BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027G16

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074127.1|  PREDICTED: uncharacterized protein OsI_02794...    182   1e-53   Sesamum indicum [beniseed]
ref|XP_009785922.1|  PREDICTED: uncharacterized protein OsI_02794...    177   1e-51   Nicotiana sylvestris
ref|XP_009604975.1|  PREDICTED: uncharacterized protein OsI_02794...    177   2e-51   Nicotiana tomentosiformis
ref|XP_009604976.1|  PREDICTED: uncharacterized protein OsI_02794...    176   3e-51   Nicotiana tomentosiformis
gb|AIL30486.1|  ripening regulated protein DDTFR8                       176   3e-51   Nicotiana tabacum [American tobacco]
ref|XP_006360297.1|  PREDICTED: uncharacterized protein Os08g0359...    175   8e-51   Solanum tuberosum [potatoes]
ref|NP_001234685.1|  ripening regulated protein DDTFR8                  174   2e-50   
emb|CDP01142.1|  unnamed protein product                                175   2e-50   Coffea canephora [robusta coffee]
gb|EYU36540.1|  hypothetical protein MIMGU_mgv1a018670mg                171   7e-50   Erythranthe guttata [common monkey flower]
ref|XP_004252558.1|  PREDICTED: uncharacterized protein OsI_02794...    172   7e-50   Solanum lycopersicum
ref|XP_010314468.1|  PREDICTED: uncharacterized protein OsI_02794...    172   8e-50   Solanum lycopersicum
ref|XP_006359015.1|  PREDICTED: uncharacterized protein OsI_02794...    169   1e-48   Solanum tuberosum [potatoes]
ref|XP_006574773.1|  PREDICTED: uncharacterized protein OsI_02794...    164   1e-46   Glycine max [soybeans]
ref|XP_002893745.1|  hypothetical protein ARALYDRAFT_336372             164   1e-46   Arabidopsis lyrata subsp. lyrata
gb|KHN32820.1|  Hypothetical protein glysoja_024179                     164   2e-46   Glycine soja [wild soybean]
ref|NP_001237326.1|  uncharacterized protein LOC100527783               164   2e-46   Glycine max [soybeans]
ref|XP_008780776.1|  PREDICTED: uncharacterized protein Os08g0359...    162   6e-46   Phoenix dactylifera
ref|XP_010926229.1|  PREDICTED: uncharacterized protein Os08g0359...    162   1e-45   Elaeis guineensis
ref|XP_010243328.1|  PREDICTED: uncharacterized protein OsI_02794...    161   2e-45   Nelumbo nucifera [Indian lotus]
ref|XP_008811572.1|  PREDICTED: uncharacterized protein Os08g0359...    160   4e-45   Phoenix dactylifera
ref|XP_006434560.1|  hypothetical protein CICLE_v10002611mg             160   4e-45   Citrus clementina [clementine]
ref|XP_007020190.1|  HSP20-like chaperones superfamily protein          160   8e-45   Theobroma cacao [chocolate]
ref|XP_010916995.1|  PREDICTED: uncharacterized protein OsI_02794...    159   2e-44   Elaeis guineensis
ref|XP_006473157.1|  PREDICTED: uncharacterized protein OsI_02794...    159   2e-44   Citrus sinensis [apfelsine]
ref|XP_006434561.1|  hypothetical protein CICLE_v10002611mg             156   5e-44   
ref|XP_006434559.1|  hypothetical protein CICLE_v10002611mg             157   6e-44   
ref|XP_010461085.1|  PREDICTED: uncharacterized protein OsI_02794...    156   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010461087.1|  PREDICTED: uncharacterized protein OsI_02794...    156   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010461088.1|  PREDICTED: uncharacterized protein OsI_02794...    156   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010461086.1|  PREDICTED: uncharacterized protein OsI_02794...    155   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011044819.1|  PREDICTED: uncharacterized protein OsI_02794...    155   7e-43   Populus euphratica
ref|XP_010478707.1|  PREDICTED: uncharacterized protein OsI_02794...    154   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010478706.1|  PREDICTED: uncharacterized protein OsI_02794...    154   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010478705.1|  PREDICTED: uncharacterized protein OsI_02794...    154   8e-43   Camelina sativa [gold-of-pleasure]
ref|XP_008237431.1|  PREDICTED: uncharacterized protein Os08g0359...    155   1e-42   
ref|XP_008237430.1|  PREDICTED: uncharacterized protein Os08g0359...    155   1e-42   Prunus mume [ume]
ref|XP_011458453.1|  PREDICTED: uncharacterized protein OsI_02794...    154   2e-42   Fragaria vesca subsp. vesca
ref|XP_007201255.1|  hypothetical protein PRUPE_ppa010769mg             155   2e-42   Prunus persica
ref|XP_007201254.1|  hypothetical protein PRUPE_ppa010769mg             155   2e-42   Prunus persica
ref|XP_007151931.1|  hypothetical protein PHAVU_004G088000g             154   2e-42   Phaseolus vulgaris [French bean]
ref|XP_002307531.2|  hypothetical protein POPTR_0005s22140g             153   6e-42   
ref|XP_010499807.1|  PREDICTED: uncharacterized protein OsI_02794...    152   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010499806.1|  PREDICTED: uncharacterized protein OsI_02794...    152   9e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010499808.1|  PREDICTED: uncharacterized protein OsI_02794...    152   9e-42   
ref|XP_009409147.1|  PREDICTED: uncharacterized protein OsI_02794...    152   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300889.2|  hypothetical protein POPTR_0002s06240g             151   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002265220.1|  PREDICTED: uncharacterized protein OsI_02794...    150   3e-41   Vitis vinifera
ref|NP_001050241.1|  Os03g0381300                                       150   3e-41   
gb|EAY90254.1|  hypothetical protein OsI_11826                          150   3e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_004140943.1|  PREDICTED: uncharacterized protein OsI_02794...    150   3e-41   Cucumis sativus [cucumbers]
gb|ABF96271.1|  expressed protein                                       149   4e-41   Oryza sativa Japonica Group [Japonica rice]
gb|KHF97613.1|  hypothetical protein F383_14672                         150   6e-41   Gossypium arboreum [tree cotton]
gb|KJB59532.1|  hypothetical protein B456_009G259900                    150   6e-41   Gossypium raimondii
ref|XP_009380995.1|  PREDICTED: uncharacterized protein At3g03773...    149   7e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004159475.1|  PREDICTED: uncharacterized protein OsI_02794...    150   7e-41   
emb|CBI29341.3|  unnamed protein product                                150   1e-40   Vitis vinifera
ref|XP_003619026.1|  Ripening regulated protein DDTFR8                  149   1e-40   Medicago truncatula
ref|XP_006651444.1|  PREDICTED: uncharacterized protein OsI_02794...    148   3e-40   Oryza brachyantha
ref|XP_006434558.1|  hypothetical protein CICLE_v10002611mg             147   8e-40   
ref|XP_008456697.1|  PREDICTED: uncharacterized protein At3g03773...    147   1e-39   Cucumis melo [Oriental melon]
ref|XP_008456698.1|  PREDICTED: uncharacterized protein At3g03773...    147   1e-39   Cucumis melo [Oriental melon]
ref|XP_011026295.1|  PREDICTED: uncharacterized protein OsI_02794...    145   4e-39   Populus euphratica
ref|XP_006304541.1|  hypothetical protein CARUB_v10011509mg             143   8e-39   
ref|XP_008381044.1|  PREDICTED: uncharacterized protein OsI_02794...    145   2e-38   Malus domestica [apple tree]
ref|XP_008381045.1|  PREDICTED: uncharacterized protein OsI_02794...    144   2e-38   Malus domestica [apple tree]
gb|AAG41763.1|AF153128_1  p23                                           143   2e-38   Brassica napus [oilseed rape]
emb|CDY04790.1|  BnaC05g17990D                                          143   4e-38   
emb|CDY21385.1|  BnaA09g30420D                                          142   7e-38   Brassica napus [oilseed rape]
ref|XP_003557812.1|  PREDICTED: uncharacterized protein OsI_02794...    141   8e-38   Brachypodium distachyon [annual false brome]
ref|XP_010251769.1|  PREDICTED: uncharacterized protein Os08g0359...    140   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004984205.1|  PREDICTED: uncharacterized protein OsI_02794...    140   2e-37   Setaria italica
gb|AFK43711.1|  unknown                                                 140   4e-37   Lotus japonicus
gb|EMT32541.1|  hypothetical protein F775_31652                         140   4e-37   
gb|AGT16170.1|  hypothetical protein SHCRBa_024_F14_R_20                139   4e-37   Saccharum hybrid cultivar R570
ref|XP_002277004.1|  PREDICTED: uncharacterized protein OsI_02794...    138   9e-37   Vitis vinifera
ref|XP_002465200.1|  hypothetical protein SORBIDRAFT_01g033940          138   1e-36   Sorghum bicolor [broomcorn]
ref|XP_002525582.1|  HSP90 co-chaperone, putative                       137   1e-36   Ricinus communis
ref|XP_002276982.1|  PREDICTED: uncharacterized protein OsI_02794...    138   1e-36   Vitis vinifera
gb|ABA60373.1|  p23                                                     137   4e-36   Dactylis glomerata [cocksfoot]
ref|XP_010922128.1|  PREDICTED: uncharacterized protein At3g03773...    135   1e-35   Elaeis guineensis
emb|CAN64654.1|  hypothetical protein VITISV_015756                     135   2e-35   Vitis vinifera
ref|NP_001148600.1|  prostaglandin E synthase 3                         134   3e-35   Zea mays [maize]
ref|XP_008792419.1|  PREDICTED: uncharacterized protein OsI_02794...    134   4e-35   
ref|XP_009115602.1|  PREDICTED: uncharacterized protein OsI_02794...    134   5e-35   Brassica rapa
ref|XP_008792417.1|  PREDICTED: uncharacterized protein OsI_02794...    134   2e-34   
ref|XP_010694670.1|  PREDICTED: uncharacterized protein OsI_02794...    133   2e-34   
ref|XP_008792416.1|  PREDICTED: uncharacterized protein At3g03773...    134   3e-34   
ref|XP_010694666.1|  PREDICTED: uncharacterized protein At3g03773...    133   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694667.1|  PREDICTED: uncharacterized protein At3g03773...    132   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694668.1|  PREDICTED: uncharacterized protein At3g03773...    132   3e-34   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE92292.1|  putative p23 co-chaperone                              133   5e-34   Cryptomeria japonica
gb|ABK26701.1|  unknown                                                 131   4e-33   Picea sitchensis
gb|AFK39090.1|  unknown                                                 129   1e-32   Lotus japonicus
gb|KDP28144.1|  hypothetical protein JCGZ_13915                         127   3e-32   Jatropha curcas
ref|XP_006444305.1|  hypothetical protein CICLE_v10022431mg             126   7e-32   Citrus clementina [clementine]
ref|XP_006444304.1|  hypothetical protein CICLE_v10022431mg             126   8e-32   
ref|XP_004290784.1|  PREDICTED: uncharacterized protein Os08g0359...    126   3e-31   Fragaria vesca subsp. vesca
ref|XP_011458723.1|  PREDICTED: uncharacterized protein Os08g0359...    126   3e-31   Fragaria vesca subsp. vesca
ref|XP_004290783.1|  PREDICTED: uncharacterized protein Os08g0359...    126   3e-31   Fragaria vesca subsp. vesca
ref|XP_011458724.1|  PREDICTED: uncharacterized protein Os08g0359...    126   3e-31   Fragaria vesca subsp. vesca
ref|NP_001241395.1|  uncharacterized protein LOC100796372               124   6e-31   Glycine max [soybeans]
gb|AES61800.2|  CS domain protein                                       123   1e-30   Medicago truncatula
ref|XP_011458722.1|  PREDICTED: uncharacterized protein OsI_02794...    125   1e-30   Fragaria vesca subsp. vesca
ref|XP_011458721.1|  PREDICTED: uncharacterized protein OsI_02794...    125   1e-30   Fragaria vesca subsp. vesca
ref|XP_003591549.1|  hypothetical protein MTR_1g088700                  123   2e-30   
ref|XP_007050895.1|  HSP20-like chaperones superfamily protein is...    122   2e-30   
gb|KJB22493.1|  hypothetical protein B456_004G052400                    122   2e-30   Gossypium raimondii
gb|KJB22494.1|  hypothetical protein B456_004G052400                    122   2e-30   Gossypium raimondii
ref|XP_007050893.1|  HSP20-like chaperones superfamily protein is...    122   2e-30   Theobroma cacao [chocolate]
ref|XP_008451590.1|  PREDICTED: uncharacterized protein OsI_027940      122   3e-30   Cucumis melo [Oriental melon]
ref|XP_004136034.1|  PREDICTED: uncharacterized protein OsI_02794...    122   4e-30   Cucumis sativus [cucumbers]
ref|XP_009342102.1|  PREDICTED: uncharacterized protein OsI_02794...    122   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_009342103.1|  PREDICTED: uncharacterized protein OsI_02794...    122   4e-30   Pyrus x bretschneideri [bai li]
ref|NP_001236771.1|  uncharacterized protein LOC100499842               121   4e-30   
ref|XP_007050896.1|  HSP20-like chaperones superfamily protein is...    120   8e-30   
ref|XP_004495968.1|  PREDICTED: uncharacterized protein OsI_02794...    120   1e-29   Cicer arietinum [garbanzo]
ref|XP_010038204.1|  PREDICTED: uncharacterized protein Os08g0359500    121   1e-29   Eucalyptus grandis [rose gum]
gb|KHG16575.1|  hypothetical protein F383_01113                         120   2e-29   Gossypium arboreum [tree cotton]
ref|XP_010684508.1|  PREDICTED: uncharacterized protein OsI_027940      120   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009342151.1|  PREDICTED: uncharacterized protein OsI_02794...    120   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_008386667.1|  PREDICTED: uncharacterized protein OsI_02794...    119   2e-29   
ref|XP_008386666.1|  PREDICTED: uncharacterized protein OsI_02794...    119   2e-29   
ref|XP_009342150.1|  PREDICTED: uncharacterized protein OsI_02794...    120   3e-29   Pyrus x bretschneideri [bai li]
gb|KJB49925.1|  hypothetical protein B456_008G146000                    120   3e-29   Gossypium raimondii
gb|KJB49923.1|  hypothetical protein B456_008G146000                    120   3e-29   Gossypium raimondii
ref|XP_010652179.1|  PREDICTED: uncharacterized protein OsI_02794...    119   3e-29   Vitis vinifera
ref|XP_002264898.1|  PREDICTED: uncharacterized protein OsI_02794...    119   3e-29   Vitis vinifera
gb|KJB49924.1|  hypothetical protein B456_008G146000                    119   3e-29   Gossypium raimondii
ref|XP_008235058.1|  PREDICTED: uncharacterized protein OsI_027940      119   4e-29   Prunus mume [ume]
ref|XP_006840547.1|  hypothetical protein AMTR_s00045p00215950          120   5e-29   Amborella trichopoda
ref|XP_007201343.1|  hypothetical protein PRUPE_ppa011992mg             119   5e-29   Prunus persica
gb|KHN20406.1|  Hypothetical protein glysoja_039704                     120   6e-29   Glycine soja [wild soybean]
emb|CBI36840.3|  unnamed protein product                                119   9e-29   Vitis vinifera
gb|KHN43515.1|  Hypothetical protein glysoja_002098                     124   1e-28   Glycine soja [wild soybean]
gb|ADE76546.1|  unknown                                                 117   2e-28   Picea sitchensis
gb|ADE76981.1|  unknown                                                 117   2e-28   Picea sitchensis
emb|CDX89935.1|  BnaA10g01470D                                          118   4e-28   
ref|XP_009385408.1|  PREDICTED: uncharacterized protein OsI_02794...    114   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002964192.1|  hypothetical protein SELMODRAFT_81672              113   2e-27   
ref|XP_001768873.1|  predicted protein                                  112   2e-27   
ref|XP_006659323.1|  PREDICTED: uncharacterized protein Os08g0359...    115   2e-27   Oryza brachyantha
ref|XP_007050894.1|  HSP20-like chaperones superfamily protein is...    114   2e-27   
ref|XP_002988870.1|  hypothetical protein SELMODRAFT_128863             112   4e-27   
ref|XP_003573778.1|  PREDICTED: uncharacterized protein Os08g0359500    115   4e-27   Brachypodium distachyon [annual false brome]
gb|AFX67021.1|  putative p23 co-chaperone                               114   4e-27   Solanum tuberosum [potatoes]
ref|XP_010481284.1|  PREDICTED: uncharacterized protein OsI_02794...    114   5e-27   Camelina sativa [gold-of-pleasure]
gb|AFX66984.1|  putative p23 co-chaperone                               115   5e-27   Solanum tuberosum [potatoes]
ref|XP_006359384.1|  PREDICTED: uncharacterized protein Os08g0359...    113   1e-26   
ref|XP_009386345.1|  PREDICTED: uncharacterized protein OsI_02794...    112   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001061631.1|  Os08g0359500                                       112   2e-26   
sp|P0C8Z0.2|Y8359_ORYSI  RecName: Full=Uncharacterized protein Os...    112   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_009119603.1|  PREDICTED: uncharacterized protein Os08g0359...    113   2e-26   Brassica rapa
