BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027H23

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...    189   5e-54   Nicotiana sylvestris
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...    189   6e-54   Nicotiana sylvestris
ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...    187   2e-53   Nicotiana tomentosiformis
gb|KDP22716.1|  hypothetical protein JCGZ_01818                         185   2e-53   Jatropha curcas
emb|CDP10795.1|  unnamed protein product                                187   3e-53   Coffea canephora [robusta coffee]
ref|XP_004251520.1|  PREDICTED: probable beta-1,3-galactosyltrans...    187   3e-53   Solanum lycopersicum
ref|XP_010313672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    187   4e-53   Solanum lycopersicum
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    187   5e-53   Solanum lycopersicum
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...    187   5e-53   Solanum lycopersicum
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    186   6e-53   Nicotiana sylvestris
ref|XP_006351966.1|  PREDICTED: probable beta-1,3-galactosyltrans...    186   8e-53   Solanum tuberosum [potatoes]
ref|XP_006351967.1|  PREDICTED: probable beta-1,3-galactosyltrans...    186   8e-53   Solanum tuberosum [potatoes]
ref|XP_006592811.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   9e-53   
ref|XP_009624798.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   1e-52   Nicotiana tomentosiformis
gb|KDO54673.1|  hypothetical protein CISIN_1g015407mg                   183   1e-52   Citrus sinensis [apfelsine]
ref|XP_006447567.1|  hypothetical protein CICLE_v10015443mg             183   1e-52   
ref|XP_006375531.1|  hypothetical protein POPTR_0014s15200g             183   1e-52   
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg             186   1e-52   Prunus persica
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg             186   1e-52   Prunus persica
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   1e-52   Sesamum indicum [beniseed]
ref|XP_002524194.1|  Beta-1,3-galactosyltransferase sqv-2, putative     184   2e-52   
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Glycine max [soybeans]
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Nicotiana tomentosiformis
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Nicotiana tomentosiformis
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Solanum tuberosum [potatoes]
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Solanum tuberosum [potatoes]
ref|XP_010675728.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Glycine max [soybeans]
gb|KJB80507.1|  hypothetical protein B456_013G101400                    185   2e-52   Gossypium raimondii
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   2e-52   Populus euphratica
gb|KJB80505.1|  hypothetical protein B456_013G101400                    185   3e-52   Gossypium raimondii
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    185   3e-52   Populus euphratica
ref|XP_006592810.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   3e-52   
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Malus domestica [apple tree]
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Fragaria vesca subsp. vesca
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Malus domestica [apple tree]
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Camelina sativa [gold-of-pleasure]
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                   184   5e-52   Citrus sinensis [apfelsine]
ref|XP_006304048.1|  hypothetical protein CARUB_v10009858mg             181   5e-52   
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg             184   5e-52   Citrus clementina [clementine]
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Solanum tuberosum [potatoes]
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   5e-52   Fragaria vesca subsp. vesca
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   6e-52   Citrus sinensis [apfelsine]
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   6e-52   Citrus sinensis [apfelsine]
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                   184   6e-52   Citrus sinensis [apfelsine]
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                   184   6e-52   Citrus sinensis [apfelsine]
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g             184   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002320464.1|  galactosyltransferase family protein               184   6e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   6e-52   Sesamum indicum [beniseed]
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2          184   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892271.1|  galactosyltransferase family protein               184   7e-52   Arabidopsis lyrata subsp. lyrata
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2             183   8e-52   
ref|XP_010457599.1|  PREDICTED: probable beta-1,3-galactosyltrans...    183   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...    183   8e-52   Eucalyptus grandis [rose gum]
ref|XP_010457598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010457597.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010457596.1|  PREDICTED: probable beta-1,3-galactosyltrans...    184   9e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...    183   9e-52   Nicotiana sylvestris
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...    183   1e-51   Prunus mume [ume]
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...    183   1e-51   Nicotiana tomentosiformis
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                    183   1e-51   Arabis alpina [alpine rockcress]
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg             183   1e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   2e-51   Cucumis melo [Oriental melon]
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   2e-51   Cucumis sativus [cucumbers]
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    182   2e-51   
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...    182   2e-51   Gossypium arboreum [tree cotton]
ref|XP_009782227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   2e-51   Nicotiana sylvestris
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g             182   2e-51   Phaseolus vulgaris [French bean]
gb|KEH29682.1|  beta-1,3-galactosyltransferase-like protein             181   2e-51   Medicago truncatula
ref|XP_009397181.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   3e-51   Tarenaya hassleriana [spider flower]
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg                182   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   4e-51   Solanum lycopersicum
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...    182   4e-51   Phoenix dactylifera
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg                182   4e-51   Erythranthe guttata [common monkey flower]
ref|XP_010089999.1|  putative beta-1,3-galactosyltransferase 2          181   5e-51   Morus notabilis
ref|XP_009361001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   5e-51   Pyrus x bretschneideri [bai li]
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   7e-51   Elaeis guineensis
ref|XP_008226884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   7e-51   Prunus mume [ume]
ref|XP_008226885.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   7e-51   Prunus mume [ume]
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   7e-51   Cicer arietinum [garbanzo]
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   7e-51   Nelumbo nucifera [Indian lotus]
emb|CDP05735.1|  unnamed protein product                                181   8e-51   Coffea canephora [robusta coffee]
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   8e-51   Pyrus x bretschneideri [bai li]
gb|KDP39142.1|  hypothetical protein JCGZ_00899                         181   8e-51   Jatropha curcas
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein             181   9e-51   Medicago truncatula
ref|XP_004167799.1|  PREDICTED: probable beta-1,3-galactosyltrans...    174   9e-51   
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2               181   1e-50   Glycine soja [wild soybean]
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...    181   1e-50   Glycine max [soybeans]
ref|XP_002529902.1|  Beta-1,3-galactosyltransferase sqv-2, putative     176   1e-50   
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   1e-50   
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   2e-50   Malus domestica [apple tree]
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410          180   2e-50   Amborella trichopoda
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   2e-50   Malus domestica [apple tree]
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   2e-50   Vitis vinifera
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   2e-50   Vitis vinifera
ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...    180   2e-50   Vitis vinifera
ref|XP_006475058.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   2e-50   
emb|CDY12206.1|  BnaC04g12360D                                          180   2e-50   Brassica napus [oilseed rape]
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg             179   3e-50   
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   3e-50   Brassica rapa
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   3e-50   Brassica rapa
emb|CDY46836.1|  BnaA10g03200D                                          179   3e-50   Brassica napus [oilseed rape]
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   3e-50   Nelumbo nucifera [Indian lotus]
emb|CDY49507.1|  BnaC05g03190D                                          179   4e-50   Brassica napus [oilseed rape]
emb|CAN63417.1|  hypothetical protein VITISV_007689                     178   5e-50   Vitis vinifera
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   5e-50   Elaeis guineensis
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   5e-50   Glycine max [soybeans]
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    179   5e-50   
ref|XP_010063019.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   6e-50   Eucalyptus grandis [rose gum]
ref|XP_010063020.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   6e-50   Eucalyptus grandis [rose gum]
ref|XP_011048789.1|  PREDICTED: probable beta-1,3-galactosyltrans...    179   6e-50   Populus euphratica
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg             179   6e-50   Citrus clementina [clementine]
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   6e-50   Citrus sinensis [apfelsine]
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2          179   6e-50   
ref|XP_011048788.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   6e-50   Populus euphratica
gb|EPS73703.1|  hypothetical protein M569_01053                         173   7e-50   Genlisea aurea
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   7e-50   Brassica rapa
ref|XP_002302876.1|  hypothetical protein POPTR_0002s21280g             178   7e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   8e-50   Brassica rapa
emb|CDY48266.1|  BnaA05g10880D                                          178   8e-50   Brassica napus [oilseed rape]
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   9e-50   Setaria italica
ref|NP_001141034.1|  hypothetical protein                               177   1e-49   Zea mays [maize]
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   1e-49   
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    178   1e-49   
ref|XP_009612460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   1e-49   Nicotiana tomentosiformis
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...    177   1e-49   Vitis vinifera
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg             177   1e-49   Eutrema salsugineum [saltwater cress]
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_009398227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   
gb|KGN63249.1|  hypothetical protein Csa_2G418850                       177   2e-49   Cucumis sativus [cucumbers]
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   Cucumis melo [Oriental melon]
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   Cicer arietinum [garbanzo]
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   2e-49   Solanum tuberosum [potatoes]
ref|XP_009408655.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   3e-49   Fragaria vesca subsp. vesca
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...    177   3e-49   Fragaria vesca subsp. vesca
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1         177   3e-49   Zea mays [maize]
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg             176   3e-49   Capsella rubella
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3             176   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g             176   5e-49   Phaseolus vulgaris [French bean]
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...    175   1e-48   Cucumis sativus [cucumbers]
ref|XP_002879388.1|  galactosyltransferase family protein               175   1e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    175   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    175   1e-48   
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    175   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009399227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    174   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...    174   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...    174   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...    174   3e-48   Camelina sativa [gold-of-pleasure]
gb|KDO78243.1|  hypothetical protein CISIN_1g015962mg                   171   8e-48   Citrus sinensis [apfelsine]
ref|XP_007153952.1|  hypothetical protein PHAVU_003G079100g             172   9e-48   Phaseolus vulgaris [French bean]
gb|KDO78242.1|  hypothetical protein CISIN_1g015962mg                   172   9e-48   Citrus sinensis [apfelsine]
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960          172   2e-47   Sorghum bicolor [broomcorn]
ref|XP_006449734.1|  hypothetical protein CICLE_v10015441mg             170   2e-47   
ref|XP_010655390.1|  PREDICTED: probable beta-1,3-galactosyltrans...    172   2e-47   Vitis vinifera
ref|XP_006467430.1|  PREDICTED: probable beta-1,3-galactosyltrans...    171   3e-47   Citrus sinensis [apfelsine]
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative     171   3e-47   Ricinus communis
ref|XP_006467429.1|  PREDICTED: probable beta-1,3-galactosyltrans...    171   3e-47   Citrus sinensis [apfelsine]
gb|KHN03478.1|  Putative beta-1,3-galactosyltransferase 2               170   3e-47   Glycine soja [wild soybean]
gb|KJB80508.1|  hypothetical protein B456_013G101400                    171   4e-47   Gossypium raimondii
ref|XP_003550487.1|  PREDICTED: probable beta-1,3-galactosyltrans...    170   6e-47   Glycine max [soybeans]
