbjct  154  CVRLERLTLMNCTALSDEGLTRVLPRCPN-LVALDLTSVAEVTDRTIVAIAKS-AKRLQG  211

Query  602  LNLDGCGYVTDVSLVAIADHCSVLCELDVSKSR-ITDSGIVALTEAVQLSLHVLSLSGC  429
            +NL GC  +TD S++A+A +CS+L  + +S    ITD  I  L  +  L L +  L+ C
Sbjct  212  INLTGCKKLTDASVMALAQNCSLLRRVKLSNVELITDQSISVLARSCPLLLEI-DLNNC  269



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385