gb|EEC83453.1|  hypothetical protein OsI_28951                          114   2e-26   Oryza sativa Indica Group [Indian rice]
emb|CDY15271.1|  BnaC05g01500D                                          114   3e-26   Brassica napus [oilseed rape]
ref|XP_006418294.1|  hypothetical protein EUTSA_v10008755mg             112   3e-26   Eutrema salsugineum [saltwater cress]
gb|EEE59155.1|  hypothetical protein OsJ_11066                          110   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009769849.1|  PREDICTED: uncharacterized protein OsI_02794...    111   4e-26   Nicotiana sylvestris
ref|XP_004247428.1|  PREDICTED: uncharacterized protein OsI_027940      112   4e-26   Solanum lycopersicum
ref|XP_009414713.1|  PREDICTED: uncharacterized protein OsI_02794...    110   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010474870.1|  PREDICTED: uncharacterized protein OsI_02794...    111   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002992410.1|  hypothetical protein SELMODRAFT_186712             110   5e-26   Selaginella moellendorffii
ref|XP_009414711.1|  PREDICTED: uncharacterized protein OsI_02794...    110   6e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004494372.1|  PREDICTED: uncharacterized protein Os08g0359...    111   7e-26   Cicer arietinum [garbanzo]
ref|XP_009769848.1|  PREDICTED: uncharacterized protein OsI_02794...    111   8e-26   Nicotiana sylvestris
emb|CDP03502.1|  unnamed protein product                                112   8e-26   Coffea canephora [robusta coffee]
ref|XP_009799463.1|  PREDICTED: uncharacterized protein OsI_027940      110   8e-26   Nicotiana sylvestris
ref|XP_010269540.1|  PREDICTED: uncharacterized protein OsI_027940      109   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002968013.1|  hypothetical protein SELMODRAFT_145227             110   1e-25   Selaginella moellendorffii
gb|KEH24379.1|  CS domain protein                                       110   1e-25   Medicago truncatula
ref|XP_009598042.1|  PREDICTED: uncharacterized protein OsI_02794...    109   2e-25   Nicotiana tomentosiformis
gb|AFK43198.1|  unknown                                                 110   2e-25   Medicago truncatula
gb|KEH24380.1|  CS domain protein                                       110   2e-25   Medicago truncatula
ref|XP_002892131.1|  predicted protein                                  110   2e-25   
ref|XP_009598041.1|  PREDICTED: uncharacterized protein OsI_02794...    109   2e-25   Nicotiana tomentosiformis
dbj|BAJ94677.1|  predicted protein                                      110   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH24381.1|  CS domain protein                                       109   3e-25   Medicago truncatula
ref|XP_008775907.1|  PREDICTED: uncharacterized protein OsI_02794...    108   3e-25   Phoenix dactylifera
ref|XP_009598040.1|  PREDICTED: uncharacterized protein OsI_02794...    109   4e-25   Nicotiana tomentosiformis
ref|XP_010522788.1|  PREDICTED: uncharacterized protein OsI_027940      108   6e-25   Tarenaya hassleriana [spider flower]
ref|XP_011082475.1|  PREDICTED: uncharacterized protein OsI_02794...    108   7e-25   Sesamum indicum [beniseed]
ref|XP_009586785.1|  PREDICTED: uncharacterized protein OsI_02794...    107   7e-25   Nicotiana tomentosiformis
gb|EMS68218.1|  hypothetical protein TRIUR3_30845                       108   8e-25   Triticum urartu
ref|XP_010922352.1|  PREDICTED: uncharacterized protein OsI_02794...    107   8e-25   Elaeis guineensis
ref|XP_003625928.1|  RING finger protein 113A                           110   8e-25   
ref|XP_003628460.1|  Zinc finger CCCH domain-containing protein         110   1e-24   
ref|XP_010556743.1|  PREDICTED: uncharacterized protein OsI_02794...    107   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_010556742.1|  PREDICTED: uncharacterized protein OsI_02794...    107   2e-24   Tarenaya hassleriana [spider flower]
gb|EMT10253.1|  hypothetical protein F775_29406                         109   2e-24   
ref|XP_007163102.1|  hypothetical protein PHAVU_001G206400g             106   3e-24   Phaseolus vulgaris [French bean]
gb|ACJ83262.1|  unknown                                                 106   3e-24   Medicago truncatula
gb|AGV54501.1|  zinc finger CCCH domain-containing protein              105   7e-24   Phaseolus vulgaris [French bean]
gb|ABR17014.1|  unknown                                                 104   8e-24   Picea sitchensis
ref|XP_010906988.1|  PREDICTED: uncharacterized protein OsI_02794...    104   1e-23   Elaeis guineensis
gb|ACN35583.1|  unknown                                                 102   2e-23   Zea mays [maize]
gb|ACN34684.1|  unknown                                                 103   2e-23   Zea mays [maize]
gb|ACF88149.1|  unknown                                                 103   2e-23   Zea mays [maize]
ref|XP_008792885.1|  PREDICTED: uncharacterized protein OsI_02794...    103   3e-23   
tpg|DAA49201.1|  TPA: hypothetical protein ZEAMMB73_435161              102   3e-23   
gb|KFK30837.1|  hypothetical protein AALP_AA6G032100                    103   7e-23   Arabis alpina [alpine rockcress]
ref|XP_011079678.1|  PREDICTED: uncharacterized protein Os08g0359500    102   7e-23   Sesamum indicum [beniseed]
ref|NP_001241744.1|  co-chaperone protein SBA1                          102   1e-22   
ref|NP_001148972.1|  LOC100282592                                       102   1e-22   
gb|ACR38464.1|  unknown                                                 102   1e-22   Zea mays [maize]
ref|XP_010456028.1|  PREDICTED: uncharacterized protein Os08g0359...    102   1e-22   Camelina sativa [gold-of-pleasure]
tpg|DAA49203.1|  TPA: hypothetical protein ZEAMMB73_435161              102   1e-22   
ref|NP_001150702.1|  co-chaperone protein SBA1                          102   2e-22   Zea mays [maize]
ref|XP_010429707.1|  PREDICTED: uncharacterized protein Os08g0359...    102   2e-22   Camelina sativa [gold-of-pleasure]
emb|CBI29165.3|  unnamed protein product                              99.0    4e-22   Vitis vinifera
ref|XP_006288563.1|  hypothetical protein CARUB_v10001852mg             101   4e-22   Capsella rubella
ref|XP_010422586.1|  PREDICTED: uncharacterized protein Os08g0359...    101   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006396454.1|  hypothetical protein EUTSA_v10028946mg             101   5e-22   Eutrema salsugineum [saltwater cress]
ref|XP_010259596.1|  PREDICTED: uncharacterized protein OsI_02794...    100   5e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009134431.1|  PREDICTED: uncharacterized protein OsI_02794...  99.8    1e-21   Brassica rapa
ref|XP_002444216.1|  hypothetical protein SORBIDRAFT_07g015140        99.8    1e-21   Sorghum bicolor [broomcorn]
ref|XP_001763304.1|  predicted protein                                97.8    2e-21   
gb|AAT68744.1|  hypothetical protein At3g03773                        96.3    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144563.1|  PREDICTED: uncharacterized protein Os08g0359...  98.6    3e-21   Brassica rapa
pdb|2KMW|A  Chain A, Solution Structure Of At3g03773.1 Protein Fr...  96.7    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_683525.2|  p23 co-chaperone protein                            96.7    4e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90937.1|  BnaA03g26170D                                        98.6    4e-21   
ref|XP_009134430.1|  PREDICTED: uncharacterized protein OsI_02794...  98.6    5e-21   Brassica rapa
ref|XP_006826339.1|  hypothetical protein AMTR_s00004p00112630        95.9    1e-20   
emb|CDY18019.1|  BnaC03g30910D                                        98.6    1e-20   Brassica napus [oilseed rape]
ref|NP_001154201.1|  HSP20-like chaperone                             97.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872836.1|  predicted protein                                97.8    1e-20   
ref|NP_192154.2|  HSP20-like chaperone                                97.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007151769.1|  hypothetical protein PHAVU_004G073200g           94.4    1e-20   Phaseolus vulgaris [French bean]
emb|CAC16575.1|  p23 co-chaperone                                     97.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386859.1|  PREDICTED: uncharacterized protein At3g03773     95.1    2e-20   Malus domestica [apple tree]
ref|NP_001154589.1|  p23 co-chaperone protein                         96.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882306.1|  predicted protein                                95.1    2e-20   Arabidopsis lyrata subsp. lyrata
emb|CDY29960.1|  BnaC01g40480D                                        95.1    2e-20   Brassica napus [oilseed rape]
ref|XP_004489674.1|  PREDICTED: uncharacterized protein At3g03773...  94.7    2e-20   Cicer arietinum [garbanzo]
gb|AAC19287.1|  T14P8.5                                               97.1    2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97265.1|  BnaA02g20560D                                          100   3e-20   
ref|XP_009366492.1|  PREDICTED: uncharacterized protein At3g03773...  94.4    3e-20   
emb|CDX91318.1|  BnaC02g27290D                                          100   4e-20   
ref|XP_007202648.1|  hypothetical protein PRUPE_ppa012211mg           94.7    4e-20   
ref|XP_004973281.1|  PREDICTED: uncharacterized protein Os08g0359...  95.5    5e-20   Setaria italica
gb|AFK42085.1|  unknown                                               94.0    5e-20   Lotus japonicus
ref|XP_008244127.1|  PREDICTED: uncharacterized protein At3g03773...  93.2    5e-20   Prunus mume [ume]
ref|XP_004973280.1|  PREDICTED: uncharacterized protein Os08g0359...  95.1    6e-20   Setaria italica
ref|XP_010514039.1|  PREDICTED: uncharacterized protein At3g03773...  93.6    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009102082.1|  PREDICTED: uncharacterized protein At3g03773     93.6    6e-20   Brassica rapa
ref|XP_004136663.1|  PREDICTED: uncharacterized protein At3g03773...  93.6    6e-20   Cucumis sativus [cucumbers]
ref|XP_008443309.1|  PREDICTED: uncharacterized protein At3g03773...  92.8    8e-20   
ref|XP_006408265.1|  hypothetical protein EUTSA_v10021254mg           95.9    8e-20   
emb|CDY21163.1|  BnaA01g33940D                                        94.4    8e-20   Brassica napus [oilseed rape]
ref|XP_003550100.1|  PREDICTED: uncharacterized protein At3g03773...  92.8    1e-19   Glycine max [soybeans]
ref|XP_008443308.1|  PREDICTED: uncharacterized protein At3g03773...  92.8    1e-19   Cucumis melo [Oriental melon]
ref|XP_006298626.1|  hypothetical protein CARUB_v10014713mg           93.6    1e-19   
ref|XP_010910290.1|  PREDICTED: uncharacterized protein At3g03773     92.4    2e-19   Elaeis guineensis
gb|KJB80743.1|  hypothetical protein B456_013G113500                  92.0    2e-19   Gossypium raimondii
ref|XP_009420684.1|  PREDICTED: uncharacterized protein At3g03773...  92.0    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS74301.1|  hypothetical protein M569_00457                       92.4    2e-19   Genlisea aurea
gb|KHN43783.1|  Hypothetical protein glysoja_035394                   93.2    2e-19   Glycine soja [wild soybean]
gb|KHG15374.1|  hypothetical protein F383_20155                       91.7    3e-19   Gossypium arboreum [tree cotton]
ref|XP_010249748.1|  PREDICTED: uncharacterized protein At3g03773     92.0    3e-19   Nelumbo nucifera [Indian lotus]
gb|KJB80742.1|  hypothetical protein B456_013G113500                  91.7    3e-19   Gossypium raimondii
ref|NP_001236575.1|  uncharacterized protein LOC100527476             91.3    4e-19   Glycine max [soybeans]
ref|XP_009406560.1|  PREDICTED: uncharacterized protein At3g03773     91.3    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006443478.1|  hypothetical protein CICLE_v10022696mg           90.5    7e-19   Citrus clementina [clementine]
ref|XP_010524994.1|  PREDICTED: uncharacterized protein At3g03773     90.5    8e-19   Tarenaya hassleriana [spider flower]
gb|KDO66094.1|  hypothetical protein CISIN_1g031955mg                 90.1    9e-19   Citrus sinensis [apfelsine]
emb|CDY50383.1|  BnaCnng19150D                                        95.5    1e-18   Brassica napus [oilseed rape]
gb|AEO14616.1|  p23-like protein                                      90.5    1e-18   Zea mays [maize]
ref|XP_010036247.1|  PREDICTED: uncharacterized protein At3g03773     89.7    1e-18   Eucalyptus grandis [rose gum]
ref|XP_002325859.2|  hypothetical protein POPTR_0019s05470g           89.7    2e-18   
gb|KFK37810.1|  hypothetical protein AALP_AA3G032300                  89.7    2e-18   Arabis alpina [alpine rockcress]
gb|KFK42641.1|  hypothetical protein AALP_AA1G021600                  92.0    2e-18   Arabis alpina [alpine rockcress]
ref|XP_002525703.1|  HSP90 co-chaperone, putative                     89.0    2e-18   
ref|XP_001751416.1|  predicted protein                                87.4    5e-18   
ref|XP_007030016.1|  HSP20-like chaperones superfamily protein is...  89.4    6e-18   
ref|XP_007030017.1|  HSP20-like chaperones superfamily protein is...  89.0    7e-18   
ref|XP_002319181.2|  hypothetical protein POPTR_0013s05920g           87.0    8e-18   
gb|EEC75850.1|  hypothetical protein OsI_12851                        87.0    8e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_006375912.1|  hypothetical protein POPTR_0013s05920g           87.8    9e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008784543.1|  PREDICTED: uncharacterized protein At3g03773     87.4    1e-17   Phoenix dactylifera
ref|XP_011001701.1|  PREDICTED: uncharacterized protein At3g03773     87.4    1e-17   Populus euphratica
ref|XP_010922358.1|  PREDICTED: uncharacterized protein OsI_02794...  87.4    1e-17   
gb|AAT78841.1|  putative ripening regulated protein                   87.4    1e-17   
gb|KDP39664.1|  hypothetical protein JCGZ_02684                       86.7    2e-17   
ref|XP_006387881.1|  hypothetical protein POPTR_0502s00200g           87.8    2e-17   
ref|XP_006651649.1|  PREDICTED: uncharacterized protein At3g03773...  86.3    3e-17   
ref|XP_011077748.1|  PREDICTED: uncharacterized protein At3g03773     85.9    3e-17   
gb|EEE59618.1|  hypothetical protein OsJ_11950                        86.3    3e-17   
ref|XP_003561651.1|  PREDICTED: uncharacterized protein At3g03773...  85.5    5e-17   
ref|XP_011034312.1|  PREDICTED: uncharacterized protein At3g03773...  85.5    6e-17   
ref|XP_008676642.1|  PREDICTED: LOC100282649 isoform X1               85.9    7e-17   
tpg|DAA50638.1|  TPA: hypothetical protein ZEAMMB73_821193            85.9    7e-17   
gb|EYU38733.1|  hypothetical protein MIMGU_mgv1a015568mg              84.7    8e-17   
ref|NP_001149029.1|  LOC100282649                                     85.1    9e-17   
ref|XP_004982271.1|  PREDICTED: uncharacterized protein At3g03773...  84.3    1e-16   
ref|XP_011467366.1|  PREDICTED: uncharacterized protein At3g03773     84.0    2e-16   
ref|XP_008244126.1|  PREDICTED: uncharacterized protein At3g03773...  84.0    2e-16   
gb|EMT28462.1|  hypothetical protein F775_24500                       85.5    2e-16   
gb|KEH25572.1|  HSP20-like chaperone superfamily protein              83.6    2e-16   
ref|XP_006339212.1|  PREDICTED: uncharacterized protein At3g03773...  83.6    2e-16   
gb|EMS50884.1|  hypothetical protein TRIUR3_00736                     83.6    2e-16   
ref|XP_010111789.1|  hypothetical protein L484_008793                 84.7    3e-16   
ref|XP_003550101.1|  PREDICTED: uncharacterized protein At3g03773...  81.3    1e-15   
emb|CDP16487.1|  unnamed protein product                              82.4    1e-15   
ref|XP_002466731.1|  hypothetical protein SORBIDRAFT_01g013010        80.1    3e-15   
ref|XP_010312189.1|  PREDICTED: uncharacterized protein At3g03773...  80.5    3e-15   
ref|XP_004249362.1|  PREDICTED: uncharacterized protein At3g03773...  80.1    4e-15   
ref|XP_006405244.1|  hypothetical protein EUTSA_v10000448mg           80.1    5e-15   
ref|XP_010677802.1|  PREDICTED: uncharacterized protein At3g03773     79.3    8e-15   
gb|KJB49926.1|  hypothetical protein B456_008G146000                  79.3    1e-14   
ref|XP_009614070.1|  PREDICTED: uncharacterized protein At3g03773...  77.8    2e-14   
ref|XP_009759594.1|  PREDICTED: uncharacterized protein At3g03773...  77.8    2e-14   