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    171   6e-47   Oryza brachyantha
ref|XP_006449733.1|  hypothetical protein CICLE_v10015441mg             171   7e-47   
gb|EMS64796.1|  putative beta-1,3-galactosyltransferase 2               170   9e-47   Triticum urartu
ref|NP_001045990.1|  Os02g0164300                                       164   1e-46   
ref|NP_001050543.1|  Os03g0577500                                       170   1e-46   
gb|KDP20741.1|  hypothetical protein JCGZ_21212                         169   1e-46   Jatropha curcas
gb|KJB57752.1|  hypothetical protein B456_009G178900                    169   1e-46   Gossypium raimondii
gb|EPS64555.1|  hypothetical protein M569_10226                         169   1e-46   Genlisea aurea
ref|XP_007026088.1|  Galactosyltransferase family protein isoform 1     170   2e-46   
gb|KHG10854.1|  putative beta-1,3-galactosyltransferase 2 -like p...    169   2e-46   Gossypium arboreum [tree cotton]
ref|XP_007020793.1|  Galactosyltransferase family protein               169   2e-46   
ref|XP_010092200.1|  putative beta-1,3-galactosyltransferase 2          169   2e-46   Morus notabilis
gb|KJB57747.1|  hypothetical protein B456_009G178900                    169   2e-46   Gossypium raimondii
ref|XP_010652984.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    169   2e-46   Vitis vinifera
dbj|BAJ89733.1|  predicted protein                                      169   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89822.1|  predicted protein                                      169   3e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002269415.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    169   3e-46   Vitis vinifera
ref|NP_001183433.1|  uncharacterized protein LOC100501859               163   3e-46   
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                  169   3e-46   Medicago truncatula
gb|EMS67042.1|  putative beta-1,3-galactosyltransferase 2               167   4e-46   Triticum urartu
gb|EMT25658.1|  Putative beta-1,3-galactosyltransferase 2               168   4e-46   
ref|XP_006452383.1|  hypothetical protein CICLE_v10008439mg             166   4e-46   
ref|XP_007039332.1|  Galactosyltransferase family protein isoform 1     168   4e-46   
ref|XP_007039333.1|  Galactosyltransferase family protein isoform 2     168   4e-46   
gb|KHG03847.1|  putative beta-1,3-galactosyltransferase 2 -like p...    168   5e-46   Gossypium arboreum [tree cotton]
ref|XP_007039335.1|  Beta-1,3-galactosyltransferase 6 isoform 4         168   7e-46   
ref|XP_011097870.1|  PREDICTED: probable beta-1,3-galactosyltrans...    167   8e-46   Sesamum indicum [beniseed]
gb|EMT12895.1|  Putative beta-1,3-galactosyltransferase 2               167   9e-46   
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...    167   1e-45   Brachypodium distachyon [annual false brome]
ref|XP_009419577.1|  PREDICTED: probable beta-1,3-galactosyltrans...    167   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009601250.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    165   1e-45   Nicotiana tomentosiformis
gb|KCW70545.1|  hypothetical protein EUGRSUZ_F03738                     165   1e-45   Eucalyptus grandis [rose gum]
ref|XP_009786663.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    165   1e-45   Nicotiana sylvestris
gb|EYU23928.1|  hypothetical protein MIMGU_mgv1a007764mg                167   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_010943123.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    167   1e-45   Elaeis guineensis
ref|XP_010251481.1|  PREDICTED: probable beta-1,3-galactosyltrans...    167   1e-45   Nelumbo nucifera [Indian lotus]
ref|XP_004507687.1|  PREDICTED: probable beta-1,3-galactosyltrans...    166   1e-45   Cicer arietinum [garbanzo]
ref|XP_006364961.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    165   1e-45   Solanum tuberosum [potatoes]
gb|EYU22897.1|  hypothetical protein MIMGU_mgv1a007777mg                167   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_002518935.1|  Beta-1,3-galactosyltransferase sqv-2, putative     167   2e-45   Ricinus communis
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg             166   3e-45   
ref|XP_002300511.1|  hypothetical protein POPTR_0001s45420g             165   3e-45   
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...    166   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_008778068.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    162   3e-45   Phoenix dactylifera
ref|XP_011097866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    167   3e-45   
ref|XP_009601249.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    166   3e-45   Nicotiana tomentosiformis
gb|KCW70544.1|  hypothetical protein EUGRSUZ_F03738                     165   3e-45   Eucalyptus grandis [rose gum]
ref|NP_001149120.1|  beta-1,3-galactosyltransferase sqv-2               165   3e-45   
ref|XP_010536662.1|  PREDICTED: probable beta-1,3-galactosyltrans...    166   4e-45   
ref|NP_001141890.1|  hypothetical protein                               166   4e-45   Zea mays [maize]
ref|XP_002979099.1|  glycosyltransferase-like protein                   166   4e-45   
gb|KJB13704.1|  hypothetical protein B456_002G089700                    165   4e-45   Gossypium raimondii
emb|CAA06925.1|  Avr9 elicitor response protein                         166   4e-45   Nicotiana tabacum [American tobacco]
ref|XP_006439188.1|  hypothetical protein CICLE_v10020627mg             161   4e-45   
ref|XP_006646915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    166   4e-45   Oryza brachyantha
dbj|BAD25162.1|  putative Avr9 elicitor response protein                166   4e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009786662.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    166   4e-45   Nicotiana sylvestris
ref|XP_002451594.1|  hypothetical protein SORBIDRAFT_04g004400          166   5e-45   Sorghum bicolor [broomcorn]
ref|XP_010104914.1|  putative beta-1,3-galactosyltransferase 6          166   5e-45   
gb|EAY84604.1|  hypothetical protein OsI_05972                          166   5e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_002974972.1|  glycosyltransferase-like protein                   166   5e-45   Selaginella moellendorffii
gb|KDP25226.1|  hypothetical protein JCGZ_20382                         166   5e-45   Jatropha curcas
ref|XP_002977391.1|  glycosyltransferase-like protein                   166   5e-45   Selaginella moellendorffii
ref|XP_006370727.1|  hypothetical protein POPTR_0001s45420g             165   6e-45   
ref|XP_004250351.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    165   6e-45   Solanum lycopersicum
gb|KJB13705.1|  hypothetical protein B456_002G089700                    164   6e-45   Gossypium raimondii
gb|KJB64380.1|  hypothetical protein B456_010G046600                    163   6e-45   Gossypium raimondii
ref|XP_010245068.1|  PREDICTED: beta-1,3-galactosyltransferase 7        165   6e-45   Nelumbo nucifera [Indian lotus]
ref|XP_010063329.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    165   6e-45   Eucalyptus grandis [rose gum]
ref|XP_006364960.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    165   6e-45   Solanum tuberosum [potatoes]
ref|XP_010063328.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    165   6e-45   Eucalyptus grandis [rose gum]
ref|XP_011470881.1|  PREDICTED: probable beta-1,3-galactosyltrans...    165   7e-45   Fragaria vesca subsp. vesca
ref|XP_010063326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    165   7e-45   Eucalyptus grandis [rose gum]
ref|XP_010063327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    165   7e-45   Eucalyptus grandis [rose gum]
ref|XP_008677265.1|  PREDICTED: beta-1,3-galactosyltransferase sq...    165   8e-45   
ref|XP_003575190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    165   8e-45   Brachypodium distachyon [annual false brome]
ref|XP_006439187.1|  hypothetical protein CICLE_v10020627mg             163   8e-45   
ref|XP_007136194.1|  hypothetical protein PHAVU_009G026100g             165   8e-45   Phaseolus vulgaris [French bean]
gb|KHN47065.1|  Beta-1,3-galactosyltransferase 7                        164   8e-45   Glycine soja [wild soybean]
ref|XP_003523469.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    165   8e-45   Glycine max [soybeans]
gb|KDO76779.1|  hypothetical protein CISIN_1g021312mg                   162   9e-45   Citrus sinensis [apfelsine]
ref|XP_010916559.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   9e-45   Elaeis guineensis
ref|XP_006578989.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   1e-44   Glycine max [soybeans]
gb|KJB69212.1|  hypothetical protein B456_011G013600                    163   1e-44   Gossypium raimondii
ref|XP_002317052.2|  galactosyltransferase family protein               164   1e-44   
ref|XP_002462477.1|  hypothetical protein SORBIDRAFT_02g026360          165   1e-44   
ref|NP_001131318.1|  uncharacterized protein LOC100192632               164   1e-44   
gb|ACF79671.1|  unknown                                                 164   1e-44   Zea mays [maize]
gb|KJB13702.1|  hypothetical protein B456_002G089700                    164   1e-44   Gossypium raimondii
ref|XP_003526605.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   1e-44   Glycine max [soybeans]
ref|XP_006647402.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   1e-44   Oryza brachyantha
ref|XP_006581562.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   1e-44   Glycine max [soybeans]
ref|XP_010240796.1|  PREDICTED: probable beta-1,3-galactosyltrans...    164   1e-44   Brachypodium distachyon [annual false brome]
ref|XP_001781844.1|  predicted protein                                  164   1e-44   
ref|XP_008802092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   2e-44   Phoenix dactylifera
ref|XP_004951866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    164   2e-44   Setaria italica
ref|XP_004515660.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   2e-44   Cicer arietinum [garbanzo]
ref|XP_003601132.1|  Avr9 elicitor response protein                     164   2e-44   Medicago truncatula
ref|XP_004515661.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    164   2e-44   Cicer arietinum [garbanzo]
ref|XP_003601133.1|  Avr9 elicitor response protein                     164   2e-44   Medicago truncatula
ref|XP_006846610.1|  hypothetical protein AMTR_s00156p00023720          164   2e-44   Amborella trichopoda
ref|XP_011074895.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    163   2e-44   Sesamum indicum [beniseed]
ref|XP_004162968.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   2e-44   
gb|KDP32735.1|  hypothetical protein JCGZ_12027                         164   2e-44   Jatropha curcas
emb|CDP18301.1|  unnamed protein product                                163   3e-44   Coffea canephora [robusta coffee]
gb|KHG03200.1|  Beta-1,3-galactosyltransferase 7 -like protein          163   3e-44   Gossypium arboreum [tree cotton]
gb|KJB64379.1|  hypothetical protein B456_010G046600                    163   3e-44   
gb|KJB64381.1|  hypothetical protein B456_010G046600                    163   3e-44   
ref|XP_006476263.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   3e-44   
ref|XP_006476264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   3e-44   
gb|KHN26051.1|  Beta-1,3-galactosyltransferase 7                        162   3e-44   
dbj|BAJ94062.1|  predicted protein                                      163   3e-44   
gb|EMS52307.1|  putative beta-1,3-galactosyltransferase 2               163   3e-44   
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...    163   3e-44   
ref|XP_003576598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   3e-44   
ref|XP_009589155.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   4e-44   
ref|XP_010277678.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    163   4e-44   
ref|XP_006439190.1|  hypothetical protein CICLE_v10020627mg             162   4e-44   
ref|XP_009782081.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   4e-44   
ref|XP_001758882.1|  predicted protein                                  163   4e-44   
gb|KHG10489.1|  Beta-1,3-galactosyltransferase 7 -like protein          160   4e-44   
gb|KJB69210.1|  hypothetical protein B456_011G013600                    163   4e-44   
ref|XP_010095510.1|  Beta-1,3-galactosyltransferase 7                   163   4e-44   
gb|KJB69211.1|  hypothetical protein B456_011G013600                    163   4e-44   
gb|EMT26667.1|  Beta-1,3-galactosyltransferase 7                        163   5e-44   
ref|XP_011040606.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   5e-44   
ref|XP_008392652.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   5e-44   
ref|XP_009344054.1|  PREDICTED: probable beta-1,3-galactosyltrans...    163   5e-44   
ref|XP_007209207.1|  hypothetical protein PRUPE_ppa006612mg             163   5e-44   
gb|KJB59160.1|  hypothetical protein B456_009G242100                    162   6e-44   
ref|XP_006596309.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    162   6e-44   
ref|XP_008245629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    162   6e-44   
gb|KHN06134.1|  Beta-1,3-galactosyltransferase 7                        162   7e-44   
gb|EPS60081.1|  hypothetical protein M569_14722                         159   7e-44   
ref|XP_011097468.1|  PREDICTED: beta-1,3-galactosyltransferase 7        162   8e-44   
ref|XP_011038007.1|  PREDICTED: probable beta-1,3-galactosyltrans...    162   8e-44   
ref|XP_008437459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    162   8e-44   
dbj|BAD17751.1|  putative avr9 elicitor response protein                162   8e-44   
ref|XP_002988781.1|  glycosyltransferase-like protein                   162   9e-44   
ref|XP_003542690.1|  PREDICTED: beta-1,3-galactosyltransferase 7        162   9e-44   
ref|XP_010053046.1|  PREDICTED: probable beta-1,3-galactosyltrans...    161   1e-43   
ref|XP_006660681.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    160   1e-43   
ref|XP_008439989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    162   1e-43   
ref|XP_009367326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    162   1e-43   
ref|XP_009367325.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    162   1e-43   
ref|XP_009367323.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    162   1e-43   
ref|XP_002278708.1|  PREDICTED: probable beta-1,3-galactosyltrans...    162   1e-43   
ref|XP_010534616.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    162   1e-43   
ref|XP_009367324.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    162   1e-43   
ref|NP_001141176.1|  hypothetical protein                               159   1e-43   
ref|XP_008378526.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    162   1e-43   
ref|XP_008378524.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    162   1e-43   
ref|XP_008378522.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    162   1e-43   