ref|XP_009614071.1|  PREDICTED: uncharacterized protein At3g03773...  77.8    2e-14   
ref|XP_009759595.1|  PREDICTED: uncharacterized protein At3g03773...  77.8    3e-14   
emb|CDW90495.1|  UNKNOWN                                              77.4    6e-14   
ref|XP_003561652.1|  PREDICTED: uncharacterized protein At3g03773...  76.3    9e-14   
ref|XP_009759592.1|  PREDICTED: uncharacterized protein At3g03773...  76.3    1e-13   
ref|XP_009759593.1|  PREDICTED: uncharacterized protein At3g03773...  75.9    1e-13   
gb|KIP08515.1|  hypothetical protein PHLGIDRAFT_104152                75.9    3e-13   
ref|XP_006579379.1|  PREDICTED: uncharacterized protein LOC100527...  74.7    3e-13   
gb|EJY64547.1|  hypothetical protein OXYTRI_15424                     74.7    7e-13   
gb|KDD75545.1|  hypothetical protein H632_c624p0                      73.9    9e-13   
ref|XP_007402477.1|  hypothetical protein PHACADRAFT_107836           74.3    1e-12   
ref|XP_005703152.1|  hypothetical protein Gasu_57530                  72.8    2e-12   
gb|KDP27514.1|  hypothetical protein JCGZ_20154                       71.2    3e-12   
gb|KFA60902.1|  hypothetical protein S40285_04863                     70.5    1e-11   
ref|NP_594586.1|  p23 chaperone protein wos2                          70.9    1e-11   
ref|XP_007805406.1|  hypothetical protein EPUS_08181                  70.9    2e-11   
gb|KIN01266.1|  hypothetical protein OIDMADRAFT_180102                70.5    2e-11   
gb|KEF55504.1|  hypothetical protein A1O9_08254                       70.5    2e-11   
gb|KIY03930.1|  hypothetical protein Z520_00622                       70.1    2e-11   
gb|KEY66933.1|  hypothetical protein S7711_06882                      70.5    2e-11   
gb|KIW33587.1|  hypothetical protein PV07_00424                       70.1    2e-11   
gb|KIW86178.1|  hypothetical protein Z517_01573                       70.1    2e-11   
ref|XP_009063023.1|  hypothetical protein LOTGIDRAFT_167297           69.7    3e-11   
ref|XP_007733594.1|  hypothetical protein A1O3_05279                  70.1    3e-11   
ref|XP_008730292.1|  hypothetical protein G647_07758                  69.7    4e-11   
gb|KIX04374.1|  hypothetical protein Z518_05242                       69.7    4e-11   
gb|KIW64432.1|  hypothetical protein PV04_09365                       69.3    4e-11   
ref|XP_002490155.1|  Co-chaperone that binds to and regulates Hsp...  68.9    6e-11   
ref|XP_007760963.1|  hypothetical protein A1O7_08784                  68.6    9e-11   
gb|EMD41447.1|  hypothetical protein CERSUDRAFT_90011                 68.6    9e-11   
gb|EGO02826.1|  hypothetical protein SERLA73DRAFT_176232              68.6    9e-11   
ref|XP_007740106.1|  hypothetical protein A1O5_01297                  68.6    1e-10   
gb|KIV93686.1|  hypothetical protein PV10_04881                       68.2    1e-10   
ref|XP_007721804.1|  hypothetical protein A1O1_02704                  68.2    1e-10   
ref|XP_002545188.1|  conserved hypothetical protein                   67.8    1e-10   
ref|XP_002628714.1|  conserved hypothetical protein                   67.8    1e-10   
gb|ELT99588.1|  hypothetical protein CAPTEDRAFT_175529                67.8    1e-10   
ref|XP_002505589.1|  predicted protein                                67.4    2e-10   
gb|KIW90779.1|  hypothetical protein Z519_08562                       67.8    2e-10   
ref|XP_003666918.1|  hypothetical protein MYCTH_2312065               66.2    2e-10   
gb|KHJ33705.1|  putative hsp90 associated co-chaperone                68.6    2e-10   
gb|KEQ59873.1|  HSP20-like chaperone                                  66.6    2e-10   
dbj|GAM85028.1|  hypothetical protein ANO11243_030310                 67.8    2e-10   
gb|KIO07430.1|  hypothetical protein M404DRAFT_23943                  66.6    3e-10   
gb|KER00863.1|  hypothetical protein AUEXF2481DRAFT_164090            65.9    4e-10   
ref|XP_009227308.1|  hypothetical protein GGTG_11164                  66.6    4e-10   
ref|XP_007763196.1|  HSP20-like chaperone                             67.0    4e-10   
ref|XP_009261552.1|  hypothetical protein FPSE_10160                  66.6    4e-10   
ref|XP_001417418.1|  predicted protein                                65.1    4e-10   
ref|XP_010730004.1|  PREDICTED: prostaglandin E synthase 3            65.5    5e-10   
ref|XP_008087002.1|  HSP20-like chaperone                             66.2    5e-10   
gb|KIV87240.1|  hypothetical protein PV11_02798                       66.2    5e-10   
emb|CCF35904.1|  Wos2                                                 66.2    5e-10   
gb|EHK97651.1|  putative protein wos2                                 66.2    6e-10   
ref|XP_001596171.1|  hypothetical protein SS1G_02387                  65.9    8e-10   
gb|KFH43429.1|  hypothetical protein ACRE_058210                      64.7    9e-10   
ref|XP_011395585.1|  Uncharacterized protein F751_6760                65.5    9e-10   
gb|KEQ73539.1|  HSP20-like chaperone                                  64.7    1e-09   
emb|CAD98707.1|  p23 co-chaperone, probable                           65.1    1e-09   
ref|XP_003737019.1|  PREDICTED: prostaglandin E synthase 3-like       64.7    1e-09   
gb|ESZ90227.1|  CS domain-containing protein                          65.5    1e-09   
ref|XP_666939.1|  p23 co-chaperone                                    64.7    2e-09   
ref|XP_011146741.1|  PREDICTED: prostaglandin E synthase 3 isofor...  64.3    2e-09   
gb|KIW44022.1|  hypothetical protein PV06_05065                       64.7    2e-09   
ref|XP_011146742.1|  PREDICTED: prostaglandin E synthase 3 isofor...  63.9    2e-09   
gb|EUN29802.1|  hypothetical protein COCVIDRAFT_35427                 65.1    2e-09   
gb|KIW11856.1|  hypothetical protein PV08_09129                       64.7    2e-09   
ref|XP_011301796.1|  PREDICTED: prostaglandin E synthase 3 isofor...  63.9    2e-09   
ref|XP_011325563.1|  hypothetical protein FGSG_10831                  64.7    2e-09   
ref|XP_003835711.1|  hypothetical protein LEMA_P050520.1              64.7    2e-09   
gb|EEH05143.1|  cell cycle regulator p21 protein                      64.3    2e-09   
ref|XP_009153341.1|  hypothetical protein HMPREF1120_01086            64.3    3e-09   
ref|XP_627530.1|  p23; HSP20-like chaperones fold                     64.3    3e-09   
ref|XP_502241.1|  YALI0D00429p                                        65.1    3e-09   
emb|CAX72392.1|  Conserved hypothetical protein                       63.9    3e-09   
gb|KJB80744.1|  hypothetical protein B456_013G113500                  62.4    3e-09   
gb|KEQ87580.1|  HSP20-like chaperone                                  64.7    3e-09   
ref|XP_011301791.1|  PREDICTED: prostaglandin E synthase 3 isofor...  63.5    4e-09   
ref|XP_001828956.1|  wos2                                             63.9    4e-09   
ref|XP_008716482.1|  hypothetical protein HMPREF1541_03912            63.9    4e-09   
ref|XP_008596946.1|  Hsp90 associated co-chaperone                    63.5    5e-09   
gb|KIK47968.1|  hypothetical protein CY34DRAFT_798829                 63.9    5e-09   
ref|XP_007716764.1|  hypothetical protein COCCADRAFT_8792             63.9    5e-09   
dbj|GAD93137.1|  Hsp90 binding co-chaperone (Sba1), putative          63.5    6e-09   
gb|EHK45396.1|  hypothetical protein TRIATDRAFT_169917                63.5    6e-09   
gb|KIW60525.1|  hypothetical protein PV05_00737                       63.2    6e-09   
gb|KGQ04193.1|  Protein wos2                                          63.2    6e-09   
ref|XP_003709374.1|  hypothetical protein MGG_06669                   63.2    7e-09   
emb|CEP11024.1|  hypothetical protein                                 62.4    7e-09   
gb|EQK98614.1|  Hsp90 binding co-chaperone Sba1                       63.2    7e-09   
ref|XP_001745103.1|  hypothetical protein                             64.3    8e-09   
gb|KIK97887.1|  hypothetical protein PAXRUDRAFT_824469                63.2    8e-09   
ref|XP_003350804.1|  hypothetical protein SMAC_02474                  63.2    8e-09   
ref|XP_001555275.1|  hypothetical protein BC1G_05980                  63.2    8e-09   
gb|EMF09545.1|  HSP20-like chaperone                                  63.5    9e-09   
gb|KIJ21402.1|  hypothetical protein PAXINDRAFT_64441                 63.5    9e-09   
ref|XP_002951829.1|  hypothetical protein VOLCADRAFT_75159            62.8    9e-09   
ref|XP_005538124.1|  hsp90 co-chaperone p23                           63.2    9e-09   
ref|XP_001536563.1|  predicted protein                                62.8    1e-08   
ref|XP_003069101.1|  protein wos2, putative                           62.4    1e-08   
ref|XP_001240168.1|  hypothetical protein CIMG_09789                  62.4    1e-08   
gb|EHK26588.1|  hypothetical protein TRIVIDRAFT_120772                62.0    1e-08   
gb|ADV40360.1|  putative p23-like protein                             61.6    1e-08   
ref|XP_006796566.1|  PREDICTED: prostaglandin E synthase 3-like       61.6    1e-08   
emb|CAX79533.1|  Conserved hypothetical protein                       62.0    1e-08   
emb|CEJ79895.1|  Putative Hsp90 binding co-chaperone Sba1             62.4    1e-08   
emb|CAX79528.1|  Conserved hypothetical protein                       62.4    1e-08   
emb|CAX79556.1|  Conserved hypothetical protein                       62.0    1e-08   
gb|AAW26530.1|  SJCHGC02843 protein                                   62.0    1e-08   
gb|KHN99187.1|  HSP20-like chaperone                                  62.4    1e-08   
ref|XP_007297430.1|  hsp90-binding co-chaperone                       62.4    1e-08   
ref|XP_001824269.1|  Hsp90 binding co-chaperone (Sba1)                62.4    1e-08   
ref|XP_003439023.1|  PREDICTED: prostaglandin E synthase 3-like       61.6    2e-08   
ref|XP_004546275.1|  PREDICTED: prostaglandin E synthase 3-like       61.6    2e-08   
ref|XP_011055805.1|  PREDICTED: prostaglandin E synthase 3-like       61.6    2e-08   
ref|XP_003657768.1|  hypothetical protein THITE_75424                 62.4    2e-08   
ref|XP_007776483.1|  hypothetical protein W97_00378                   62.8    2e-08   
gb|EME40800.1|  hypothetical protein DOTSEDRAFT_74381                 62.8    2e-08   
gb|EPS32670.1|  hypothetical protein PDE_07630                        62.0    2e-08   
gb|KFM61744.1|  Protein wos2                                          61.2    2e-08   
ref|XP_005926238.1|  PREDICTED: prostaglandin E synthase 3-like       61.2    2e-08   
gb|KIW06655.1|  hypothetical protein PV09_02363                       61.6    2e-08   
ref|XP_005649882.1|  HSP20-like chaperone                             61.2    2e-08   
ref|XP_002381379.1|  Hsp90 binding co-chaperone (Sba1), putative      62.4    2e-08   
ref|XP_007702854.1|  hypothetical protein COCSADRAFT_148384           62.0    3e-08   
gb|EFX03962.1|  hsp90-binding co-chaperone                            62.0    3e-08   
gb|ERS96320.1|  hypothetical protein HMPREF1624_07230                 61.6    3e-08   
gb|EPE06267.1|  hsp90 associated co-chaperone                         62.0    3e-08   
gb|ABA28992.1|  p23                                                   60.5    3e-08   
ref|XP_005801811.1|  PREDICTED: prostaglandin E synthase 3-like       60.5    3e-08   
gb|KIH95193.1|  protein wos2                                          61.6    3e-08   
ref|XP_008281876.1|  PREDICTED: prostaglandin E synthase 3            60.5    4e-08   
ref|XP_007835718.1|  hypothetical protein PFICI_08946                 60.8    4e-08   
ref|XP_005098825.1|  PREDICTED: uncharacterized protein ZC395.10-...  60.5    4e-08   
emb|CAX72397.1|  Conserved hypothetical protein                       60.8    4e-08   
ref|XP_005098826.1|  PREDICTED: uncharacterized protein ZC395.10-...  60.5    4e-08   
ref|XP_001524089.1|  conserved hypothetical protein                   61.6    4e-08   
ref|XP_007687014.1|  hypothetical protein COCMIDRAFT_4487             61.2    4e-08   
emb|CEF97421.1|  HSP20-like chaperone                                 61.2    4e-08   
ref|XP_009540362.1|  hypothetical protein HETIRDRAFT_42374            61.2    4e-08   
ref|XP_001805132.1|  hypothetical protein SNOG_14967                  59.7    4e-08   
ref|XP_011155372.1|  PREDICTED: prostaglandin E synthase 3 isofor...  60.8    4e-08   
gb|ADP36948.1|  hypothetical protein                                  60.5    5e-08   
ref|XP_011155371.1|  PREDICTED: prostaglandin E synthase 3 isofor...  60.8    5e-08   
gb|KDQ30366.1|  hypothetical protein PLEOSDRAFT_1088350               61.2    5e-08   
ref|XP_007793716.1|  putative hsp90 associated co-chaperone protein   60.8    5e-08   
emb|CDK28392.1|  unnamed protein product                              60.8    5e-08   
ref|XP_001692528.1|  p23 co-chaperone of HSP90 system                 59.3    5e-08   
gb|EEH18572.2|  hypothetical protein PABG_07632                       60.8    5e-08   
gb|KIO31180.1|  hypothetical protein M407DRAFT_241886                 60.8    5e-08   
ref|XP_007930720.1|  hypothetical protein MYCFIDRAFT_123576           59.3    5e-08   
ref|XP_006691093.1|  putative Co-chaperone protein                    60.8    5e-08   
ref|XP_007368799.1|  HSP20-like chaperone                             60.8    6e-08   
ref|XP_005755520.1|  PREDICTED: very-long-chain (3R)-3-hydroxyacy...  60.1    6e-08   
ref|XP_006673744.1|  Hsp90 binding co-chaperone Sba1                  60.5    6e-08   
ref|XP_010760244.1|  hypothetical protein PADG_05032                  60.8    6e-08   
emb|CCE39706.1|  hypothetical protein CPAR2_601260                    61.2    6e-08   
ref|XP_003870580.1|  Sba1 protein                                     61.2    6e-08   
gb|EMG50117.1|  Co-chaperone protein, putative                        60.8    6e-08   
ref|XP_009852169.1|  hypothetical protein NEUTE1DRAFT_117392          60.8    7e-08   
gb|EKG22102.1|  hypothetical protein MPH_00557                        61.6    7e-08   
ref|XP_004070854.1|  PREDICTED: prostaglandin E synthase 3            59.7    7e-08   
ref|XP_002793090.1|  Hsp90 binding co-chaperone (Sba1)                60.1    7e-08   
gb|KJA29359.1|  hypothetical protein HYPSUDRAFT_127652                60.8    7e-08   
ref|XP_007314723.1|  hypothetical protein SERLADRAFT_380296           60.8    7e-08   
ref|XP_956470.2|  heat shock protein 90-associated                    60.5    8e-08   
gb|EEH34177.2|  Hsp90 binding co-chaperone (Sba1)                     60.1    9e-08   
ref|XP_006968134.1|  predicted protein                                60.1    9e-08   
emb|CDO70896.1|  hypothetical protein BN946_scf184829.g4              60.1    1e-07   
gb|EPS99586.1|  hypothetical protein FOMPIDRAFT_1024083               60.5    1e-07   
gb|ETR98960.1|  HSP20-like chaperone                                  60.1    1e-07   
emb|CDX96489.1|  BnaA07g31000D                                        58.9    1e-07   
gb|KFZ13253.1|  hypothetical protein V501_03777                       60.1    1e-07   
ref|XP_001930878.1|  hypothetical protein PTRG_00545                  60.1    1e-07   
ref|XP_011340387.1|  PREDICTED: prostaglandin E synthase 3 isofor...  58.9    1e-07   
gb|KIY98474.1|  hypothetical protein MNEG_9489                        60.1    1e-07   
gb|KFY75474.1|  hypothetical protein V499_04563                       60.1    1e-07   
gb|EZA53333.1|  Prostaglandin E synthase                              58.9    1e-07   
ref|XP_011340388.1|  PREDICTED: prostaglandin E synthase 3 isofor...  58.9    1e-07   
ref|XP_003303649.1|  hypothetical protein PTT_15960                   59.7    2e-07   
ref|XP_008030399.1|  hypothetical protein SETTUDRAFT_165569           59.7    2e-07   
gb|EUC65580.1|  CS domain protein                                     60.1    2e-07   
emb|CDH60308.1|  hypothetical protein RO3G_03344                      58.9    2e-07   
gb|KEP52150.1|  CS domain protein                                     59.7    2e-07   
gb|AHG98269.1|  prostaglandin E synthase 3                            58.5    2e-07   
gb|ACM08767.1|  Prostaglandin E synthase 3                            58.5    2e-07   
ref|XP_001692527.1|  p23 co-chaperone of HSP90 system                 59.3    2e-07   
gb|EMD91595.1|  hypothetical protein COCHEDRAFT_1021520               59.3    3e-07   
emb|CDS09429.1|  hypothetical protein LRAMOSA10789                    58.2    3e-07   
dbj|GAK68323.1|  p23 chaperone protein wos2                           58.9    3e-07   