ref|XP_008437460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    162   1e-43   
ref|XP_008378523.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    162   1e-43   
ref|XP_007222961.1|  hypothetical protein PRUPE_ppa006755mg             161   1e-43   
ref|XP_008233934.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    161   2e-43   
ref|XP_008233933.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    161   2e-43   
ref|XP_008233932.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    161   2e-43   
ref|XP_004952712.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    161   2e-43   
gb|AGZ15279.1|  putative Avr9 elicitor response protein                 161   2e-43   
ref|XP_008233935.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    161   2e-43   
ref|XP_002454032.1|  hypothetical protein SORBIDRAFT_04g023470          161   2e-43   
ref|XP_008444117.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    161   2e-43   
gb|ADE75915.1|  unknown                                                 157   2e-43   
ref|XP_008444116.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    161   2e-43   
ref|XP_010053045.1|  PREDICTED: probable beta-1,3-galactosyltrans...    161   2e-43   
ref|XP_009401434.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    161   2e-43   
gb|KFK45039.1|  hypothetical protein AALP_AA1G336200                    161   2e-43   
gb|AFK45069.1|  unknown                                                 154   2e-43   
ref|XP_010686831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    161   2e-43   
ref|XP_004956987.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    160   3e-43   
ref|XP_001779676.1|  predicted protein                                  160   3e-43   
ref|NP_174569.1|  putative beta-1,3-galactosyltransferase               160   3e-43   
gb|ADE77778.1|  unknown                                                 159   3e-43   
ref|NP_001063339.1|  Os09g0452900                                       160   3e-43   
gb|KJB62839.1|  hypothetical protein B456_009G440200                    160   3e-43   
gb|KGN49967.1|  hypothetical protein Csa_5G146900                       160   3e-43   
gb|KHN35737.1|  Putative beta-1,3-galactosyltransferase 2               154   3e-43   
gb|KJB62840.1|  hypothetical protein B456_009G440200                    160   3e-43   
ref|XP_006828867.1|  hypothetical protein AMTR_s00001p00171620          160   4e-43   
ref|XP_004145877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    160   4e-43   
ref|XP_009414059.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    160   4e-43   
ref|XP_004142613.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    160   4e-43   
gb|KGN54610.1|  hypothetical protein Csa_4G377730                       160   4e-43   
emb|CDX93812.1|  BnaA09g24120D                                          160   4e-43   
gb|ACJ84307.1|  unknown                                                 154   4e-43   
ref|XP_002893747.1|  galactosyltransferase family protein               160   5e-43   
ref|XP_009114848.1|  PREDICTED: probable beta-1,3-galactosyltrans...    160   5e-43   
ref|XP_006656380.1|  PREDICTED: probable beta-1,3-galactosyltrans...    160   5e-43   
ref|XP_004300420.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    160   5e-43   
ref|XP_008681428.1|  PREDICTED: hypothetical protein isoform X1         160   5e-43   
gb|ACG41551.1|  avr9 elicitor response protein                          160   5e-43   
ref|XP_011465327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    160   5e-43   
ref|XP_008777928.1|  PREDICTED: probable beta-1,3-galactosyltrans...    159   6e-43   
ref|XP_008782246.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    160   7e-43   
ref|XP_007212259.1|  hypothetical protein PRUPE_ppa006626mg             159   8e-43   
gb|KJB62836.1|  hypothetical protein B456_009G440200                    160   8e-43   
emb|CDY54843.1|  BnaC05g51320D                                          160   9e-43   
ref|XP_006304992.1|  hypothetical protein CARUB_v10009358mg             159   9e-43   
ref|XP_008224857.1|  PREDICTED: probable beta-1,3-galactosyltrans...    159   1e-42   
ref|XP_007141114.1|  hypothetical protein PHAVU_008G168500g             159   1e-42   
ref|XP_004966215.1|  PREDICTED: probable beta-1,3-galactosyltrans...    159   1e-42   
ref|XP_009367010.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    159   1e-42   
ref|XP_006344003.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    159   1e-42   
ref|XP_004295272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   1e-42   
emb|CAB36540.1|  Avr9 elicitor response like protein                    159   1e-42   
ref|XP_002867534.1|  galactosyltransferase family protein               159   1e-42   
ref|NP_567762.1|  putative beta-1,3-galactosyltransferase 4             159   1e-42   
ref|XP_011081357.1|  PREDICTED: probable beta-1,3-galactosyltrans...    159   1e-42   
ref|XP_008338811.1|  PREDICTED: beta-1,3-galactosyltransferase 7        159   2e-42   
ref|XP_001754566.1|  predicted protein                                  158   2e-42   
ref|XP_002305569.1|  hypothetical protein POPTR_0004s01390g             158   2e-42   
ref|XP_008374141.1|  PREDICTED: probable beta-1,3-galactosyltrans...    159   2e-42   
ref|XP_010499840.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   2e-42   
ref|XP_010478679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   2e-42   
gb|ADN34055.1|  galactosyltransferase                                   157   3e-42   
ref|XP_008441020.1|  PREDICTED: probable beta-1,3-galactosyltrans...    157   3e-42   
dbj|BAK03918.1|  predicted protein                                      158   3e-42   
ref|XP_008441012.1|  PREDICTED: probable beta-1,3-galactosyltrans...    157   3e-42   
ref|XP_002285826.1|  PREDICTED: beta-1,3-galactosyltransferase 7        158   3e-42   
ref|XP_011037627.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    158   3e-42   
ref|XP_004155605.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   3e-42   
ref|XP_004134762.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   3e-42   
ref|XP_010461116.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   3e-42   
ref|XP_008352694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    158   4e-42   
ref|XP_010672363.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    157   4e-42   
ref|XP_010461115.1|  PREDICTED: probable beta-1,3-galactosyltrans...    158   5e-42   
ref|XP_002970340.1|  glycosyltransferase-like protein                   157   5e-42   
ref|XP_010542088.1|  PREDICTED: probable beta-1,3-galactosyltrans...    157   5e-42   
ref|XP_010672316.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    157   5e-42   
gb|KJB52408.1|  hypothetical protein B456_008G260300                    156   6e-42   
ref|XP_002968104.1|  glycosyltransferase-like protein                   157   6e-42   
ref|XP_006836897.1|  hypothetical protein AMTR_s00099p00123290          157   7e-42   
ref|XP_007045661.1|  Galactosyltransferase family protein               157   7e-42   
ref|XP_002302264.1|  galactosyltransferase family protein               157   8e-42   
gb|AFK48973.1|  unknown                                                 157   8e-42   
ref|XP_010676934.1|  PREDICTED: probable beta-1,3-galactosyltrans...    157   8e-42   
ref|XP_004145116.1|  PREDICTED: probable beta-1,3-galactosyltrans...    156   9e-42   
ref|XP_011027638.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    156   9e-42   
ref|XP_011027635.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    157   9e-42   
ref|NP_001058369.1|  Os06g0679500                                       157   9e-42   
ref|XP_006413124.1|  hypothetical protein EUTSA_v10025360mg             157   9e-42   
ref|XP_011027636.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    156   1e-41   
ref|XP_011027637.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    156   1e-41   
ref|XP_006304002.1|  hypothetical protein CARUB_v10011446mg             156   1e-41   
ref|XP_011047977.1|  PREDICTED: probable beta-1,3-galactosyltrans...    156   1e-41   
gb|KHG17244.1|  putative beta-1,3-galactosyltransferase 6 -like p...    156   1e-41   
ref|XP_011047978.1|  PREDICTED: probable beta-1,3-galactosyltrans...    156   1e-41   
gb|KJB52405.1|  hypothetical protein B456_008G260300                    156   2e-41   
ref|XP_009360212.1|  PREDICTED: probable beta-1,3-galactosyltrans...    156   2e-41   
ref|XP_006415137.1|  hypothetical protein EUTSA_v10007803mg             156   2e-41   
ref|XP_006389613.1|  hypothetical protein POPTR_0021s00630g             156   2e-41   
gb|KGN64515.1|  hypothetical protein Csa_1G062900                       155   3e-41   
ref|XP_002513842.1|  Beta-1,3-galactosyltransferase sqv-2, putative     155   3e-41   
ref|XP_009412887.1|  PREDICTED: uncharacterized protein LOC103994283    161   3e-41   
ref|XP_009109161.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   3e-41   
emb|CDX97371.1|  BnaC08g12360D                                          155   3e-41   
ref|XP_009357459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   3e-41   
ref|XP_009774684.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    152   4e-41   
ref|XP_002306601.2|  galactosyltransferase family protein               155   5e-41   
ref|XP_010448195.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   5e-41   
ref|XP_010433424.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   5e-41   
ref|XP_010233857.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   5e-41   
ref|XP_010448194.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   5e-41   
ref|XP_010438679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   5e-41   
ref|XP_010438680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    155   5e-41   
ref|NP_001149873.1|  LOC100283501                                       155   6e-41   
gb|ACL53751.1|  unknown                                                 155   6e-41   
ref|XP_006441805.1|  hypothetical protein CICLE_v10024512mg             155   6e-41   
ref|XP_004158007.1|  PREDICTED: probable beta-1,3-galactosyltrans...    154   7e-41   
gb|KHG30400.1|  putative beta-1,3-galactosyltransferase 6 -like p...    154   7e-41   
gb|KDO80826.1|  hypothetical protein CISIN_1g015683mg                   152   7e-41   
ref|XP_010252349.1|  PREDICTED: probable beta-1,3-galactosyltrans...    154   1e-40   
ref|XP_008459501.1|  PREDICTED: probable beta-1,3-galactosyltrans...    153   1e-40   
ref|XP_004970763.1|  PREDICTED: probable beta-1,3-galactosyltrans...    154   1e-40   
ref|XP_006478362.1|  PREDICTED: probable beta-1,3-galactosyltrans...    154   1e-40   
emb|CDY46675.1|  BnaA03g48330D                                          154   1e-40   
ref|XP_010927833.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    153   1e-40   
ref|XP_006472695.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    153   1e-40   
ref|XP_006840618.1|  hypothetical protein AMTR_s00084p00079370          153   2e-40   
emb|CBI16979.3|  unnamed protein product                                153   2e-40   
ref|XP_006472694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    153   2e-40   
ref|XP_002513511.1|  transferase, transferring glycosyl groups, p...    154   2e-40   
ref|XP_010911041.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    153   2e-40   
gb|EYU21104.1|  hypothetical protein MIMGU_mgv1a007738mg                153   2e-40   
ref|XP_006390051.1|  hypothetical protein EUTSA_v10018693mg             152   3e-40   
gb|EYU22689.1|  hypothetical protein MIMGU_mgv1a007366mg                151   3e-40   
ref|XP_002437448.1|  hypothetical protein SORBIDRAFT_10g027290          153   3e-40   
gb|EAZ14356.1|  hypothetical protein OsJ_04276                          151   3e-40   
gb|KJB37441.1|  hypothetical protein B456_006G204700                    151   3e-40   
gb|KFK42175.1|  hypothetical protein AALP_AA2G220800                    152   3e-40   
ref|XP_002265159.2|  PREDICTED: probable beta-1,3-galactosyltrans...    153   4e-40   
ref|XP_006434095.1|  hypothetical protein CICLE_v10001364mg             152   4e-40   
ref|XP_008802930.1|  PREDICTED: probable beta-1,3-galactosyltrans...    152   4e-40   
gb|KDO80824.1|  hypothetical protein CISIN_1g015683mg                   152   4e-40   
gb|KFK42176.1|  hypothetical protein AALP_AA2G220800                    152   4e-40   
gb|KDO80825.1|  hypothetical protein CISIN_1g015683mg                   152   5e-40   
ref|XP_004245304.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    152   5e-40   
ref|NP_001044974.1|  Os01g0877400                                       152   5e-40   
ref|XP_006434096.1|  hypothetical protein CICLE_v10001364mg             152   5e-40   
ref|XP_010910268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    152   5e-40   
ref|NP_174609.1|  putative beta-1,3-galactosyltransferase 8             152   5e-40   
ref|NP_564154.1|  putative beta-1,3-galactosyltransferase 5             152   5e-40   
ref|XP_006416240.1|  hypothetical protein EUTSA_v10009382mg             152   5e-40   
gb|EEC81181.1|  hypothetical protein OsI_24180                          152   6e-40   
ref|XP_010498661.1|  PREDICTED: probable beta-1,3-galactosyltrans...    152   6e-40   
ref|XP_009607565.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    152   6e-40   
ref|NP_001185130.1|  putative beta-1,3-galactosyltransferase 8          152   6e-40   
ref|XP_007039334.1|  Beta-1,3-galactosyltransferase 6 isoform 3         152   7e-40   
ref|XP_007131321.1|  hypothetical protein PHAVU_011G003800g             151   7e-40   
ref|XP_010459924.1|  PREDICTED: probable beta-1,3-galactosyltrans...    151   8e-40   
ref|XP_009777689.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    151   1e-39   
gb|EYU22688.1|  hypothetical protein MIMGU_mgv1a007366mg                151   1e-39   
ref|XP_010542535.1|  PREDICTED: probable beta-1,3-galactosyltrans...    151   1e-39   
gb|KJB37442.1|  hypothetical protein B456_006G204700                    151   1e-39   
ref|NP_001136834.1|  beta-1,3-galactosyltransferase sqv-2               151   1e-39   
ref|XP_010477453.1|  PREDICTED: probable beta-1,3-galactosyltrans...    151   1e-39   
ref|XP_009777688.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    151   1e-39   
emb|CDX88390.1|  BnaC06g38340D                                          150   1e-39   
ref|XP_010542528.1|  PREDICTED: probable beta-1,3-galactosyltrans...    151   1e-39   
gb|EYU22690.1|  hypothetical protein MIMGU_mgv1a007366mg                151   1e-39   
ref|XP_009137625.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    151   1e-39   
ref|XP_009106424.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    150   1e-39   
ref|XP_011095109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    151   1e-39   
ref|XP_009106423.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    150   1e-39   
ref|XP_006355190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    151   1e-39   



>ref|XP_009775718.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana sylvestris]
Length=404

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISVNQHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDRIKEVHRRCGEGE  LW AAF
Sbjct  365  NICVASFDWTCSGICRSVDRIKEVHRRCGEGENALWKAAF  404



>ref|XP_009775717.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=405

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYISVNQHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDRIKEVHRRCGEGE  LW AAF
Sbjct  366  NICVASFDWTCSGICRSVDRIKEVHRRCGEGENALWKAAF  405



>ref|XP_009598546.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
tomentosiformis]
Length=410

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL AWFIGLDVHH+DDRRLCCGTPPDCE KAQAG
Sbjct  311  YAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVHHIDDRRLCCGTPPDCEWKAQAG  370

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVHRRCGEGE  LW AA 
Sbjct  371  NICVASFDWTCSGICRSVDRLKEVHRRCGEGENALWKAAI  410



>gb|KDP22716.1| hypothetical protein JCGZ_01818 [Jatropha curcas]
Length=303

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  204  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  263

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGIC+  DRIKEVHRRCGEGE VLW+A F
Sbjct  264  NICVASFDWTCSGICKSADRIKEVHRRCGEGENVLWSATF  303



>emb|CDP10795.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISKDLATYISVNQHVLHKYANEDVSLGSWFIGLDVLHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDRIKEVHRRCGEGE  +W AAF
Sbjct  370  NICVASFDWTCSGICRSVDRIKEVHRRCGEGENAIWTAAF  409



>ref|XP_004251520.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=397

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYISANQHVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  298  YAISKDLATYISANQHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  357

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVHR CGEGE  LW AAF
Sbjct  358  NVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  397



>ref|XP_010313672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=395

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYISANQHVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  296  YAISKDLATYISANQHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  355

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVHR CGEGE  LW AAF
Sbjct  356  NVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  395



>ref|XP_010323831.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=406

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVH+RCGEGEK LW AA 
Sbjct  367  NVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  406



>ref|XP_004243473.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVH+RCGEGEK LW AA 
Sbjct  369  NVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  408



>ref|XP_009770915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=410

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS N+HVLHKYANEDVSL AWFIGLDVHH+DDRRLCCGTPPDCE KAQAG
Sbjct  311  YAISKDLASYISVNKHVLHKYANEDVSLGAWFIGLDVHHIDDRRLCCGTPPDCEWKAQAG  370

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVHRRCGEGE  LW AA 
Sbjct  371  NICVASFDWTCSGICRSVDRLKEVHRRCGEGENTLWKAAI  410



>ref|XP_006351966.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=397

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYISANQHVLHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  298  YAISKDLATYISANQHVLHKYTNEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  357

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVHR CGEGE  LW AAF
Sbjct  358  NVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  397



>ref|XP_006351967.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=395

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYISANQHVLHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  296  YAISKDLATYISANQHVLHKYTNEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  355

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVHR CGEGE  LW AAF
Sbjct  356  NVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  395



>ref|XP_006592811.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Glycine max]
Length=371

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  272  YAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  331

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  +RIKEVH+RCGEGEK LWNA+F
Sbjct  332  NVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  371



>ref|XP_009624798.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X3 [Nicotiana tomentosiformis]
Length=365

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  266  YAISKDLASYISVNQHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  325

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDRIKEVHR CGEGE  LW AAF
Sbjct  326  NICVASFDWTCSGICRSVDRIKEVHRHCGEGENALWKAAF  365



>gb|KDO54673.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=303

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  204  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  263

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  264  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  303



>ref|XP_006447567.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 gb|ESR60807.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=303

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  204  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  263

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  264  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  303



>ref|XP_006375531.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53328.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=303

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  204  YAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  263

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW A F
Sbjct  264  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  303



>ref|XP_007215470.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16669.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=404

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A+F
Sbjct  365  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  404



>ref|XP_007215471.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16670.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=407

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A+F
Sbjct  368  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  407



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC   DRIKEVHRRCGEGE VLWN+AF
Sbjct  366  NICVASFDWSCSGICNSADRIKEVHRRCGEGETVLWNSAF  405



>ref|XP_002524194.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF38209.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=374

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  275  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  334

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  335  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  374



>ref|XP_003543389.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN36530.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKYANEDVSL +WFIGLDV+H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVNHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  +RIKEVH+RCGEGEK LWNA+F
Sbjct  368  NVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  407



>ref|XP_009624796.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana tomentosiformis]
Length=404

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLASYISVNQHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDRIKEVHR CGEGE  LW AAF
Sbjct  365  NICVASFDWTCSGICRSVDRIKEVHRHCGEGENALWKAAF  404



>ref|XP_009624797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana tomentosiformis]
Length=402

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  303  YAISKDLASYISVNQHVLHKYTNEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDRIKEVHR CGEGE  LW AAF
Sbjct  363  NICVASFDWTCSGICRSVDRIKEVHRHCGEGENALWKAAF  402



>ref|XP_006366586.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=408

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVLHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVH+RCGEGEK LW AA 
Sbjct  369  NVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  408



>ref|XP_006366587.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=406

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVLHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+KEVH+RCGEGEK LW AA 
Sbjct  367  NVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  406



>ref|XP_010675728.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  300  YAISRDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  359

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSG+C+ V+R+KEVHRRCGEGEK LW+A F
Sbjct  360  NVCVASFDWTCSGVCKSVERMKEVHRRCGEGEKALWSATF  399



>ref|XP_003540300.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoformX1 
[Glycine max]
 gb|KHN44874.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  +RIKEVH+RCGEGEK LWNA+F
Sbjct  368  NVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  407



>gb|KJB80507.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=405

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  366  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW A F
Sbjct  366  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  405



>gb|KJB80505.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=404

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  404



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW A F
Sbjct  369  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  408



>ref|XP_006592810.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=383

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  284  YAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  343

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  +RIKEVH+RCGEGEK LWNA+F
Sbjct  344  NVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  383



>ref|XP_010484744.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=405

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  366  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  405



>ref|XP_008342011.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGIC+  +RIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWTCSGICKSAERIKEVHRRCGEGENALWSATF  404



>ref|XP_011463344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=404

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A+F
Sbjct  365  NVCVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  404



>ref|XP_010475189.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=409

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  370  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  409



>ref|XP_008342010.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGIC+  +RIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWTCSGICKSAERIKEVHRRCGEGENALWSATF  407



>ref|XP_010484738.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=408

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  369  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  408



>gb|KDO54670.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=407

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  407



>ref|XP_006304048.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
 gb|EOA36946.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
Length=303

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE K QAG
Sbjct  204  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKTQAG  263

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  264  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  303



>ref|XP_010475190.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=406

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  367  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  406



>ref|XP_006447568.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 ref|XP_006469678.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR60808.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=407

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  407



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLATYISLNQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR VDRIKEVHRRCGEGE  LWNA+F
Sbjct  369  NICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNASF  408



>ref|XP_004287949.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A+F
Sbjct  368  NVCVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  407



>ref|XP_006469679.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
Length=405

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  366  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_006469680.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
Length=404

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  404



>gb|KDO54671.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=405

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  366  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  405



>gb|KDO54672.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=404

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  404



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW A F
Sbjct  369  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  408



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW A F
Sbjct  366  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  405



>ref|XP_011100272.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLASYISVNQHVLHKYANEDVSLGSWFIGLDVRHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR VDRIKEVHRRCGEGE  +W A F
Sbjct  366  NVCVASFDWSCSGICRSVDRIKEVHRRCGEGEDAIWKAVF  405



>ref|NP_001077462.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 sp|A8MRC7.1|B3GT2_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AEE27798.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38970.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=407

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  368  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  407



>ref|XP_002892271.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68530.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  368  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  407



>ref|NP_172009.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AAK63859.1|AF389287_1 At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AAB71461.1| Similar to Sequence 10 from patent 5477002 (gb|1253956) [Arabidopsis 
thaliana]
 gb|AAM47315.1| At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AEE27797.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
Length=404

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  365  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  404



>ref|XP_010457599.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X4 [Camelina sativa]
Length=405

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  366  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  405



>ref|XP_010046417.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW88779.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
 gb|KCW88780.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=407

 Score =   183 bits (465),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR V+RIKEVHRRCGEGE  LW+A F
Sbjct  367  NICVASFDWSCSGICRSVERIKEVHRRCGEGENALWSATF  406



>ref|XP_010457598.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Camelina sativa]
Length=408

 Score =   184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  369  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  408



>ref|XP_010457597.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=438

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  339  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  398

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  399  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  438



>ref|XP_010457596.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=441

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  342  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  401

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGEK LW+A F
Sbjct  402  NICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  441



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score =   183 bits (465),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISKDLATYISINQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR VDRIKEVHRRCGEGE  LWNA F
Sbjct  370  NICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNAVF  409



>ref|XP_008229956.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Prunus 
mume]
Length=407

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLH+YANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHRYANEDVSLGAWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A+F
Sbjct  368  NICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  407



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISKDLATYISINQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR VDRIKEVHRRCGEGE  LWNA F
Sbjct  370  NICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNAVF  409



>gb|KFK42855.1| hypothetical protein AALP_AA1G047700 [Arabis alpina]
Length=408

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  369  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  408



>ref|XP_006418057.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
 gb|ESQ36410.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
Length=407

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  407



>ref|XP_010557003.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Tarenaya hassleriana]
Length=405

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW++ F
Sbjct  366  NICVASFDWTCSGICRSADRIKEVHRRCGEGETALWSSTF  405



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>ref|XP_004159203.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2-like [Cucumis sativus]
Length=407

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>gb|KHF99242.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=404

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS N+HVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLASYISINRHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWTCSGICRSADRIKEVHRRCGEGETALWSATF  404



>ref|XP_009782227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=398

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LHKYANEDV+L +WFIGLDV HVDDR+LCCGTPPDCE KAQAG
Sbjct  299  YAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHVDDRKLCCGTPPDCELKAQAG  358

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+RIKEVHRRCGEGE  LW+AAF
Sbjct  359  NICVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAAF  398



>ref|XP_007149975.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
 gb|ESW21969.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
Length=407

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  +RIKEVH+RCGEGEK LW+A+F
Sbjct  368  NVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWSASF  407



>gb|KEH29682.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=349

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQ+VLHKYANEDVS+ AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  250  YAISNDLATYISTNQNVLHKYANEDVSIGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  309

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A+F
Sbjct  310  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  349



>ref|XP_009397181.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYISANQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYISANQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC   +RIKEVHRRCGEGEK +W A F
Sbjct  366  NICVASFDWSCSGICNSAERIKEVHRRCGEGEKTVWKAVF  405



>ref|XP_010557001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557002.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=408

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGEGE  LW + F
Sbjct  369  NICVASFDWTCSGICRSADRIKEVHRRCGEGETALWRSTF  408



>gb|EYU34029.1| hypothetical protein MIMGU_mgv1a007633mg [Erythranthe guttata]
Length=401

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHK+ANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  302  YAISKDLASYISVNQHVLHKFANEDVSLGSWFIGLDVKHIDDRRLCCGTPPDCEWKAQAG  361

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR VDRIKEVHRRCGEGE  +W A F
Sbjct  362  NICVASFDWSCSGICRSVDRIKEVHRRCGEGEDAVWKATF  401