>ref|XP_011074127.1| PREDICTED: uncharacterized protein OsI_027940-like [Sesamum indicum]
Length=180

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITVELPDAKNVK  L+PEGKF+F+A +GADNTP+E+  +L+DKVDVNESK S TSR
Sbjct  14   DKLFITVELPDAKNVKLNLDPEGKFFFSATSGADNTPYEIDIDLYDKVDVNESKASFTSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             ICYLVKKA++KWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK
Sbjct  74   SICYLVKKADNKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  117



>ref|XP_009785922.1| PREDICTED: uncharacterized protein OsI_027940-like [Nicotiana 
sylvestris]
Length=184

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK++V+ESK STTSR
Sbjct  14   DKLFITVELPDAKNVKLKLEPEGKFFFSATAGADNVPYEVDLDLFDKINVDESKTSTTSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  74   SIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>ref|XP_009604975.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Nicotiana tomentosiformis]
Length=190

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK++V+ESK STTSR
Sbjct  14   DKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDKINVDESKTSTTSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  74   SIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>ref|XP_009604976.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Nicotiana tomentosiformis]
Length=184

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK++V+ESK STTSR
Sbjct  14   DKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDKINVDESKTSTTSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  74   SIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>gb|AIL30486.1| ripening regulated protein DDTFR8 [Nicotiana tabacum]
Length=184

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITVELPDAKNVK KLEPEGKF+F+A AGADN P+EV  +LFDK++V+ESK STTSR
Sbjct  14   DKLFITVELPDAKNVKLKLEPEGKFFFSAIAGADNVPYEVDLDLFDKINVDESKTSTTSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  74   SIVYLVKKAEDKWWSRLIKQEGVRPVFLKVDWDKWVDEDEEDTKP  118



>ref|XP_006360297.1| PREDICTED: uncharacterized protein Os08g0359500-like [Solanum 
tuberosum]
Length=182

 Score =   175 bits (444),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK+DV+ESK S TSR
Sbjct  14   DKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDKIDVDESKSSITSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             ICYLVKKAED WWSRL+KQEGK P FLK DWDKW+DEDEQD +P
Sbjct  74   NICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWIDEDEQDSEP  118



>ref|NP_001234685.1| ripening regulated protein DDTFR8 [Solanum lycopersicum]
 gb|AAG49030.1|AF204783_1 ripening regulated protein DDTFR8 [Solanum lycopersicum]
Length=179

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK++V+ESK STTSR
Sbjct  14   DKLFITVELPDAKNVKLKLEPEGKFLFSATAGADNVPYEVDLDLFDKINVDESKSSTTSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             I YLVKKAEDKWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  74   SIVYLVKKAEDKWWSRLVKQEGLRPVFLKVDWDKWVDEDEEDSKP  118



>emb|CDP01142.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+LFITVELPDA NV  KLEPEGKF F+A  G DNTP+EV F+LFDKVD NESK S TSR
Sbjct  9    DRLFITVELPDANNVTHKLEPEGKFLFSATTGVDNTPYEVEFDLFDKVDANESKISATSR  68

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             ICYLV+KAE+KWW RLLKQ GKPP+FLKVDWDKWVDEDEQDEK
Sbjct  69   NICYLVQKAENKWWGRLLKQSGKPPIFLKVDWDKWVDEDEQDEK  112



>gb|EYU36540.1| hypothetical protein MIMGU_mgv1a018670mg, partial [Erythranthe 
guttata]
Length=136

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLF+TVELPDAKNVK  L+PEGKF+F+A  G DN P+E+  +L+DKV V+ESK S TSR
Sbjct  20   DKLFVTVELPDAKNVKLNLDPEGKFFFSATGGVDNVPYEIDIDLYDKVVVDESKASCTSR  79

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
            +ICYLVKKAE KWWSRLLKQ GKPP+FLKVDWDKWVDEDEQDEK
Sbjct  80   HICYLVKKAESKWWSRLLKQGGKPPLFLKVDWDKWVDEDEQDEK  123



>ref|XP_004252558.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Solanum 
lycopersicum]
Length=180

 Score =   172 bits (437),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK+DV+ES+ S TSR
Sbjct  14   DKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDKIDVDESQSSITSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             ICYLVKKAED WWSRL+KQEGK P FLK DWDKWVDEDEQD +P
Sbjct  74   NICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWVDEDEQDGEP  118



>ref|XP_010314468.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Solanum 
lycopersicum]
Length=179

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITVELPDAKNVK KLEPEGKF F+A AGADN P+EV  +LFDK+DV+ES+ S TSR
Sbjct  14   DKVFITVELPDAKNVKQKLEPEGKFSFSATAGADNVPYEVVLDLFDKIDVDESQSSITSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             ICYLVKKAED WWSRL+KQEGK P FLK DWDKWVDEDEQD +P
Sbjct  74   NICYLVKKAEDNWWSRLIKQEGKSPTFLKADWDKWVDEDEQDGEP  118