>ref|XP_004244109.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Solanum 
lycopersicum]
Length=408

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLATYISLNQHVLHKYVNEDVSLGSWLIGLDVEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR VDRI EVHRRCGEGE  LWNA+F
Sbjct  369  NICVASFDWSCSGICRSVDRIMEVHRRCGEGENALWNASF  408



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  312  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  371

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +R++EVHRRCGEGE  LW+A F
Sbjct  372  NICVASFDWSCSGICRSAERVREVHRRCGEGENALWSATF  411



>gb|EYU27344.1| hypothetical protein MIMGU_mgv1a007546mg [Erythranthe guttata]
Length=404

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D ATYIS NQH LHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISRDLATYISKNQHFLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC   DRIKEVHRRCGEGE  LWN AF
Sbjct  365  NVCVASFDWSCSGICNSADRIKEVHRRCGEGEHTLWNTAF  404



>ref|XP_010089999.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB38730.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=404

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLH+YANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHRYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR V+R+KEVHRRCGEGE  LW+A F
Sbjct  365  NVCVASFDWSCSGICRSVERMKEVHRRCGEGENALWSAEF  404



>ref|XP_009361001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=365

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL +WFIGLDV  VDDRRLCCGTPPDCE KAQAG
Sbjct  266  YAISKDLATYISINQHVLHKYVNEDVSLGSWFIGLDVEQVDDRRLCCGTPPDCEWKAQAG  325

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVHRRCGEGE  LWNAAF
Sbjct  326  NVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAAF  365



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLH+YANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  312  YAISKDLATYISINQHVLHRYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  371

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RI+EVHRRCGEGE  LW+A F
Sbjct  372  NICVASFDWSCSGICRSAERIREVHRRCGEGENALWSAIF  411



>ref|XP_008226884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Prunus mume]
Length=404

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGIC+  +RIKEVHRRCGEGE  LWNA F
Sbjct  365  NVCVASFDWTCSGICKSSERIKEVHRRCGEGENALWNAVF  404



>ref|XP_008226885.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Prunus mume]
Length=403

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  304  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  363

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGIC+  +RIKEVHRRCGEGE  LWNA F
Sbjct  364  NVCVASFDWTCSGICKSSERIKEVHRRCGEGENALWNAVF  403



>ref|XP_004487414.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS N+HVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLAAYISTNKHVLHKYANEDVSLGAWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  +RIKEVH++CGEGEK LW+A+F
Sbjct  369  NVCVASFDWTCSGICRSAERIKEVHKKCGEGEKALWSASF  408



>ref|XP_009353286.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=405

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  404



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGVDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGICR  +RIKEVH+RCGEGEK LW+A F
Sbjct  365  NVCAASFDWSCSGICRSAERIKEVHQRCGEGEKALWSAVF  404



>emb|CDP05735.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDR+LCCGTPPDCE KAQAG
Sbjct  304  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRQLCCGTPPDCEWKAQAG  363

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGIC  V+RIKEVHRRCGEGE  LWNA F
Sbjct  364  NICVASFDWRCSGICNSVERIKEVHRRCGEGENALWNAVF  403



>ref|XP_009353285.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=408

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  407



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATY+S NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISNDLATYVSINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ VDRIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWSCSGICKSVDRIKEVHRRCGEGENALWSAEF  404



>gb|KEH29683.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=407

 Score =   181 bits (458),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQ+VLHKYANEDVS+ AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISNDLATYISTNQNVLHKYANEDVSIGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A+F
Sbjct  368  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  407



>ref|XP_004167799.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=187

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  88   YAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  147

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+  +R+KEVHRRCGEGE  L +A F
Sbjct  148  NICIASFDWSCSGICKSAERMKEVHRRCGEGENALLSAVF  187



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQ+VLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE VLW+A+F
Sbjct  367  NICVASFDWSCSGICRSAERIKEVHRRCGEGENVLWSASF  406



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQ+VLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE VLW+A+F
Sbjct  367  NICVASFDWSCSGICRSAERIKEVHRRCGEGENVLWSASF  406



>ref|XP_002529902.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF32456.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=238

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  139  YAISNDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  198

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+RIKEVH RCGEGE  LW+A F
Sbjct  199  NICVASFDWSCSGICKSVERIKEVHGRCGEGENALWSAEF  238



>ref|XP_010522341.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522343.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQ+VLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLASYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW +AF
Sbjct  369  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWRSAF  408



>ref|XP_010522344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQ+VLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLASYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW +AF
Sbjct  366  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWRSAF  405



>ref|XP_009361000.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=403

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKY NEDVSL +WFIGLDV  VDDRRLCCGTPPDCE KAQAG
Sbjct  304  YAISKDLATYISINQHVLHKYVNEDVSLGSWFIGLDVEQVDDRRLCCGTPPDCEWKAQAG  363

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVHRRCGEGE  LWNAAF
Sbjct  364  NVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAAF  403



>ref|XP_008379640.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATY+S NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYVSINQHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVHRRCGEGE  LW+A F
Sbjct  365  NICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  404



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVH+RCGEGE  LW+A F
Sbjct  366  NICVASFDWSCSGICKSAERIKEVHQRCGEGEHALWSAVF  405



>ref|XP_008379639.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATY+S NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYVSINQHVLHKYANEDVSLGSWFIGLDVQHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVHRRCGEGE  LW+A F
Sbjct  368  NICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  407



>ref|XP_010657202.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Vitis vinifera]
Length=405

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLARYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LWNA F
Sbjct  366  NACVASFDWSCSGICRSSERIKEVHRRCGEGENALWNAVF  405



>ref|XP_010657203.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Vitis vinifera]
Length=404

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLARYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LWNA F
Sbjct  365  NACVASFDWSCSGICRSSERIKEVHRRCGEGENALWNAVF  404



>ref|XP_002268282.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Vitis vinifera]
 emb|CBI28801.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLARYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LWNA F
Sbjct  368  NACVASFDWSCSGICRSSERIKEVHRRCGEGENALWNAVF  407



>ref|XP_006475058.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
 ref|XP_006475059.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X4 [Citrus sinensis]
 gb|KDO62742.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=367

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  268  YAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  327

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +R+KEVHRRCGEGE  LW+AAF
Sbjct  328  NVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  367



>emb|CDY12206.1| BnaC04g12360D [Brassica napus]
Length=409

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+Y+S NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISRDLASYVSINQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGE EK +W A F
Sbjct  370  NICVASFDWTCSGICRSADRIKEVHRRCGEPEKAIWKATF  409



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVHRRCGEGE  LWNA F
Sbjct  365  NVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAVF  404



>ref|XP_009119197.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Brassica rapa]
Length=411

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  312  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  371

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DR+KEVHRRC EGE  LW+A F
Sbjct  372  NICVASFDWTCSGICRSADRLKEVHRRCSEGENALWSATF  411



>ref|XP_009119198.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Brassica rapa]
Length=408

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DR+KEVHRRC EGE  LW+A F
Sbjct  369  NICVASFDWTCSGICRSADRLKEVHRRCSEGENALWSATF  408



>emb|CDY46836.1| BnaA10g03200D [Brassica napus]
Length=407

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DR+KEVHRRC EGE  LW+A F
Sbjct  368  NICVASFDWTCSGICRSADRLKEVHRRCSEGENTLWSATF  407



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATY+S NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYMSINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVH+RCGEGE  LW+A F
Sbjct  366  NVCVASFDWSCSGICKSAERIKEVHQRCGEGENALWSAVF  405



>emb|CDY49507.1| BnaC05g03190D [Brassica napus]
Length=410

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIG+DV H+DDRRLCCGTPPDCE KAQAG
Sbjct  311  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAG  370

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DR+KEVHRRC EGE  LW+A F
Sbjct  371  NICVASFDWTCSGICRSADRLKEVHRRCSEGENALWSATF  410



>emb|CAN63417.1| hypothetical protein VITISV_007689 [Vitis vinifera]
Length=373

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  274  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  333

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RI+EVHRRCGEGE  +W+A F
Sbjct  334  NICVASFDWSCSGICRSSERIREVHRRCGEGENAVWSAVF  373



>ref|XP_010923856.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=412

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  313  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  372

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RI++VHRRCGEGE  LW A F
Sbjct  373  NTCVASFDWSCSGICKSAERIRDVHRRCGEGENALWGANF  412



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQ+VLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A+F
Sbjct  368  NICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  407



>ref|XP_008808431.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2 [Phoenix dactylifera]
Length=411

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  312  YAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  371

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RI+EVHRRCGEG+  LW+A F
Sbjct  372  NTCVASFDWSCSGICKSAERIREVHRRCGEGKNALWSANF  411



>ref|XP_010063019.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Eucalyptus grandis]
 gb|KCW70192.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=403

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  304  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  363

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+R+K VHRRCGEGE VLW+ AF
Sbjct  364  NVCVASFDWSCSGICKSVERMKVVHRRCGEGENVLWSTAF  403



>ref|XP_010063020.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW70193.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=402

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  303  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+R+K VHRRCGEGE VLW+ AF
Sbjct  363  NVCVASFDWSCSGICKSVERMKVVHRRCGEGENVLWSTAF  402



>ref|XP_011048789.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLAKYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  366  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_006452382.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 ref|XP_006475056.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR65622.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|KDO62740.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=407

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +R+KEVHRRCGEGE  LW+AAF
Sbjct  368  NVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  407



>ref|XP_006475057.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO62741.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=406

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +R+KEVHRRCGEGE  LW+AAF
Sbjct  367  NVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  406



>ref|XP_010104592.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXC01255.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=420

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  321  YAISNDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  380

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+++F
Sbjct  381  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSSSF  420



>ref|XP_011048788.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISKDLAKYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  369  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  408



>gb|EPS73703.1| hypothetical protein M569_01053, partial [Genlisea aurea]
Length=221

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  123  YAISRDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  182

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAA  361
            N CVAS DW+CSGIC   DRIKEVHRRCGEG+  LWN++
Sbjct  183  NACVASFDWSCSGICNSADRIKEVHRRCGEGDTALWNSS  221



>ref|XP_009143989.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Brassica rapa]
Length=406

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISRDLASYISINQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGE E  +W A F
Sbjct  367  NICVASFDWTCSGICRSADRIKEVHRRCGEPENAIWKATF  406



>ref|XP_002302876.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
 gb|EEE82149.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
Length=405

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLAKYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DRIKEVHRRCGEGE  LW+A F
Sbjct  366  NICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_009143988.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Brassica rapa]
Length=409

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISRDLASYISINQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGE E  +W A F
Sbjct  370  NICVASFDWTCSGICRSADRIKEVHRRCGEPENAIWKATF  409



>emb|CDY48266.1| BnaA05g10880D [Brassica napus]
Length=409

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISRDLASYISINQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVHRRCGE E  +W A F
Sbjct  370  NICVASFDWTCSGICRSADRIKEVHRRCGEPENAIWKATF  409



>ref|XP_004982530.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=405

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YI+ NQHVLHKYANEDVSL AWFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLASYIALNQHVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  DRIKEVH+RCGE E  +WNA F
Sbjct  366  NVCVASFDWSCSGICKSADRIKEVHQRCGESENAIWNAKF  405



>ref|NP_001141034.1| hypothetical protein [Zea mays]
 gb|ACF85234.1| unknown [Zea mays]
 gb|AFW68304.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
 gb|AFW68305.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=361

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YI+ NQHVLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  262  YAISKDLASYIALNQHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  321

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  DRIKEVH+RCGE E  +WNA F
Sbjct  322  NACVASFDWSCSGICKSADRIKEVHQRCGESENAIWNAEF  361



>ref|XP_008359264.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=411

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  312  YAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  371

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVH+RCGEGE  LWNAAF
Sbjct  372  NVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  411



>ref|XP_008359262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=412

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  313  YAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  372

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVH+RCGEGE  LWNAAF
Sbjct  373  NVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  412



>ref|XP_009612460.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=398

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LHKYANEDV+L +WFIGLDV H+DDR+LCCGTPPDCE KAQAG
Sbjct  299  YAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHIDDRKLCCGTPPDCELKAQAG  358