>ref|XP_006359015.1| PREDICTED: uncharacterized protein OsI_027940-like [Solanum tuberosum]
Length=180

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITVELPDAKNVK KLEPEGKF F+A AG DN P+EV  +LFDK++V+ESK STTSR
Sbjct  14   DKLFITVELPDAKNVKLKLEPEGKFLFSATAGDDNVPYEVDLDLFDKINVDESKSSTTSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             I YLVKKAE+KWWSRL+KQEG  PVFLKVDWDKWVDEDE+D KP
Sbjct  74   SIVYLVKKAEEKWWSRLIKQEGLRPVFLKVDWDKWVDEDEEDGKP  118



>ref|XP_006574773.1| PREDICTED: uncharacterized protein OsI_027940-like [Glycine max]
 gb|KHN00714.1| Hypothetical protein glysoja_000382 [Glycine soja]
Length=191

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D L++TVELPDA++VK KLEPEGKFYF+A AGA+  P+EV  +LFDK+DVN SK S  SR
Sbjct  14   DVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDKIDVNNSKASVGSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED-EQDEKP  412
            +ICYLVKKAE+KWW RLLKQ GK PVFLKVDWDKWVDED EQD KP
Sbjct  74   HICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKP  119



>ref|XP_002893745.1| hypothetical protein ARALYDRAFT_336372 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70004.1| hypothetical protein ARALYDRAFT_336372 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP+GKF+F+A +GA  TP+EV  +LFD VDVNESK S  SR
Sbjct  14   DKVYITVELPDAEDVKLKLEPQGKFFFSATSGASKTPYEVDLDLFDNVDVNESKASVNSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGKPPVFLKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWNRLIKQEGKPPVFLKVDWDKWVDEDE  113



>gb|KHN32820.1| Hypothetical protein glysoja_024179 [Glycine soja]
Length=189

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D L++TVELPDA++VK KLEPEGKFYF+A AGA+  P+EV  +LFDK+DVN SK S  SR
Sbjct  14   DVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDKIDVNNSKASVGSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED-EQDEKP  412
             ICYLVKKAE+KWW RLLKQ GK PVFLKVDWDKWVDED EQD KP
Sbjct  74   NICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKP  119



>ref|NP_001237326.1| uncharacterized protein LOC100527783 [Glycine max]
 gb|ACU16956.1| unknown [Glycine max]
Length=189

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D L++TVELPDA++VK KLEPEGKFYF+A AGA+  P+EV  +LFDK+DVN SK S  SR
Sbjct  14   DVLYLTVELPDAQDVKLKLEPEGKFYFSATAGAEKIPYEVDIDLFDKIDVNNSKASVGSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED-EQDEKP  412
             ICYLVKKAE+KWW RLLKQ GK PVFLKVDWDKWVDED EQD KP
Sbjct  74   NICYLVKKAENKWWDRLLKQGGKSPVFLKVDWDKWVDEDEEQDNKP  119



>ref|XP_008780776.1| PREDICTED: uncharacterized protein Os08g0359500-like [Phoenix 
dactylifera]
Length=182

 Score =   162 bits (411),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++IT+ELPDAK+VK  L+P+G FYF+A +GADN P+E+ FELFDKV+V ESK S   R
Sbjct  14   DKVYITIELPDAKDVKLNLQPDGHFYFSAASGADNVPYEIDFELFDKVNVEESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAE KWWSRLLK+EGKPPVFLKVDWDKW+DED+  E
Sbjct  74   TICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDTE  116



>ref|XP_010926229.1| PREDICTED: uncharacterized protein Os08g0359500-like [Elaeis 
guineensis]
Length=187

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++IT+ELPDAK+VK  L+P G FYF+A +GADN P+E+ FELFDKV+V ESK S   R
Sbjct  14   DKVYITIELPDAKDVKLNLQPGGHFYFSAASGADNVPYEIDFELFDKVNVEESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAE KWWSRLLK+EGKPPVFLKVDWDKW+DED+  E
Sbjct  74   TICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDKE  116



>ref|XP_010243328.1| PREDICTED: uncharacterized protein OsI_027940-like [Nelumbo nucifera]
Length=175

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++IT+ELPDAK+V  KLEPEGKF+F+A +GAD TP+E+  +L+DKVDV+ESK S   R
Sbjct  14   DKVYITIELPDAKDVNLKLEPEGKFFFSATSGADKTPYEIDIDLYDKVDVDESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKK E KWWSR LKQEGKPPVFLKVDWDKWVDEDE+ E
Sbjct  74   NICYLVKKVEKKWWSRFLKQEGKPPVFLKVDWDKWVDEDEEQE  116



>ref|XP_008811572.1| PREDICTED: uncharacterized protein Os08g0359500-like [Phoenix 
dactylifera]
Length=186

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK  L+P+G FYF+A +GADNTP+E+ FEL DKV V ESK +   R
Sbjct  14   DKVYLTIELPDAKDVKLNLQPDGHFYFSATSGADNTPYEIDFELLDKVSVEESKAAIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAE KWWSRLLK+EGKPPVFLKVDWDKW+DED+ +E
Sbjct  74   NICYLVKKAEKKWWSRLLKKEGKPPVFLKVDWDKWIDEDDDNE  116



>ref|XP_006434560.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47800.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83851.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=184

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 124/175 (71%), Gaps = 8/175 (5%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DKVDVNESK S   R
Sbjct  14   DRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDKVDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKPgagmdfggddfdF  373
             I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP A MDFG  DF  
Sbjct  74   NIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKPPADMDFGDLDFSK  133

Query  372  SNLSMggpgdfdadaagdddddddsDTEEEGKEIETGAASSEVQAHAPCSEPETK  208
             N+            A   D++D+SDTEEE +   T A + E    +  SEP+TK
Sbjct  134  MNMG------GLDAEAAGGDENDESDTEEENEVGTTPAGNREAPPPSTSSEPDTK  182



>ref|XP_007020190.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
 gb|EOY17415.1| HSP20-like chaperones superfamily protein [Theobroma cacao]
Length=182

 Score =   160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +FIT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L DKVDV ESK S   R
Sbjct  14   DVVFITIDLPDAQDVKLKLEPEGKFFFSATSGVDKIPYEVDIDLRDKVDVAESKASVGKR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAE+KWWSRLLKQEGKPPVFLKVDWDKWVDEDE+D+
Sbjct  74   NICYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWVDEDEEDQ  116



>ref|XP_010916995.1| PREDICTED: uncharacterized protein OsI_027940-like [Elaeis guineensis]
Length=187

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++IT+ELPDAK+VK  L+P+G FYF A +GADN P+E+ FELFDKV+V ES+ +   R
Sbjct  14   DKVYITIELPDAKDVKLNLQPDGHFYFYATSGADNIPYEIDFELFDKVNVEESRAAIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAE KWWSRLLK EG+PPVFLK DWDKW+DED+++E
Sbjct  74   NICYLVKKAEKKWWSRLLKNEGRPPVFLKADWDKWIDEDDENE  116



>ref|XP_006473157.1| PREDICTED: uncharacterized protein OsI_027940-like [Citrus sinensis]
Length=184

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 123/175 (70%), Gaps = 8/175 (5%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DKVDVNESK S   R
Sbjct  14   DRVYITIDLPDAQDVKLKLEPEGKFFFSAISGPDKIPYEVDIDLYDKVDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKPgagmdfggddfdF  373
             I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D KP A MDFG  DF  
Sbjct  74   NIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDNKPPADMDFGDLDFSK  133

Query  372  SNLSMggpgdfdadaagdddddddsDTEEEGKEIETGAASSEVQAHAPCSEPETK  208
             N+            A   D++D+SDTEEE +   T A + E    +  SEP+TK
Sbjct  134  MNMG------GFDAEAAGGDENDESDTEEENEVGATPAGNREAPPPSTSSEPDTK  182



>ref|XP_006434561.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47801.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83852.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=139

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DKVDVNESK S   R
Sbjct  14   DRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDKVDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKP  412
             I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP
Sbjct  74   NIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120



>ref|XP_006434559.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47799.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|KDO83850.1| hypothetical protein CISIN_1g030007mg [Citrus sinensis]
Length=182

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 2/107 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DKVDVNESK S   R
Sbjct  14   DRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDKVDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKP  412
             I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP
Sbjct  74   NIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKP  120



>ref|XP_010461085.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=181

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ VDVNESK S +SR
Sbjct  14   DKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFESVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010461087.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=180

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ VDVNESK S +SR
Sbjct  13   DKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFESVDVNESKASVSSR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  73   CICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  112



>ref|XP_010461088.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X4 
[Camelina sativa]
Length=179

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ VDVNESK S +SR
Sbjct  14   DKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFESVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010461086.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=181

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP GKF+F+A +G   TP+EV  +LF+ VDVNESK S +SR
Sbjct  14   DKVYITVELPDAEDVKVKLEPHGKFFFSATSGPSKTPYEVDIDLFESVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_011044819.1| PREDICTED: uncharacterized protein OsI_027940-like [Populus euphratica]
Length=186

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFITV+LPDA++VKFKLEPEGKF+F+A +GAD TP+E+  EL DKV+V ESK    SR
Sbjct  14   DKLFITVQLPDAQDVKFKLEPEGKFFFSATSGADKTPYEIELELLDKVNVEESKAGIGSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I Y+VKKAE+KWWSRL+K  GKPPVFL VDWDKW+DEDE+
Sbjct  74   NIQYIVKKAENKWWSRLIKPTGKPPVFLTVDWDKWIDEDEE  114



>ref|XP_010478707.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=182

 Score =   154 bits (390),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KL+P GKF+F+A +G   TP+EV  +LF+ VDVNESK S +SR
Sbjct  14   DKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFESVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010478706.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=182

 Score =   154 bits (390),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KL+P GKF+F+A +G   TP+EV  +LF+ VDVNESK S +SR
Sbjct  13   DKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFESVDVNESKASVSSR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  73   CICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  112



>ref|XP_010478705.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=183

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KL+P GKF+F+A +G   TP+EV  +LF+ VDVNESK S +SR
Sbjct  14   DKVYITVELPDAEDVKVKLDPHGKFFFSATSGPSKTPYEVEIDLFESVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW+RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWNRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_008237431.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X2 [Prunus mume]
Length=236

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT++LPDA++VK  LEPEGKF F+A  G + TP+E+  +L+DK+DVNESK S   R
Sbjct  14   DTVYITIDLPDAQDVKLNLEPEGKFLFSATTGPEKTPYEIDLDLYDKIDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  74   NICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_008237430.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X1 [Prunus mume]
Length=237

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT++LPDA++VK  LEPEGKF F+A  G + TP+E+  +L+DK+DVNESK S   R
Sbjct  14   DTVYITIDLPDAQDVKLNLEPEGKFLFSATTGPEKTPYEIDLDLYDKIDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  74   NICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_011458453.1| PREDICTED: uncharacterized protein OsI_027940-like [Fragaria 
vesca subsp. vesca]
Length=183

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D L+IT++LPDA++VK KL PEGKF F+A  G + TP+EV  +L+DK+DVNESK S   R
Sbjct  14   DTLYITIDLPDAQDVKLKLGPEGKFLFSATTGKEKTPYEVDLDLYDKIDVNESKASIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             ICYLVKKAE KWWSRL+KQEGK PVFLKVDWDKWVDEDE+
Sbjct  74   NICYLVKKAESKWWSRLIKQEGKAPVFLKVDWDKWVDEDEE  114



>ref|XP_007201255.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
 gb|EMJ02454.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
Length=236

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT+ LPDA +VK  LEPEGKF F+A  G + TP+EV  +L+DK+DVNESK S   R
Sbjct  14   DTVYITINLPDAHDVKLNLEPEGKFLFSATTGPEKTPYEVDLDLYDKIDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  74   NICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_007201254.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
 gb|EMJ02453.1| hypothetical protein PRUPE_ppa010769mg [Prunus persica]
Length=237

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT+ LPDA +VK  LEPEGKF F+A  G + TP+EV  +L+DK+DVNESK S   R
Sbjct  14   DTVYITINLPDAHDVKLNLEPEGKFLFSATTGPEKTPYEVDLDLYDKIDVNESKASVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAEDKWWSRL+KQ+GK PVFLKVDWDKWVDEDE+ E
Sbjct  74   NICYLVKKAEDKWWSRLIKQQGKAPVFLKVDWDKWVDEDEEPE  116



>ref|XP_007151931.1| hypothetical protein PHAVU_004G088000g [Phaseolus vulgaris]
 gb|ESW23925.1| hypothetical protein PHAVU_004G088000g [Phaseolus vulgaris]
Length=189

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D L++TVELPDA++VK KLEPEGKF+F+A AG++  P+EV  +LFD++DVN SK S  SR
Sbjct  14   DVLYLTVELPDAQDVKLKLEPEGKFHFSATAGSEKIPYEVDIDLFDEIDVNNSKASVGSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             ICYLVKK E+KWW RLLK+ GK PVFLKVDWDKWVDEDE+
Sbjct  74   NICYLVKKTENKWWDRLLKKGGKTPVFLKVDWDKWVDEDEE  114



>ref|XP_002307531.2| hypothetical protein POPTR_0005s22140g, partial [Populus trichocarpa]
 gb|EEE94527.2| hypothetical protein POPTR_0005s22140g, partial [Populus trichocarpa]
Length=205

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLFI V+LPDA++VKFKLEPEGKF+F+A +GAD TP+E+  +L DKV+V ESK    SR
Sbjct  30   DKLFIIVQLPDAQDVKFKLEPEGKFFFSATSGADKTPYEIELDLLDKVNVEESKAGIGSR  89

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I Y+VKKAE+KWWSRL+KQ GKPPVFL VDWDKW+DEDE+
Sbjct  90   NIQYIVKKAENKWWSRLIKQTGKPPVFLTVDWDKWIDEDEE  130



>ref|XP_010499807.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Camelina sativa]
Length=181

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP GKF+F+A +    TP+EV  +LF+ VDVNESK S +SR
Sbjct  13   DKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFESVDVNESKASVSSR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  73   CICYMVKKAESKWWDRLIKQEGKTPVYLKVDWDKWVDEDE  112



>ref|XP_010499806.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Camelina sativa]
Length=182

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP GKF+F+A +    TP+EV  +LF+ VDVNESK S +SR
Sbjct  14   DKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFESVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWDRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_010499808.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Camelina sativa]
Length=180

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITVELPDA++VK KLEP GKF+F+A +    TP+EV  +LF+ VDVNESK S +SR
Sbjct  14   DKVYITVELPDAEDVKVKLEPHGKFFFSATSEPTKTPYEVDIDLFESVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             ICY+VKKAE KWW RL+KQEGK PV+LKVDWDKWVDEDE
Sbjct  74   CICYMVKKAESKWWDRLIKQEGKTPVYLKVDWDKWVDEDE  113



>ref|XP_009409147.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=185

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++IT+ELPDAK+VK  LEPEG+FYF+A +G  N  +E+  ELFD+V V+ESK +   R
Sbjct  14   DKVYITIELPDAKDVKLTLEPEGRFYFSATSGTANIRYELDLELFDRVIVDESKAAVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             ICYLVKKAE KWWSRLLKQ GKPPV+LKVDWDKW+DED++ E
Sbjct  74   TICYLVKKAEKKWWSRLLKQAGKPPVYLKVDWDKWIDEDDEKE  116



>ref|XP_002300889.2| hypothetical protein POPTR_0002s06240g [Populus trichocarpa]
 gb|EEE80162.2| hypothetical protein POPTR_0002s06240g [Populus trichocarpa]
Length=184

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D LFITV+LPDA++VK K+EPEGKF+F+A +G D  P+EV  +L DKV V ESK ST SR
Sbjct  14   DNLFITVQLPDAQDVKLKIEPEGKFFFSATSGVDKIPYEVELDLLDKVIVEESKASTGSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I Y+VKKAE+KWWSRL+KQ GKPPVFL VDWDKW+DEDE+
Sbjct  74   SIQYIVKKAENKWWSRLIKQTGKPPVFLTVDWDKWIDEDEE  114



>ref|XP_002265220.1| PREDICTED: uncharacterized protein OsI_027940-like [Vitis vinifera]
Length=178

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT++LPDAK+V  KLEPEGKF+F+A +GAD  P+E+  +LFDKVDVNESK S   R
Sbjct  14   DTIYITIDLPDAKDVNLKLEPEGKFFFSATSGADKIPYEIDIDLFDKVDVNESKASIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I YLVKKAE+KWWSRLLKQEGKPPVFLKVDWDKWV
Sbjct  74   NIRYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWV  109



>ref|NP_001050241.1| Os03g0381300 [Oryza sativa Japonica Group]
 gb|AAR96242.1| putative ripening regulated protein [Oryza sativa Japonica Group]
 gb|ABF96270.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12155.1| Os03g0381300 [Oryza sativa Japonica Group]
Length=173

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+T+ELPDA++VK  L+PEG+F F+A+  AD+TP+E+  ELFD V+V ESK +  +R
Sbjct  14   DKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDAVNVEESKAAVAAR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  74   SICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>gb|EAY90254.1| hypothetical protein OsI_11826 [Oryza sativa Indica Group]
Length=171

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+T+ELPDA++VK  L+PEG+F F+A+  AD+TP+E+  ELFD V+V ESK +  +R
Sbjct  14   DKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDAVNVEESKAAVAAR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  74   SICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>ref|XP_004140943.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 gb|KGN46095.1| hypothetical protein Csa_6G052700 [Cucumis sativus]
Length=191

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+LFIT++LPDA++VK KL+PEGKF F+A +G +  P+EV  +L+DKVD+NESK S   R
Sbjct  14   DRLFITIDLPDAQDVKLKLDPEGKFCFSAVSGTEKIPYEVDIDLYDKVDINESKASIGMR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I YL++KAE KWWSRLLKQEGKPPVF+K+DWDKW+DEDE+
Sbjct  74   NILYLIEKAEKKWWSRLLKQEGKPPVFVKIDWDKWIDEDEE  114



>gb|ABF96271.1| expressed protein [Oryza sativa Japonica Group]
Length=160

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+T+ELPDA++VK  L+PEG+F F+A+  AD+TP+E+  ELFD V+V ESK +  +R
Sbjct  14   DKVFLTIELPDARDVKLNLKPEGQFIFSAKGPADDTPYELDLELFDAVNVEESKAAVAAR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  74   SICYLIKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>gb|KHF97613.1| hypothetical protein F383_14672 [Gossypium arboreum]
Length=182

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +FIT+ELPDA++VK KLEPEGKF+F+A++GAD  P+EV  +L DKVDV+ SK S  +R
Sbjct  14   DDVFITIELPDAQDVKLKLEPEGKFFFSAKSGADKIPYEVDLDLHDKVDVDGSKASVGNR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             ICYLVKKAE KWWSRLLKQEG+PPVFLKVDWD+W
Sbjct  74   NICYLVKKAESKWWSRLLKQEGRPPVFLKVDWDRW  108



>gb|KJB59532.1| hypothetical protein B456_009G259900 [Gossypium raimondii]
Length=182

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +FIT+ELPDA++VK KLEPEGKF+F+A++GAD  P+EV  +L DKVDV+ SK S  +R
Sbjct  14   DDVFITIELPDAQDVKLKLEPEGKFFFSAKSGADKIPYEVDLDLHDKVDVDGSKASVGNR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             ICYLVKKAE KWWSRLLKQEG+PPVFLKVDWD+W
Sbjct  74   NICYLVKKAESKWWSRLLKQEGRPPVFLKVDWDRW  108



>ref|XP_009380995.1| PREDICTED: uncharacterized protein At3g03773-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   149 bits (377),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++I +ELPDAK+VKF L+P+G+FYF+A +GA+N P+E+ FELFDKV+V+ESK +   R
Sbjct  14   DKVYIIIELPDAKDVKFTLQPDGRFYFSATSGAENIPYELDFELFDKVNVDESKAAVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             ICYLVKKAE KWWSRLLK  GKPPV+LKVDWDKW+
Sbjct  74   TICYLVKKAEKKWWSRLLKTAGKPPVYLKVDWDKWI  109



>ref|XP_004159475.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
Length=191

 Score =   150 bits (378),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+LFIT++LPDA++VK KL+PEGKF F+A +G +  P+EV  +L+DKVD+NESK S   R
Sbjct  14   DRLFITIDLPDAQDVKLKLDPEGKFCFSAVSGTEKIPYEVDIDLYDKVDINESKASIGMR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I YL++KAE KWWSRLLKQEGKPPVF+K+DWDKW+DEDE+
Sbjct  74   NIRYLIEKAEKKWWSRLLKQEGKPPVFVKIDWDKWIDEDEE  114



>emb|CBI29341.3| unnamed protein product [Vitis vinifera]
Length=218

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT++LPDAK+V  KLEPEGKF+F+A +GAD  P+E+  +LFDKVDVNESK S   R
Sbjct  54   DTIYITIDLPDAKDVNLKLEPEGKFFFSATSGADKIPYEIDIDLFDKVDVNESKASIGLR  113

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I YLVKKAE+KWWSRLLKQEGKPPVFLKVDWDKWV
Sbjct  114  NIRYLVKKAENKWWSRLLKQEGKPPVFLKVDWDKWV  149



>ref|XP_003619026.1| Ripening regulated protein DDTFR8 [Medicago truncatula]
 gb|AES75244.1| HSP90 co-chaperone [Medicago truncatula]
Length=190

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 3/106 (3%)
 Frame = -3

Query  720  LFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSRYI  541
            L ITVELPDA++VK K+EPEGKFYF+A AGA+  P+EV+ +LFD +DVN+   S +SR I
Sbjct  16   LSITVELPDAQDVKLKVEPEGKFYFSATAGAEKIPYEVNVDLFDSIDVNDIITSASSRQI  75

Query  540  CYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED---EQDEKP  412
            CYLVKKAE+KWW RLLKQ GK P FLK+DWDKWVDED   EQ+ KP
Sbjct  76   CYLVKKAENKWWDRLLKQGGKIPSFLKIDWDKWVDEDEYYEQEAKP  121



>ref|XP_006651444.1| PREDICTED: uncharacterized protein OsI_027940-like [Oryza brachyantha]
Length=173

 Score =   148 bits (373),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+T+ELPDA++VK  L+P+G F F+A+  AD+TP+E+  ELFD V+V ESK +   R
Sbjct  14   DKVFLTIELPDARDVKLNLKPDGHFIFSAKGPADDTPYELDLELFDAVNVEESKAAVAPR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYLVKKAE KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  74   TICYLVKKAESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  115



>ref|XP_006434558.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
 gb|ESR47798.1| hypothetical protein CICLE_v10002611mg [Citrus clementina]
Length=180

 Score =   147 bits (370),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 12/175 (7%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+++IT++LPDA++VK KLEPEGKF+F+A +G D  P+EV  +L+DK    ESK S   R
Sbjct  14   DRVYITIDLPDAQDVKLKLEPEGKFFFSATSGPDKIPYEVDIDLYDK----ESKASVGLR  69

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ--DEKPgagmdfggddfdF  373
             I YLVKKAE+KWWSRLLKQ GKPPVFLKVDWDKW+DEDE+  D+KP A MDFG  DF  
Sbjct  70   NIHYLVKKAENKWWSRLLKQAGKPPVFLKVDWDKWIDEDEEGKDDKPPADMDFGDLDFSK  129

Query  372  SNLSMggpgdfdadaagdddddddsDTEEEGKEIETGAASSEVQAHAPCSEPETK  208
             N+            A   D++D+SDTEEE +   T A + E    +  SEP+TK
Sbjct  130  MNMG------GLDAEAAGGDENDESDTEEENEVGTTPAGNREAPPPSTSSEPDTK  178



>ref|XP_008456697.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Cucumis melo]
Length=190

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            ++LFIT++LPDA++VK KLEPEGKF F+A +GA+  P EV  +L+DKVD+NESK S   R
Sbjct  14   NRLFITIDLPDAQDVKLKLEPEGKFCFSAVSGAEKIPHEVDIDLYDKVDINESKASIGMR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I YL++KAE KWWSRLLKQEGK PVF+K+DWDKW+DEDE+
Sbjct  74   NIRYLIEKAEKKWWSRLLKQEGKHPVFVKIDWDKWIDEDEE  114



>ref|XP_008456698.1| PREDICTED: uncharacterized protein At3g03773-like isoform X2 
[Cucumis melo]
Length=189

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            ++LFIT++LPDA++VK KLEPEGKF F+A +GA+  P EV  +L+DKVD+NESK S   R
Sbjct  13   NRLFITIDLPDAQDVKLKLEPEGKFCFSAVSGAEKIPHEVDIDLYDKVDINESKASIGMR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I YL++KAE KWWSRLLKQEGK PVF+K+DWDKW+DEDE+
Sbjct  73   NIRYLIEKAEKKWWSRLLKQEGKHPVFVKIDWDKWIDEDEE  113



>ref|XP_011026295.1| PREDICTED: uncharacterized protein OsI_027940-like [Populus euphratica]
Length=184

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D LFITV+LPDA++VK K+EPEGKF+F+A +G +  P+EV  +L DKV V ESK S  SR
Sbjct  14   DNLFITVQLPDAQDVKLKIEPEGKFFFSASSGVEKIPYEVELDLLDKVIVEESKASIGSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I Y+VKKAE+KWWSRL+K  GKPPVFL VDWDKW+DEDE+
Sbjct  74   SIQYIVKKAENKWWSRLIKPTGKPPVFLTVDWDKWIDEDEE  114



>ref|XP_006304541.1| hypothetical protein CARUB_v10011509mg, partial [Capsella rubella]
 gb|EOA37439.1| hypothetical protein CARUB_v10011509mg, partial [Capsella rubella]
Length=153

 Score =   143 bits (361),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = -3

Query  717  FITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSRYIC  538
            ++T+ELPDA+ V  KLEP+GKF+F A +GA  TP+E+  +LFD VDVN ++   +SR IC
Sbjct  1    YVTLELPDAEEVNMKLEPQGKFFFYATSGASKTPYELELDLFDNVDVNVTR-RVSSRCIC  59

Query  537  YLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
            Y+VKKAE KWW+RL+KQEGKPPV+LKVDWDKWVDED++D
Sbjct  60   YMVKKAESKWWNRLIKQEGKPPVYLKVDWDKWVDEDDED  98



>ref|XP_008381044.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Malus domestica]
Length=224

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT++LPDA++VK KLEPEGKF F+A  G + TP+EV  +L+DK+D+NE+K S   R
Sbjct  14   DMVYITIDLPDAQDVKLKLEPEGKFLFSATTGPEKTPYEVDLDLYDKIDINETKTSVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             ICYLVKKAEDKWWSRL+KQ+G+ P+FLKVDWDKW
Sbjct  74   NICYLVKKAEDKWWSRLIKQQGRAPIFLKVDWDKW  108



>ref|XP_008381045.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Malus domestica]
Length=223

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++IT++LPDA++VK KLEPEGKF F+A  G + TP+EV  +L+DK+D+NE+K S   R
Sbjct  14   DMVYITIDLPDAQDVKLKLEPEGKFLFSATTGPEKTPYEVDLDLYDKIDINETKTSVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             ICYLVKKAEDKWWSRL+KQ+G+ P+FLKVDWDKW
Sbjct  74   NICYLVKKAEDKWWSRLIKQQGRAPIFLKVDWDKW  108



>gb|AAG41763.1|AF153128_1 p23 [Brassica napus]
Length=178

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++ITVELPDA++VK KLEPEGKF+F+A +GA  T +EV  +L D VDVNESK S +SR
Sbjct  14   DWVYITVELPDAEDVKLKLEPEGKFFFSATSGASKTLYEVDLDLLDSVDVNESKASVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             + YLVKKAE KWW+RL K EGK P++LKVDWDKWVDED++D
Sbjct  74   SVFYLVKKAESKWWNRLTKPEGKHPLYLKVDWDKWVDEDDED  115



>emb|CDY04790.1| BnaC05g17990D [Brassica napus]
Length=196

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++ITVELPDA++VK KLEPEGKF+F+A +GA  T +EV  +L D VDVNESK S +SR
Sbjct  32   DWVYITVELPDAEDVKLKLEPEGKFFFSATSGASKTLYEVDLDLLDSVDVNESKASVSSR  91