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+RIKEVH RCGEGE  LW+A F
Sbjct  359  NICVASFDWSCSGICKSVERIKEVHSRCGEGENALWSAIF  398



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RI+EVHRRCGEGE  +W+A F
Sbjct  366  NICVASFDWSCSGICRSSERIREVHRRCGEGENAVWSAVF  405



>ref|XP_006410375.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
 gb|ESQ51828.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
Length=408

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISTNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A F
Sbjct  369  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKATF  408



>ref|XP_008385877.1| PREDICTED: probable beta-1,3-galactosyltransferase 2, partial 
[Malus domestica]
Length=407

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVH+RCGEGE  LWNAAF
Sbjct  368  NVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  407



>ref|XP_009338706.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=411

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  312  YAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  371

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVH+RCGEGE  LWNAAF
Sbjct  372  NVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  411



>ref|XP_009338707.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=410

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A YIS NQHVLHKYANEDVSL +WFIGLDV  +DDRRLCCGTPPDCE KAQAG
Sbjct  311  YAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQIDDRRLCCGTPPDCEWKAQAG  370

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  +RIKEVH+RCGEGE  LWNAAF
Sbjct  371  NVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  410



>ref|XP_009398227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  314  YAISKDLATYISMNQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  373

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC   +RIKEVHRRCGEG+  L NA F
Sbjct  374  NICVASFDWSCSGICNSAERIKEVHRRCGEGKNALLNAVF  413



>ref|XP_004172360.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQH+LHKYANEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+  +RIKEVHRRCGEGE VLW+A F
Sbjct  369  NICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>ref|XP_004151891.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQH+LHKYANEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+  +RIKEVHRRCGEGE VLW+A F
Sbjct  369  NICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>gb|KGN63249.1| hypothetical protein Csa_2G418850 [Cucumis sativus]
Length=409

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQH+LHKYANEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+  +RIKEVHRRCGEGE VLW+A F
Sbjct  370  NICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  409



>ref|XP_008455884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=408

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQH+LHKYANEDVSL +W IGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+  +RIKEVHRRCGEGE VLW+A F
Sbjct  369  NICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>ref|XP_004515096.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQ+VLHKYANEDVS+ AWFIGLDV H+DDRR+CCGTPPDCE KAQAG
Sbjct  309  YAISNDLATYISTNQNVLHKYANEDVSIGAWFIGLDVEHIDDRRICCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVH+RCGEGE  LW+A+F
Sbjct  369  NICVASFDWSCSGICRSAERIKEVHKRCGEGENALWSASF  408



>ref|XP_006365959.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=395

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LHKYANEDV+L +WFIGLDV H+DDR++CCGTPPDCE KAQ G
Sbjct  296  YAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHIDDRKMCCGTPPDCEWKAQTG  355

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ VDRIKEVHRRCGEGE  LW+  F
Sbjct  356  NICVASFDWSCSGICKSVDRIKEVHRRCGEGENALWSTVF  395



>ref|XP_009408655.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D A YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISNDLAAYISMNQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGIC   +RI EVHRRCGEGEK++W+A F
Sbjct  367  NICVASFDWTCSGICNSAERINEVHRRCGEGEKMVWDAVF  406



>ref|XP_011461040.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=406

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D ATYIS NQHVLHKY NEDVSL +W +GLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISRDLATYISINQHVLHKYVNEDVSLGSWLLGLDVEHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+RIKEVHRRCGEGE  LW+A F
Sbjct  367  NVCVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAVF  406



>ref|XP_004294404.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D ATYIS NQHVLHKY NEDVSL +W +GLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISRDLATYISINQHVLHKYVNEDVSLGSWLLGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+RIKEVHRRCGEGE  LW+A F
Sbjct  368  NVCVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAVF  407



>ref|XP_008681412.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW68303.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=416

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YI+ NQHVLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  317  YAISKDLASYIALNQHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  376

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+  DRIKEVH+RCGE E  +WNA F
Sbjct  377  NACVASFDWSCSGICKSADRIKEVHQRCGESENAIWNAEF  416



>ref|XP_006294322.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
 gb|EOA27220.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
Length=408

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISLNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A F
Sbjct  369  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  408



>ref|NP_180802.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 sp|Q9ZV71.1|B3GT3_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAC69935.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42172.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08684.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 gb|AHL38822.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=409

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISRDLASYISLNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A F
Sbjct  370  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  409



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQ VLHKYANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  307  YAISNDLATYISINQDVLHKYANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +RIKEVHRRCGEGE  LW+A+F
Sbjct  367  NICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  406



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+  +R+KEVHRRCGEGE  L +A F
Sbjct  368  NICIASFDWSCSGICKSAERMKEVHRRCGEGENALLSAVF  407



>ref|XP_002879388.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55647.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YI+ NQHVLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  310  YAISRDLASYIALNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A F
Sbjct  370  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  409



>ref|XP_010469586.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQ VLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A+F
Sbjct  369  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKASF  408



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  313  YAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  372

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+  +R+KEVHRRCGEGE  L +A F
Sbjct  373  NICIASFDWSCSGICKSAERMKEVHRRCGEGENALLSAVF  412



>ref|XP_010469587.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQ VLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A+F
Sbjct  366  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKASF  405



>ref|XP_009399227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS + ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDR+LCCGTPPDCE KA+AG
Sbjct  302  YAISNELATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRKLCCGTPPDCEGKARAG  361

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGIC  VDRIKEVHRRCGE E  +WNA F
Sbjct  362  NTCVASFDWNCSGICDSVDRIKEVHRRCGENESAIWNAVF  401



>ref|XP_010413995.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQ VLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A F
Sbjct  369  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  408



>ref|XP_010510018.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Camelina 
sativa]
Length=408

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQ VLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  309  YAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A F
Sbjct  369  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  408



>ref|XP_010413996.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQ VLHKYANEDV+L AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  306  YAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  DRIKEVH+RCGE E  +W A F
Sbjct  366  NICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  405



>gb|KDO78243.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=317

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS NQH+LHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQ G
Sbjct  218  YALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLG  277

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
              CVA+ DW CSGIC+ V+RIKEVH  CGEGE  LW A+F
Sbjct  278  KTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  317



>ref|XP_007153952.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
 gb|ESW25946.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
Length=380

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ VLHKYANEDVSL +WFIGLDV HVDDRR+CCGTPPDCE KAQAG
Sbjct  281  YAISKDLATYISINQDVLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAG  340

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGICR V+R+KEVH RCGE E  LW+AA 
Sbjct  341  NVCVASFDWKCSGICRSVERMKEVHLRCGEDENALWSAAL  380



>gb|KDO78242.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=359

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS NQH+LHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQ G
Sbjct  260  YALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLG  319

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
              CVA+ DW CSGIC+ V+RIKEVH  CGEGE  LW A+F
Sbjct  320  KTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  359



>ref|XP_002464309.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
 gb|EER91307.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
Length=409

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YI+ NQHVLHKYANEDVSL +WFIGLDV HVDDRRLCCGT PDCE KAQAG
Sbjct  310  YAISKDLASYIALNQHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTTPDCEWKAQAG  369

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DRIKEVH+RCGE E  +WNA F
Sbjct  370  NVCAASFDWSCSGICKSADRIKEVHQRCGESENAIWNAKF  409



>ref|XP_006449734.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
 gb|ESR62974.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
Length=343

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQH+LHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQ G
Sbjct  244  YAISNDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLG  303

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
              CVA+ DW CSGIC+ V+RIKEVH  CGEGE  LW A+F
Sbjct  304  KTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  343



>ref|XP_010655390.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI23239.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISK+ ATYIS N+HVLHKYANEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KA+AG
Sbjct  309  YAISKNLATYISINRHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAEAG  368

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  +R+K+VH+RCGEG+  LW+A F
Sbjct  369  NVCVASFDWSCSGICRSSERMKDVHQRCGEGKNALWSAVF  408



>ref|XP_006467430.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO78236.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=396

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS NQH+LHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQ G
Sbjct  297  YALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
              CVA+ DW CSGIC+ V+RIKEVH  CGEGE  LW A+F
Sbjct  357  KTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  396



>ref|XP_002518474.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43861.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=388

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQHVLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE K Q G
Sbjct  289  YAISKDLATYISVNQHVLHKYANEDVSLGSWFIGLDVDHVDDRRLCCGTPPDCEWKTQLG  348

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC+ V+RI EVH+RCGE E  LW A F
Sbjct  349  NVCAASFDWKCSGICKSVERIMEVHKRCGEDENALWTATF  388



>ref|XP_006467429.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|KDO78235.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=397

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS NQH+LHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQ G
Sbjct  298  YALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLG  357

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
              CVA+ DW CSGIC+ V+RIKEVH  CGEGE  LW A+F
Sbjct  358  KTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  397



>gb|KHN03478.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=334

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D ATYIS NQ +LHKYANEDVSL +WFIGLDV HVDDRR+CCGTPPDCE KAQAG
Sbjct  235  YAISQDLATYISINQGMLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAG  294

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGICR V+R+KEVH+RCGE E  LW+  F
Sbjct  295  NICVASFDWKCSGICRSVERMKEVHQRCGEDENALWSGTF  334



>gb|KJB80508.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=398

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGE  388
            N CVAS DWTCSGICR  DRIKEVHRRCGE
Sbjct  365  NICVASFDWTCSGICRSADRIKEVHRRCGE  394



>ref|XP_003550487.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Glycine max]
 ref|XP_006600308.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=374

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D ATYIS NQ +LHKYANEDVSL +WFIGLDV HVDDRR+CCGTPPDCE KAQAG
Sbjct  275  YAISQDLATYISINQGMLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAG  334

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGICR V+R+KEVH+RCGE E  LW+  F
Sbjct  335  NICVASFDWKCSGICRSVERMKEVHQRCGEDENALWSGTF  374



>ref|XP_006650268.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=405

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL AWFIGLDV HVDDRRLCCGT PDCE KAQAG
Sbjct  306  YAISKDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTQPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DR+KEVH+RCGE    +WNA F
Sbjct  366  NVCAASFDWSCSGICKSADRMKEVHQRCGENGSAIWNAKF  405



>ref|XP_006449733.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
 gb|ESR62973.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
Length=407

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS D ATYIS NQH+LHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQ G
Sbjct  308  YAISNDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
              CVA+ DW CSGIC+ V+RIKEVH  CGEGE  LW A+F
Sbjct  368  KTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  407



>gb|EMS64796.1| putative beta-1,3-galactosyltransferase 2 [Triticum urartu]
Length=400

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVS+ AWFIG+D  HVDDRRLCCGT PDCE KAQAG
Sbjct  301  YAISKDLASYISINQHVLHKYANEDVSIGAWFIGVDAEHVDDRRLCCGTHPDCERKAQAG  360

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DRIKEVHRRCGE    +WNA F
Sbjct  361  NVCAASFDWSCSGICKSADRIKEVHRRCGESANAIWNATF  400



>ref|NP_001045990.1| Os02g0164300 [Oryza sativa Japonica Group]
 dbj|BAF07904.1| Os02g0164300, partial [Oryza sativa Japonica Group]
Length=182

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  83   YAISKDLATYISINRHVLHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  142

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  143  NTCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  182



>ref|NP_001050543.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|AAT76370.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 gb|ABF97265.1| Galactosyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12457.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|EAY90748.1| hypothetical protein OsI_12348 [Oryza sativa Indica Group]
 gb|EAZ27579.1| hypothetical protein OsJ_11528 [Oryza sativa Japonica Group]
Length=406

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL AWFIGLDV HVDDRRLCCGT PDCE KAQAG
Sbjct  307  YAISKDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTQPDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DR+KEVH+RCGE +  +W+A F
Sbjct  367  NVCAASFDWSCSGICKSADRMKEVHQRCGENDSAIWSAKF  406



>gb|KDP20741.1| hypothetical protein JCGZ_21212 [Jatropha curcas]
Length=386

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ VLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQ G
Sbjct  287  YAISKDLATYISINQRVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQLG  346

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC+ V+RI EVH+RCGE E  LW A F
Sbjct  347  NICAASFDWKCSGICKSVERIMEVHKRCGEDENALWTARF  386



>gb|KJB57752.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=373

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYI  NQ+VLHKYANEDVSL AWFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  266  YAISKDLATYIFINQNVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  325