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             + YLVKKAE KWW+RL K EGK P++LKVDWDKWVDED++D
Sbjct  92   SVFYLVKKAESKWWNRLTKPEGKHPLYLKVDWDKWVDEDDED  133



>emb|CDY21385.1| BnaA09g30420D [Brassica napus]
Length=182

 Score =   142 bits (357),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++ITVELPDA++VK KLEPEGK +F+A +GA  T +EV  +L D VDVNESK + +SR
Sbjct  18   DWVYITVELPDAEDVKLKLEPEGKLFFSATSGASKTLYEVDLDLLDSVDVNESKVNVSSR  77

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             + YLVKKAE KWW+RL KQEGK P++LKVDWDKWVDED++D
Sbjct  78   SVFYLVKKAESKWWNRLTKQEGKHPLYLKVDWDKWVDEDDED  119



>ref|XP_003557812.1| PREDICTED: uncharacterized protein OsI_027940-like [Brachypodium 
distachyon]
Length=175

 Score =   141 bits (356),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK  L+P+G F F+A+A AD T +   FELFD V+V ESK +   R
Sbjct  14   DKVYLTIELPDAKDVKLNLKPDGHFDFSAKAPADETQYVFDFELFDAVNVEESKAAVAQR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KKAE KWW RLLK EGKPPVFLKVDWDKW DED++D
Sbjct  74   SICYLIKKAESKWWPRLLKNEGKPPVFLKVDWDKWQDEDDED  115



>ref|XP_010251769.1| PREDICTED: uncharacterized protein Os08g0359500-like [Nelumbo 
nucifera]
Length=172

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV+LPDAK+VK KLEPEGKF F+A    DN P+EV  +L DKV+V ESK S   R
Sbjct  14   DKIYLTVDLPDAKDVKLKLEPEGKFIFSA--TKDNLPYEVDIDLHDKVNVEESKVSIGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y+++KAE KWW RLLKQEGKPPVFLKVDWDKWVDE++++EK
Sbjct  72   SIVYVIEKAEKKWWGRLLKQEGKPPVFLKVDWDKWVDEEDENEK  115



>ref|XP_004984205.1| PREDICTED: uncharacterized protein OsI_027940-like [Setaria italica]
Length=177

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D++F+T+ELPDAK+VK  L+PEG F F+A+ G+D+ P+E+  ELFD V+V ESK +   R
Sbjct  14   DRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYELDLELFDAVNVEESKAAVAPR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KKAE KWW RL K+EGKPPVFLKVDWDKW DED++D
Sbjct  73   TICYLIKKAESKWWPRLPKKEGKPPVFLKVDWDKWQDEDDED  114



>gb|AFK43711.1| unknown [Lotus japonicus]
Length=191

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D+L+IT+ELPDA++VK  LEPEGK YF+A AG +N P+E +F+LFDKVDVN S+ S + R
Sbjct  14   DELYITIELPDAQDVKLILEPEGKLYFSATAGPENIPYEFNFDLFDKVDVNNSESSVSKR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I YL+ KAE K W RLLKQ GKPPVFLKVDWDKWV
Sbjct  74   NIIYLISKAESKCWDRLLKQGGKPPVFLKVDWDKWV  109



>gb|EMT32541.1| hypothetical protein F775_31652 [Aegilops tauschii]
Length=194

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK  L P+G F F+A+A AD+  +E+  ELFD V V ES+ +   R
Sbjct  27   DKVYLTIELPDAKDVKLNLRPDGHFNFSAKAPADDMQYELDLELFDAVSVEESQAAVAPR  86

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYLVKKAE KWW RLLK+EG+PPVFLKVDWDKW DED++D
Sbjct  87   AICYLVKKAEGKWWPRLLKKEGRPPVFLKVDWDKWQDEDDED  128



>gb|AGT16170.1| hypothetical protein SHCRBa_024_F14_R_20 [Saccharum hybrid cultivar 
R570]
Length=179

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D++F+T+ELPDAK+VK  L+PEG F F+A+ G+D+ P+E   ELFD V+V ESK +   R
Sbjct  14   DRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYEFDLELFDAVNVEESKAAVAPR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KK E KWW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  73   TICYLIKKTESKWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  114



>ref|XP_002277004.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Vitis vinifera]
Length=159

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKL++TVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELFDK+ V +SK +   R
Sbjct  14   DKLYLTVELPDAKDVKLKLEPEGRFMFSA--TKDDVPYEVDIELFDKIKVEDSKCNVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y++ KAE KWW+RL+K EGKPPVFLKVDWDKWVDE++++EK
Sbjct  72   SIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDENEK  115



>ref|XP_002465200.1| hypothetical protein SORBIDRAFT_01g033940 [Sorghum bicolor]
 gb|EER92198.1| hypothetical protein SORBIDRAFT_01g033940 [Sorghum bicolor]
Length=178

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D++F+T+ELPDAK+VK  L+PEG F F+A+ G+D+ P+E   ELFD V+V ESK +   R
Sbjct  14   DRVFLTIELPDAKDVKLNLKPEGHFNFSAK-GSDDLPYEFDLELFDAVNVEESKAAVAPR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KKAE KWW RLLK+EGK PVFLKVDWDKW DED++D
Sbjct  73   TICYLIKKAESKWWPRLLKKEGKAPVFLKVDWDKWQDEDDED  114



>ref|XP_002525582.1| HSP90 co-chaperone, putative [Ricinus communis]
 gb|EEF36841.1| HSP90 co-chaperone, putative [Ricinus communis]
Length=149

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (80%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELFDKV+V ESK +   R
Sbjct  14   DKVFITVELPDAKDVKLKLEPEGRFIFSATK--DDVPYEVDIELFDKVNVKESKYNIGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y +KK E KWW RL+KQEGK PVFLKVDWDKWVDED++++K
Sbjct  72   SIVYDIKKVEKKWWGRLIKQEGKTPVFLKVDWDKWVDEDDENDK  115



>ref|XP_002276982.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Vitis vinifera]
Length=170

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 84/104 (81%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKL++TVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELFDK+ V +SK +   R
Sbjct  14   DKLYLTVELPDAKDVKLKLEPEGRFMFSA--TKDDVPYEVDIELFDKIKVEDSKCNVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y++ KAE KWW+RL+K EGKPPVFLKVDWDKWVDE++++EK
Sbjct  72   SIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDENEK  115



>gb|ABA60373.1| p23 [Dactylis glomerata]
Length=180

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 82/102 (80%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK  L+P+G F F+A+ G+D+  +E+  ELFD V+V ESK +   R
Sbjct  14   DKVYLTIELPDAKDVKLNLKPDGHFNFSAK-GSDDMQYELDLELFDAVNVEESKAAVAPR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYLVKKAE  WW RLLK+EGKPPVFLKVDWDKW DED++D
Sbjct  73   TICYLVKKAESTWWPRLLKKEGKPPVFLKVDWDKWQDEDDED  114



>ref|XP_010922128.1| PREDICTED: uncharacterized protein At3g03773-like [Elaeis guineensis]
Length=155

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (79%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TVELPDAK+V  KLEPEGKFYF+A    D   +EV  ELF+KV   ESK +   R
Sbjct  14   DKIYLTVELPDAKDVNLKLEPEGKFYFSA--NKDGVSYEVDLELFNKVITKESKFNIGMR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y++KKAE KWWSRLLK+EGKPP FLKVDWDKW+DE++++EK
Sbjct  72   SIGYVIKKAEKKWWSRLLKEEGKPPAFLKVDWDKWIDEEDENEK  115



>emb|CAN64654.1| hypothetical protein VITISV_015756 [Vitis vinifera]
Length=182

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKL++TVELPDAK+VK KLEPEG+F F+A    D+ P+EV  ELFDK+ V +SK +   R
Sbjct  24   DKLYLTVELPDAKDVKLKLEPEGRFMFSA--TKDDVPYEVDIELFDKIKVEDSKCNVGVR  81

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I Y++ KAE KWW+RL+K EGKPPVFLKVDWDKWVDE++++
Sbjct  82   SIVYVIAKAEKKWWARLIKNEGKPPVFLKVDWDKWVDEEDEN  123



>ref|NP_001148600.1| prostaglandin E synthase 3 [Zea mays]
 gb|ACF82936.1| unknown [Zea mays]
 gb|ACG32174.1| prostaglandin E synthase 3 [Zea mays]
Length=176

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D++F+T+ELPDA++VK  L+PEG F F+A+ G+D+  +E   ELFD V+V ESK +   R
Sbjct  14   DRVFLTIELPDAQDVKLNLKPEGHFNFSAK-GSDDLRYEFDIELFDAVNVEESKAAIAPR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             ICYL+KKA+  WW RLLKQEGKPPVFLKVDWDKW DED++D
Sbjct  73   TICYLIKKAKSGWWPRLLKQEGKPPVFLKVDWDKWQDEDDED  114



>ref|XP_008792419.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X3 
[Phoenix dactylifera]
Length=155

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TVELPDAK+V  KLEPEGKF F+A    D   +EV  ELFDKV   ESK +   R
Sbjct  14   DKIYLTVELPDAKDVNLKLEPEGKFSFSA--NKDGVSYEVDLELFDKVSTKESKFNIGMR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y++KKAE KWWSRLLK EGKPP FLKVDWDKW+DE++++EK
Sbjct  72   SIVYVIKKAEKKWWSRLLKDEGKPPAFLKVDWDKWIDEEDENEK  115



>ref|XP_009115602.1| PREDICTED: uncharacterized protein OsI_027940-like [Brassica 
rapa]
Length=180

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D ++ITVELPDA++VK KLEPEGK +F+A +GA  T +EV  +L D VDVNESK + +SR
Sbjct  14   DWVYITVELPDAEDVKLKLEPEGKLFFSATSGASKTLYEVDLDLLDSVDVNESKVNVSSR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             + YLVKKAE KWW+RL KQEGK P++LKVDWDKWV
Sbjct  74   SVFYLVKKAESKWWNRLTKQEGKHPLYLKVDWDKWV  109



>ref|XP_008792417.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Phoenix dactylifera]
 ref|XP_008792418.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Phoenix dactylifera]
Length=213

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TVELPDAK+V  KLEPEGKF F+A    D   +EV  ELFDKV   ESK +   R
Sbjct  85   DKIYLTVELPDAKDVNLKLEPEGKFSFSA--NKDGVSYEVDLELFDKVSTKESKFNIGMR  142

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y++KKAE KWWSRLLK EGKPP FLKVDWDKW+DE++++EK
Sbjct  143  SIVYVIKKAEKKWWSRLLKDEGKPPAFLKVDWDKWIDEEDENEK  186



>ref|XP_010694670.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X4 
[Beta vulgaris subsp. vulgaris]
Length=187

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK++V ESK +   R
Sbjct  14   DKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDKINVEESKYNIGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  72   QIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>ref|XP_008792416.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Phoenix dactylifera]
Length=226

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TVELPDAK+V  KLEPEGKF F+A    D   +EV  ELFDKV   ESK +   R
Sbjct  85   DKIYLTVELPDAKDVNLKLEPEGKFSFSA--NKDGVSYEVDLELFDKVSTKESKFNIGMR  142

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I Y++KKAE KWWSRLLK EGKPP FLKVDWDKW+DE++++EK
Sbjct  143  SIVYVIKKAEKKWWSRLLKDEGKPPAFLKVDWDKWIDEEDENEK  186



>ref|XP_010694666.1| PREDICTED: uncharacterized protein At3g03773-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=201

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK++V ESK +   R
Sbjct  14   DKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDKINVEESKYNIGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  72   QIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>ref|XP_010694667.1| PREDICTED: uncharacterized protein At3g03773-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=200

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK++V ESK +   R
Sbjct  14   DKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDKINVEESKYNIGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  72   QIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>ref|XP_010694668.1| PREDICTED: uncharacterized protein At3g03773-like isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=197

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T+ELPDAK+VK KLEPEGK  F+A   A   P+E   EL DK++V ESK +   R
Sbjct  14   DKVYVTIELPDAKDVKLKLEPEGKMAFSAVKNA--HPYEFDIELLDKINVEESKYNIGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I Y+++KAE +WWSRL+KQEG PP+FLKVDWDKWVDE+E++
Sbjct  72   QIVYVIEKAEKRWWSRLIKQEGNPPIFLKVDWDKWVDENEEN  113



>dbj|BAE92292.1| putative p23 co-chaperone [Cryptomeria japonica]
Length=240

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T++LPD+KN   KLEPEGK  F+A  G +N PFE +F+LFDKVDV  SK +   R
Sbjct  19   DKVYVTIQLPDSKNADVKLEPEGKLSFSATTGPENAPFEFNFDLFDKVDVEASKINVGLR  78

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEKP  412
             I   ++KAE  WW RLLK EGK P ++KVDWDKWVDEDE+DEKP
Sbjct  79   NIFCCIEKAEKGWWKRLLKAEGKTPQYIKVDWDKWVDEDEEDEKP  123



>gb|ABK26701.1| unknown [Picea sitchensis]
Length=246

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++IT+ LPDAKN   +L+PEGK  F+A AG+ +TPFE++ EL+DKV+V  SK +   R
Sbjct  14   DKIYITILLPDAKNADVELQPEGKLTFSATAGSQDTPFELNLELYDKVNVEASKINVGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDEK  415
             I  +V+KAE  WW RLLK EGK P++LKVDWDKWVDEDE+DEK
Sbjct  74   NIFCVVEKAEKGWWKRLLKGEGKTPLYLKVDWDKWVDEDEEDEK  117



>gb|AFK39090.1| unknown [Lotus japonicus]
Length=228

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPD+K+ K  L P+G F F A AGA + P+EV  ELFDKV+V ESK +   R
Sbjct  16   DKVYITVQLPDSKDAKVDLTPDGVFTFTASAGAGDKPYEVKLELFDKVNVEESKINIGVR  75

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +V+KAE  WW RLL+ EGKPP ++KVDWDKWVDEDE+D
Sbjct  76   SIFSVVQKAESGWWKRLLRGEGKPPHYVKVDWDKWVDEDEED  117



>gb|KDP28144.1| hypothetical protein JCGZ_13915 [Jatropha curcas]
Length=188

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAKN K  LEPEG F F+A AGA+N  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKNAKVNLEPEGVFTFSASAGAENHVYELKLELFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW +LL+ +GKPP +LKVDWDKWVDEDE
Sbjct  74   SIFCIVEKAEKVWWKKLLRGDGKPPHYLKVDWDKWVDEDE  113