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGICR V+RI EVH RCGE +  LW+A F
Sbjct  326  NICAASFDWRCSGICRSVERIMEVHERCGEDKNALWSANF  365



>gb|EPS64555.1| hypothetical protein M569_10226 [Genlisea aurea]
Length=393

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  294  YAISKDLATYISINQHILHKYANEDVSLGSWFIGLEVEHIDDRDMCCGTPPDCEWKAQAG  353

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N CVAS DW+CSGIC+ VD+I+ VH++CGEGE  LWNA
Sbjct  354  NLCVASFDWSCSGICKSVDKIQFVHQQCGEGEDALWNA  391



>ref|XP_007026088.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY28710.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=415

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ+VLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGICR V+RI EVH RCGE +  LW+  F
Sbjct  368  NICVASFDWRCSGICRSVERIIEVHERCGEDKNALWSTNF  407



>gb|KHG10854.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=418

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYI  NQ VLHKYANEDVSL +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  301  YAISKDLATYILINQDVLHKYANEDVSLGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  360

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGICR V+RI EVH RCGE +  LW A F
Sbjct  361  NICVASFDWKCSGICRSVERIMEVHERCGEDKNALWTANF  400



>ref|XP_007020793.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY12318.1| Galactosyltransferase family protein [Theobroma cacao]
Length=406

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  308  YAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAG  366

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGIC+ V+R+KEVHRRCGEG+  LW+AAF
Sbjct  367  NICVASFDWTCSGICKSVERMKEVHRRCGEGKNALWSAAF  406



>ref|XP_010092200.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB50426.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=407

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SK+ ATYIS NQHVLHKYANEDVS+ +WFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  308  YAVSKELATYISINQHVLHKYANEDVSVGSWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGIC  V+R+ EVHRRC E E  LW+ +F
Sbjct  368  NMCVASFDWRCSGICSSVERMAEVHRRCSEDENTLWSESF  407



>gb|KJB57747.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=406

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYI  NQ+VLHKYANEDVSL AWFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  299  YAISKDLATYIFINQNVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  358

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGICR V+RI EVH RCGE +  LW+A F
Sbjct  359  NICAASFDWRCSGICRSVERIMEVHERCGEDKNALWSANF  398



>ref|XP_010652984.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Vitis 
vinifera]
Length=396

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR LCCGTPPDCE KAQAG
Sbjct  297  YAISKDLATYISVNQPILHKYANEDVSLGAWFIGLEVEHIDDRNLCCGTPPDCEWKAQAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+RIK+VH RCGEG+  +W+  F
Sbjct  357  NVCVASFDWSCSGICKSVERIKDVHARCGEGDGAIWSTPF  396



>dbj|BAJ89733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVS+ AWFIG+D  HVDDRRLCCGT PDCE KAQ+G
Sbjct  300  YAISKDLASYISINQHVLHKYANEDVSIGAWFIGVDAEHVDDRRLCCGTHPDCERKAQSG  359

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DRIKEVHRRCGE    +WNA F
Sbjct  360  NVCAASFDWSCSGICKSADRIKEVHRRCGESANAIWNATF  399



>dbj|BAJ89822.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVS+ AWFIG+D  HVDDRRLCCGT PDCE KAQ+G
Sbjct  300  YAISKDLASYISINQHVLHKYANEDVSIGAWFIGVDAEHVDDRRLCCGTHPDCERKAQSG  359

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DRIKEVHRRCGE    +WNA F
Sbjct  360  NVCAASFDWSCSGICKSADRIKEVHRRCGESANAIWNATF  399



>ref|XP_002269415.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 ref|XP_010652983.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 emb|CBI21654.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR LCCGTPPDCE KAQAG
Sbjct  298  YAISKDLATYISVNQPILHKYANEDVSLGAWFIGLEVEHIDDRNLCCGTPPDCEWKAQAG  357

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+RIK+VH RCGEG+  +W+  F
Sbjct  358  NVCVASFDWSCSGICKSVERIKDVHARCGEGDGAIWSTPF  397



>ref|NP_001183433.1| uncharacterized protein LOC100501859 [Zea mays]
 gb|ACR34699.1| unknown [Zea mays]
 gb|ACR36777.1| unknown [Zea mays]
Length=200

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS N+H+LHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  101  YAVSKDLATYISINKHILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  160

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  161  NVCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  200



>ref|XP_003596979.1| hypothetical protein MTR_2g088270 [Medicago truncatula]
 gb|AES67230.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=402

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYI+ N++VLHKYANEDVSL AWFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  304  YAVSKDLATYIATNKNVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGTT-DCEWKAQAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR  +RIKEVH++CGEGEK LW+A+F
Sbjct  363  NACVASFDWTCSGICRSAERIKEVHKKCGEGEKALWSASF  402



>gb|EMS67042.1| putative beta-1,3-galactosyltransferase 2 [Triticum urartu]
Length=357

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  258  YAISKDLATYISLNKHVLHKYVNEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  317

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC  V+ I+ VH +CGE EK LW A+F
Sbjct  318  NTCAASFDWRCSGICNTVENIQGVHNKCGESEKALWTASF  357



>gb|EMT25658.1| Putative beta-1,3-galactosyltransferase 2 [Aegilops tauschii]
Length=400

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVS+ AWFIG+D  HVDDRRLCCGT P+CE KAQAG
Sbjct  301  YAISKDLASYISINQHVLHKYANEDVSIGAWFIGVDAEHVDDRRLCCGTHPECERKAQAG  360

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DRIKEVHRRCGE    +WNA F
Sbjct  361  NVCAASFDWSCSGICKSADRIKEVHRRCGESANAIWNATF  400



>ref|XP_006452383.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65623.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=313

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  204  YAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  263

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEK  379
            N CVAS DW+CSGICR  +R+KEVHRRCGEG K
Sbjct  264  NVCVASFDWSCSGICRSAERMKEVHRRCGEGGK  296



>ref|XP_007039332.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY23833.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=397

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGTPPDCE KAQAG
Sbjct  298  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAG  357

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEG++ +W+ +F
Sbjct  358  NPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  397



>ref|XP_007039333.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY23834.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
Length=402

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGTPPDCE KAQAG
Sbjct  303  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEG++ +W+ +F
Sbjct  363  NPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  402



>gb|KHG03847.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=407

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYI  NQ+VLHKYANEDVSL AWFIGLDV HVDDRRLCCGTPPDCE KAQAG
Sbjct  300  YAISKDLATYIFINQNVLHKYANEDVSLGAWFIGLDVEHVDDRRLCCGTPPDCEWKAQAG  359

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGICR V+RI EVH RCGE +  LW+A F
Sbjct  360  NICAASFDWRCSGICRSVERIVEVHERCGEDKNALWSANF  399



>ref|XP_007039335.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
 gb|EOY23836.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
Length=429

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGTPPDCE KAQAG
Sbjct  330  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAG  389

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEG++ +W+ +F
Sbjct  390  NPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  429



>ref|XP_011097870.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Sesamum indicum]
Length=403

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  305  YAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRRLCCGT-TDCEWKAQAG  363

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC   DRIKEVHRRCGEGE  LW A F
Sbjct  364  NMCVASFDWSCSGICNSADRIKEVHRRCGEGEDSLWAADF  403



>gb|EMT12895.1| Putative beta-1,3-galactosyltransferase 2 [Aegilops tauschii]
Length=383

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKY NEDVSL AWFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  284  YAISKDLATYISLNKHVLHKYVNEDVSLGAWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  343

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC  V+ I+ VH +CGE EK LW A+F
Sbjct  344  NTCAASFDWRCSGICNTVENIQGVHNKCGESEKALWTASF  383



>ref|XP_003562342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Brachypodium 
distachyon]
Length=405

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS N+HVLHKYANEDVSL AWFIG+D  H+D+RRLCCGTPPDCE K QAG
Sbjct  306  YAISKDLASYISINKHVLHKYANEDVSLGAWFIGVDAEHIDERRLCCGTPPDCEWKTQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+  DRIKEVH+RCGE    +WNA F
Sbjct  366  NVCAASFDWSCSGICKSADRIKEVHQRCGESANAIWNATF  405



>ref|XP_009419577.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419578.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=400

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS + A YIS NQH+LHKY NEDVSL +WFIGLDV H+DDR+LCCGT PDCE KAQAG
Sbjct  301  YAISNELAAYISINQHILHKYVNEDVSLGSWFIGLDVEHIDDRKLCCGTLPDCEWKAQAG  360

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC  VDRIKEVH+RCGE E  +WNA F
Sbjct  361  NTCVASFDWSCSGICDSVDRIKEVHQRCGENESTIWNAVF  400



>ref|XP_009601250.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  221  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  280

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  281  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>gb|KCW70545.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=313

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+S+D ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  214  YALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAG  273

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N C+AS DW+CSGIC+ V++IK+VHRRCGEG+  +W+A
Sbjct  274  NVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  311



>ref|XP_009786663.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
sylvestris]
Length=320

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  221  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  280

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  281  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>gb|EYU23928.1| hypothetical protein MIMGU_mgv1a007764mg [Erythranthe guttata]
Length=396

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS NQH+LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDCE K+QAG
Sbjct  297  YALSKDLATYISINQHILHKYANEDVSLGAWFIGLEVEHIDERNMCCGTPPDCEWKSQAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N C+AS DW+CSGIC+ V+++K VH +CGEGE+ LWNA
Sbjct  357  NVCIASFDWSCSGICKSVEKMKFVHEQCGEGEEALWNA  394



>ref|XP_010943123.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=397

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGLDV H+D+R +CCGTPPDCE KAQAG
Sbjct  298  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLDVEHIDERNMCCGTPPDCEWKAQAG  357

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+ V+RI++VH +CGEG+  +WNA F
Sbjct  358  NVCIASFDWSCSGICKSVERIRDVHAKCGEGDGAVWNAFF  397



>ref|XP_010251481.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Nelumbo 
nucifera]
Length=402

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGTPPDCE KAQAG
Sbjct  303  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEG+  +W+A F
Sbjct  363  NSCGASFDWSCSGICKSVERMEEVHQRCGEGDGAIWHANF  402



>ref|XP_004507687.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=378

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D ATYIS NQ VLHKYANEDVSL +WFIGLDV HVDDRR+CCGTPPDCE KAQAG
Sbjct  278  YAISQDLATYISTNQDVLHKYANEDVSLGSWFIGLDVDHVDDRRMCCGTPPDCEWKAQAG  337

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGICR V+R+++VH RCGE E  LW++ F
Sbjct  338  NICAASFDWKCSGICRSVERMQDVHLRCGEDENALWSSTF  377



>ref|XP_006364961.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
 ref|XP_010312804.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Solanum 
lycopersicum]
Length=320

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  221  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  280

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  281  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>gb|EYU22897.1| hypothetical protein MIMGU_mgv1a007777mg [Erythranthe guttata]
Length=395

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  296  YAISKDLATYISINQPLLHKYANEDVSLGAWFIGLEVEHIDDRSMCCGTPPDCEWKAQAG  355

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA
Sbjct  356  NVCVASFDWSCSGICKSVEKLKFVHEQCGEGEEALWNA  393



>ref|XP_002518935.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43468.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=403

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISK+ ATYIS N+H+LH+YANEDVS+ +WFIGLDV H+DDR LCCGTPPDCE KAQAG
Sbjct  304  YAISKNLATYISVNRHILHRYANEDVSMGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAG  363

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DWTCSGIC+ V+R++EVH+RCGEG+  +W+ +F
Sbjct  364  NPCAASFDWTCSGICKSVERMEEVHQRCGEGDGAIWHTSF  403



>ref|XP_006452384.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65624.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=417

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHK+ANEDVSL +WFIGLD  H+DDRRLCCGTPPDCE KAQAG
Sbjct  308  YAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHIDDRRLCCGTPPDCEWKAQAG  367

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEK  379
            N CVAS DW+CSGICR  +R+KEVHRRCGEG K
Sbjct  368  NVCVASFDWSCSGICRSAERMKEVHRRCGEGGK  400



>ref|XP_002300511.1| hypothetical protein POPTR_0001s45420g [Populus trichocarpa]
 gb|EEE85316.1| hypothetical protein POPTR_0001s45420g [Populus trichocarpa]
Length=355

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGT PDCE KAQAG
Sbjct  256  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKAQAG  315

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEGE  +W+ +F
Sbjct  316  NPCAASFDWSCSGICKSVERMEEVHQRCGEGEGAIWHTSF  355



>ref|XP_010536663.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  307  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGT-TDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DR+K+VHRRCGEG   LW+++F
Sbjct  366  NMCVASFDWSCSGICRSADRMKDVHRRCGEGHNALWSSSF  405



>ref|XP_008778068.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Phoenix dactylifera]
Length=234

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYI+ NQ +LHKYANEDVSL AWFIGLDV H+D+R +CC TPPDCE KA+AG
Sbjct  135  YAISKDLATYITINQPILHKYANEDVSLGAWFIGLDVEHIDERNMCCKTPPDCEGKARAG  194

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+ V+RIK+VH +CGEG+  +WNA F
Sbjct  195  NVCIASFDWSCSGICKSVERIKDVHAKCGEGDGAVWNAFF  234



>ref|XP_011097866.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
 ref|XP_011097867.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
 ref|XP_011097869.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
Length=474

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 84/100 (84%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LHKYANEDVSL +WFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  376  YAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHIDDRRLCCGT-TDCEWKAQAG  434

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC   DRIKEVHRRCGEGE  LW A F
Sbjct  435  NMCVASFDWSCSGICNSADRIKEVHRRCGEGEDSLWAADF  474



>ref|XP_009601249.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
tomentosiformis]
Length=396

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  297  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  357  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>gb|KCW70544.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=356

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+S+D ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  257  YALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAG  316

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N C+AS DW+CSGIC+ V++IK+VHRRCGEG+  +W+A
Sbjct  317  NVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  354



>ref|NP_001149120.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
 gb|ACG34259.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=366

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS N+H+LHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  267  YAVSKDLATYISINKHILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  326

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  327  NVCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  366



>ref|XP_010536662.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Tarenaya hassleriana]
Length=428

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAIS+D A+YIS NQHVLHKYANEDVSL AWFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  330  YAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHIDDRRLCCGT-TDCEWKAQAG  388

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGICR  DR+K+VHRRCGEG   LW+++F
Sbjct  389  NMCVASFDWSCSGICRSADRMKDVHRRCGEGHNALWSSSF  428



>ref|NP_001141890.1| hypothetical protein [Zea mays]
 gb|ACF87243.1| unknown [Zea mays]
 tpg|DAA61737.1| TPA: hypothetical protein ZEAMMB73_056797 [Zea mays]
 gb|AIG52083.1| pyrabactin resistance-like protein [Zea mays]
Length=398

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGLDV H+DDR +CCGTPPDCE KAQAG
Sbjct  299  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLDVEHIDDRDMCCGTPPDCEWKAQAG  358

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW CSG+C  V+RIK VH RCGEG+  +W+A+F
Sbjct  359  NVCIASFDWRCSGVCNPVERIKYVHSRCGEGQDAIWSASF  398



>ref|XP_002979099.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ20056.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=387

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            Y ISKD ATYISAN+ +LHKYANEDVSL AWFIGLDV H+DDR +CCGTPPDCE KAQAG
Sbjct  277  YVISKDLATYISANEPILHKYANEDVSLGAWFIGLDVEHIDDRTMCCGTPPDCEWKAQAG  336

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWN  367
            N CVAS DW+CSGIC+  +RI EVH RCGEGE+ LWN
Sbjct  337  NACVASFDWSCSGICKSAERIHEVHSRCGEGEQALWN  373



>gb|KJB13704.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=368

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  270  YAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAG  328

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+K+VHRRCGEG+  L  A F
Sbjct  329  NICVASFDWTCSGICRSVDRMKDVHRRCGEGKNALRTATF  368



>emb|CAA06925.1| Avr9 elicitor response protein [Nicotiana tabacum]
Length=396

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  297  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  357  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_006439188.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52428.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=229

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGT PDCE KAQAG
Sbjct  130  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKAQAG  189

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSG+C+ V+R+ EVH+RCGEG++ +W+ +F
Sbjct  190  NPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  229



>ref|XP_006646915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=404

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  305  YAISKDLATYISINRHVLHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  364

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  365  NTCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  404



>dbj|BAD25162.1| putative Avr9 elicitor response protein [Oryza sativa Japonica 
Group]
 gb|EEE56368.1| hypothetical protein OsJ_05500 [Oryza sativa Japonica Group]
Length=400

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  301  YAISKDLATYISINRHVLHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  360

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  361  NTCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  400



>ref|XP_009786662.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=396

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  297  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  357  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_002451594.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
 gb|EES04570.1| hypothetical protein SORBIDRAFT_04g004400 [Sorghum bicolor]
Length=402

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  303  YAISKDLATYISINKHILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  363  NICAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  402



>ref|XP_010104914.1| putative beta-1,3-galactosyltransferase 6 [Morus notabilis]
 gb|EXC02150.1| putative beta-1,3-galactosyltransferase 6 [Morus notabilis]
Length=431

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGTPPDCE KAQAG
Sbjct  332  YALSKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTPPDCEWKAQAG  391

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEG+  +W+ +F
Sbjct  392  NACAASFDWSCSGICKSVERMEEVHQRCGEGDGAIWHTSF  431



>gb|EAY84604.1| hypothetical protein OsI_05972 [Oryza sativa Indica Group]
Length=400

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+HVLHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  301  YAISKDLATYISINRHVLHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  360

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  361  NTCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  400



>ref|XP_002974972.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23757.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LH+YANEDVSL AWFIGLDV+H+D+R  CCGTPPDCE +A+AG
Sbjct  303  YAISKDLATYISINQHILHQYANEDVSLGAWFIGLDVNHIDERSFCCGTPPDCEWQAEAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGIC+ V+R+K VH+RCGEG   +W+A F
Sbjct  363  NVCVASFDWPCSGICKSVERMKTVHKRCGEGNGAIWSAKF  402



>gb|KDP25226.1| hypothetical protein JCGZ_20382 [Jatropha curcas]
Length=403

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+Y+NEDVSL +WFIGLDV H+D+R LCCGTPPDCE KAQAG
Sbjct  304  YAISKDLATYISVNRHILHRYSNEDVSLGSWFIGLDVEHIDERSLCCGTPPDCEWKAQAG  363

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DWTCSGIC+ V+R+ EVH+RCGEG+  +W+ +F
Sbjct  364  NPCAASFDWTCSGICKSVERMVEVHQRCGEGDGAIWHTSF  403



>ref|XP_002977391.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ21395.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=402

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQH+LH+YANEDVSL AWFIGLDV+H+D+R  CCGTPPDCE +A+AG
Sbjct  303  YAISKDLATYISINQHILHQYANEDVSLGAWFIGLDVNHIDERSFCCGTPPDCEWQAEAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW CSGIC+ V+R+K VH+RCGEG   +W+A F
Sbjct  363  NVCVASFDWPCSGICKSVERMKTVHKRCGEGNGAIWSAKF  402



>ref|XP_006370727.1| hypothetical protein POPTR_0001s45420g [Populus trichocarpa]
 gb|ERP67296.1| hypothetical protein POPTR_0001s45420g [Populus trichocarpa]
Length=393

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGT PDCE KAQAG
Sbjct  294  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKAQAG  353

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEGE  +W+ +F
Sbjct  354  NPCAASFDWSCSGICKSVERMEEVHQRCGEGEGAIWHTSF  393



>ref|XP_004250351.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Solanum 
lycopersicum]
Length=396

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  297  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  357  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>gb|KJB13705.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=373

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 85/100 (85%), Gaps = 1/100 (1%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD A+YIS NQHVLHKYANEDVSL +WFIGLDV H+DDRRLCCGT  DCE KAQAG
Sbjct  275  YAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHIDDRRLCCGT-TDCEWKAQAG  333

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DWTCSGICR VDR+K+VHRRCGEG+  L  A F
Sbjct  334  NICVASFDWTCSGICRSVDRMKDVHRRCGEGKNALRTATF  373



>gb|KJB64380.1| hypothetical protein B456_010G046600 [Gossypium raimondii]
Length=322

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISK+ ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  223  YAISKELATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAG  282

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N CVAS DW+CSGIC+ V+++K VH+RCGEG+  +WN 
Sbjct  283  NVCVASFDWSCSGICKSVEKLKTVHKRCGEGDDAVWNT  320



>ref|XP_010245068.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Nelumbo nucifera]
Length=396

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDCE KAQAG
Sbjct  297  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERNMCCGTPPDCEWKAQAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C+AS DW+CSGIC+ V++IK+VH RCGEG+  +W+A F
Sbjct  357  NVCIASFDWSCSGICKSVEKIKDVHERCGEGDGAVWSALF  396



>ref|XP_010063329.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Eucalyptus 
grandis]
 gb|KCW70543.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=388

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+S+D ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  289  YALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAG  348

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N C+AS DW+CSGIC+ V++IK+VHRRCGEG+  +W+A
Sbjct  349  NVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  386



>ref|XP_006364960.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=396

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS NQ +LHKYANEDVSL AWFIGL+V H+D+R +CCGTPPDC+ KA+AG
Sbjct  297  YAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDERTMCCGTPPDCDWKAEAG  356

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N CVAS DW+CSGIC+ V+++K VH +CGEGE+ LWNA F
Sbjct  357  NVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_010063328.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Eucalyptus 
grandis]
 gb|KCW70542.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=389

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+S+D ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  290  YALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAG  349

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N C+AS DW+CSGIC+ V++IK+VHRRCGEG+  +W+A
Sbjct  350  NVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  387



>ref|XP_011470881.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+D+R LCCGTPPDCE KAQAG
Sbjct  306  YALSKDLATYISVNRHILHRYANEDVSLGSWFIGLDVQHIDERSLCCGTPPDCEWKAQAG  365

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSGIC+ V+R++EVH+RCGEG+  +W+ +F
Sbjct  366  NPCAASFDWSCSGICKSVERMEEVHQRCGEGDDAIWHTSF  405



>ref|XP_010063326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70541.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=392

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+S+D ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  293  YALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAG  352

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N C+AS DW+CSGIC+ V++IK+VHRRCGEG+  +W+A
Sbjct  353  NVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  390



>ref|XP_010063327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+S+D ATYIS NQ +LHKYANEDVSL AWFIGL+V H+DDR +CCGTPPDCE KAQAG
Sbjct  292  YALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHIDDRNMCCGTPPDCEWKAQAG  351

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N C+AS DW+CSGIC+ V++IK+VHRRCGEG+  +W+A
Sbjct  352  NVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  389



>ref|XP_008677265.1| PREDICTED: beta-1,3-galactosyltransferase sqv-2 isoform X1 [Zea 
mays]
 gb|AFW66428.1| beta-1,3-galactosyltransferase sqv-2 [Zea mays]
Length=402

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YA+SKD ATYIS N+H+LHKY NEDVSL +WFIGLDV H+DDRRLCCGTPPDCE KAQAG
Sbjct  303  YAVSKDLATYISINKHILHKYINEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAG  362

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW CSGIC    RI EVH +C EGEK LWNA F
Sbjct  363  NVCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  402



>ref|XP_003575190.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Brachypodium 
distachyon]
Length=397

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATY+S NQH+LHKYANEDVSL +WFIGL+V+H+D+R +CCGTPPDCE K QAG
Sbjct  298  YAISKDLATYVSINQHILHKYANEDVSLGSWFIGLEVNHIDERSMCCGTPPDCEWKGQAG  357

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNA  364
            N CVAS DW+CSGIC+ VDR+K+VH RCGEG+  +W+A
Sbjct  358  NVCVASFDWSCSGICKSVDRLKDVHARCGEGDSSVWSA  395



>ref|XP_006439187.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52427.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=314

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -2

Query  657  YAISKDSATYISANQHVLHKYANEDVSLXAWFIGLDVHHVDDRRLCCGTPPDCEXKAQAG  478
            YAISKD ATYIS N+H+LH+YANEDVSL +WFIGLDV H+DDR LCCGT PDCE KAQAG
Sbjct  215  YAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHIDDRSLCCGTAPDCEWKAQAG  274

Query  477  NXCVASXDWTCSGICRXVDRIKEVHRRCGEGEKVLWNAAF  358
            N C AS DW+CSG+C+ V+R+ EVH+RCGEG++ +W+ +F
Sbjct  275  NPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  314



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500