>ref|XP_006444305.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 ref|XP_006479938.1| PREDICTED: uncharacterized protein OsI_027940-like [Citrus sinensis]
 gb|ESR57545.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|KDO87267.1| hypothetical protein CISIN_1g029750mg [Citrus sinensis]
Length=188

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV+LPDAKN K  LEPEG F F+A AGA+N  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_006444304.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|ESR57544.1| hypothetical protein CICLE_v10022431mg [Citrus clementina]
 gb|KDO87268.1| hypothetical protein CISIN_1g029750mg [Citrus sinensis]
Length=187

 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV+LPDAKN K  LEPEG F F+A AGA+N  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVFITVQLPDAKNAKVNLEPEGVFSFSASAGAENHLYELKLELFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCIVEKAEKGWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_004290784.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X5 [Fragaria 
vesca subsp. vesca]
Length=241

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK S   R
Sbjct  14   DKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  74   SIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_011458723.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=248

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEPEG F F+A AGA +  +E+  +LFDKVDV ESK S   R
Sbjct  14   DKVFLTVLLPDAKDAKVKLEPEGTFIFSACAGAGDNQYELKLDLFDKVDVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WWSRLLK++G+ P ++K+DWDKWVDEDE
Sbjct  74   SIVCIVEKAEKVWWSRLLKEQGRTPHYVKIDWDKWVDEDE  113



>ref|XP_004290783.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEPEG F F+A AGA +  +E+  +LFDKVDV ESK S   R
Sbjct  14   DKVFLTVLLPDAKDAKVKLEPEGTFIFSACAGAGDNQYELKLDLFDKVDVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WWSRLLK++G+ P ++K+DWDKWVDEDE
Sbjct  74   SIVCIVEKAEKVWWSRLLKEQGRTPHYVKIDWDKWVDEDE  113



>ref|XP_011458724.1| PREDICTED: uncharacterized protein Os08g0359500 isoform X6 [Fragaria 
vesca subsp. vesca]
Length=240

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK S   R
Sbjct  14   DKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  74   SIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>ref|NP_001241395.1| uncharacterized protein LOC100796372 [Glycine max]
 gb|ACU22871.1| unknown [Glycine max]
Length=200

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +V+KAED WW RLL+ EGKPP ++KVDWDKWVDEDE D
Sbjct  74   SIFCVVQKAEDGWWKRLLRGEGKPPHYVKVDWDKWVDEDEDD  115



>gb|AES61800.2| CS domain protein [Medicago truncatula]
Length=183

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV+LPD+KN K  L P+G   F+A AGA++  +E+   LFDKV+V ESK +   R
Sbjct  14   DKVYVTVQLPDSKNAKVNLTPDGVLTFSATAGAEDHLYELKLPLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAED+WW RLLK EGKPP ++KVDWDKWVDEDE
Sbjct  74   GIFCVVQKAEDEWWKRLLKAEGKPPHYVKVDWDKWVDEDE  113



>ref|XP_011458722.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK S   R
Sbjct  14   DKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  74   SIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_011458721.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=293

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK S   R
Sbjct  14   DKVFLTVVLPDAKDAKVKLEPEGVFIFSASAGAENHQYELKLDLFDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WWS+LLK +GK P ++KVDWDKWVDEDE
Sbjct  74   SIVCIVEKAEKVWWSKLLKGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_003591549.1| hypothetical protein MTR_1g088700 [Medicago truncatula]
Length=222

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV+LPD+KN K  L P+G   F+A AGA++  +E+   LFDKV+V ESK +   R
Sbjct  53   DKVYVTVQLPDSKNAKVNLTPDGVLTFSATAGAEDHLYELKLPLFDKVNVEESKINVGVR  112

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAED+WW RLLK EGKPP ++KVDWDKWVDEDE
Sbjct  113  GIFCVVQKAEDEWWKRLLKAEGKPPHYVKVDWDKWVDEDE  152



>ref|XP_007050895.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX95052.1| HSP20-like chaperones superfamily protein isoform 3 [Theobroma 
cacao]
Length=183

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DKV+V ESK +   R
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDEDE++
Sbjct  74   SIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEEN  115



>gb|KJB22493.1| hypothetical protein B456_004G052400 [Gossypium raimondii]
Length=189

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV LPD+KN K  LEPEG F  +A AGADN  +E+  +L+DKV+V ESK S   R
Sbjct  14   DKVYITVLLPDSKNAKVNLEPEGVFTLSANAGADNNLYELKLDLYDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE  WW +LL+ EGK P ++KVDWDKWVDEDE +
Sbjct  74   NIVCVLEKAEKVWWKKLLRSEGKAPHYIKVDWDKWVDEDEDN  115



>gb|KJB22494.1| hypothetical protein B456_004G052400 [Gossypium raimondii]
Length=169

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV LPD+KN K  LEPEG F  +A AGADN  +E+  +L+DKV+V ESK S   R
Sbjct  14   DKVYITVLLPDSKNAKVNLEPEGVFTLSANAGADNNLYELKLDLYDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE  WW +LL+ EGK P ++KVDWDKWVDEDE +
Sbjct  74   NIVCVLEKAEKVWWKKLLRSEGKAPHYIKVDWDKWVDEDEDN  115



>ref|XP_007050893.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95050.1| HSP20-like chaperones superfamily protein isoform 1 [Theobroma 
cacao]
Length=180

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DKV+V ESK +   R
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDEDE++
Sbjct  74   SIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEEN  115



>ref|XP_008451590.1| PREDICTED: uncharacterized protein OsI_027940 [Cucumis melo]
Length=202

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV+LPD+K+ K  LEP+G F F+  AG++N  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVFITVQLPDSKDSKVNLEPDGVFTFSGSAGSENHHYELKLELFDKVNVEESKVNIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE  WW +LL+ +GKPP ++KVDWDKWVDEDE D
Sbjct  74   SIFCILEKAEKGWWKKLLRGDGKPPHYVKVDWDKWVDEDEDD  115



>ref|XP_004136034.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 ref|XP_004160550.1| PREDICTED: uncharacterized protein OsI_027940-like [Cucumis sativus]
 gb|KGN44928.1| hypothetical protein Csa_7G396430 [Cucumis sativus]
Length=208

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV+LPD+K+ K  LEP+G F F+  AG++N  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVFITVQLPDSKDSKVNLEPDGVFTFSGSAGSENHHYELKLELFDKVNVEESKVNIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE  WW +LL+ +GKPP ++KVDWDKWVDEDE D
Sbjct  74   SIFCILEKAEKGWWKKLLRGDGKPPHYVKVDWDKWVDEDEDD  115



>ref|XP_009342102.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Pyrus x bretschneideri]
Length=193

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW++LL+ +GK P ++KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEPAWWNKLLRGDGKMPHYVKVDWDKWVDEDD  113



>ref|XP_009342103.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Pyrus x bretschneideri]
Length=192

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW++LL+ +GK P ++KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEPAWWNKLLRGDGKMPHYVKVDWDKWVDEDD  113



>ref|NP_001236771.1| uncharacterized protein LOC100499842 [Glycine max]
 gb|ACU13874.1| unknown [Glycine max]
Length=174

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDKVNVEESKINVGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAED WW RLL+ EGK P ++KVDWDKWVDEDE
Sbjct  74   SIFIVVQKAEDGWWKRLLRGEGKTPHYVKVDWDKWVDEDE  113



>ref|XP_007050896.1| HSP20-like chaperones superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX95053.1| HSP20-like chaperones superfamily protein isoform 4 [Theobroma 
cacao]
Length=183

 Score =   120 bits (302),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DKV+V ESK +   R
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDEDE++
Sbjct  74   SIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEEN  115



>ref|XP_004495968.1| PREDICTED: uncharacterized protein OsI_027940-like [Cicer arietinum]
Length=186

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++T++LPD+KN K  L P+G   F+A AGA+N  +E+   LFDKV+V ESK +   R
Sbjct  14   DKVYVTIQLPDSKNAKVDLTPDGILTFSASAGAENHLYELQLPLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE +WW RLLK EGKPP ++KVDWDKW+DEDE
Sbjct  74   GIFCVVQKAEIEWWKRLLKAEGKPPHYVKVDWDKWMDEDE  113



>ref|XP_010038204.1| PREDICTED: uncharacterized protein Os08g0359500 [Eucalyptus grandis]
Length=209

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K  LEP+G F F+A+AGA+N P+E+  ELFDKV+V ESK +   R
Sbjct  14   DKVFLTVLLPDAKDAKVNLEPDGIFTFSAKAGAENHPYELKLELFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE +WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   NIFCILEKAEKEWWKKLLRGDGKLPHYVKVDWDKWVDEDE  113



>gb|KHG16575.1| hypothetical protein F383_01113 [Gossypium arboreum]
Length=193

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>ref|XP_010684508.1| PREDICTED: uncharacterized protein OsI_027940 [Beta vulgaris 
subsp. vulgaris]
Length=194

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAKN K  L PEG F F A  GA +  +E+  +LFDKV+V ESK S   R
Sbjct  14   DKVYLTVMLPDAKNPKVNLGPEGTFTFTATGGAGDHVYELKLDLFDKVNVEESKISYGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE KWW+RLL+ EGKPP ++K+DWDKW DEDE
Sbjct  74   SIFCVLEKAEQKWWNRLLRGEGKPPHYVKIDWDKWADEDE  113



>ref|XP_009342151.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Pyrus x bretschneideri]
Length=199

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDKVNVEESKINVGMR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW++LL  +GK P ++KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEPAWWNKLLCGDGKMPHYVKVDWDKWVDEDD  113



>ref|XP_008386667.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Malus 
domestica]
Length=190

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFLTVLLPDAKDAKVKLEPDGTFSFSASAGAENHQYELKLDLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE +WW +LL+ +GK P ++KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEPEWWPKLLRGDGKTPHYVKVDWDKWVDEDD  113



>ref|XP_008386666.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Malus 
domestica]
Length=191

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFLTVLLPDAKDAKVKLEPDGTFSFSASAGAENHQYELKLDLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE +WW +LL+ +GK P ++KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEPEWWPKLLRGDGKTPHYVKVDWDKWVDEDD  113



>ref|XP_009342150.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Pyrus x bretschneideri]
Length=200

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAK+ K KLEPEG F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKDAKVKLEPEGVFSFSASAGAENHQYELKLDLFDKVNVEESKINVGMR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW++LL  +GK P ++KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEPAWWNKLLCGDGKMPHYVKVDWDKWVDEDD  113



>gb|KJB49925.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=209

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>gb|KJB49923.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=208

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>ref|XP_010652179.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Vitis 
vinifera]
Length=177

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAKN K  LEP+G F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW +LL+ + K P +LKVDWDKWVDEDE
Sbjct  74   SIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDE  113



>ref|XP_002264898.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Vitis 
vinifera]
Length=178

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAKN K  LEP+G F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW +LL+ + K P +LKVDWDKWVDEDE
Sbjct  74   SIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDE  113



>gb|KJB49924.1| hypothetical protein B456_008G146000 [Gossypium raimondii]
Length=206

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPD+KN K  LEPEG F F+A AG DN  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFNFSATAGTDNNTYELKLDLFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEKVWWKKLLRGDGKAPHYVKVDWDKWVDEDE  113



>ref|XP_008235058.1| PREDICTED: uncharacterized protein OsI_027940 [Prunus mume]
Length=183

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKDAKVKLEPDGVFSFSASAGAENHHYELKLDLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEKVWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>ref|XP_006840547.1| hypothetical protein AMTR_s00045p00215950 [Amborella trichopoda]
 gb|ERN02222.1| hypothetical protein AMTR_s00045p00215950 [Amborella trichopoda]
Length=225

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV LPDAKNVK  L+PEG F F+A AG D  P+E+  +LF KV+  ESK +   R
Sbjct  14   DKVYITVSLPDAKNVKTNLDPEGIFTFSANAGTDGNPYELKLDLFGKVNAEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +V+KAE+ WW +LL+ + K P +LKVDWDKWVDEDE D
Sbjct  74   NIFCIVEKAEEGWWKKLLRGDEKTPHYLKVDWDKWVDEDEDD  115



>ref|XP_007201343.1| hypothetical protein PRUPE_ppa011992mg [Prunus persica]
 gb|EMJ02542.1| hypothetical protein PRUPE_ppa011992mg [Prunus persica]
Length=188

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAK+ K KLEP+G F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  14   DKVFITVLLPDAKDAKVKLEPDGVFSFSASAGAENHHYELKLDLFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LL+ +GK P ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEKVWWKKLLRGDGKTPHYVKVDWDKWVDEDE  113



>gb|KHN20406.1| Hypothetical protein glysoja_039704 [Glycine soja]
Length=269

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDKV+V ESK +   R
Sbjct  62   DKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDKVNVEESKINVGER  121

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAED WW RLL+ EGK P ++KVDWDKWVDEDE
Sbjct  122  SIFIVVQKAEDGWWKRLLRGEGKTPHYVKVDWDKWVDEDE  161



>emb|CBI36840.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+FITV LPDAKN K  LEP+G F F+A AGA+N  +E+  +LFDKV+V ESK +   R
Sbjct  49   DKVFITVLLPDAKNAKVNLEPDGDFTFSASAGAENHLYELKLDLFDKVNVEESKINIGVR  108

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE  WW +LL+ + K P +LKVDWDKWVDEDE
Sbjct  109  SIFCVVEKAEKGWWKKLLRGDEKAPHYLKVDWDKWVDEDE  148



>gb|KHN43515.1| Hypothetical protein glysoja_002098 [Glycine soja]
Length=738

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L P+G F F+  AGA++  +E+  ELFDKV+V ESK +   R
Sbjct  53   DKVYITVQLADSKNAKVDLTPDGIFTFSGSAGAEDHQYELKLELFDKVNVEESKINVGVR  112

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +V+KAED WW RLL+ EGKPP ++KVDWDKWVDEDE D
Sbjct  113  SIFCVVQKAEDGWWKRLLRGEGKPPHYVKVDWDKWVDEDEDD  154



>gb|ADE76546.1| unknown [Picea sitchensis]
Length=204

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKL+IT+ELPDA N K+KLEP+GKF F+A  G + T +E+ F L+D+V+V ESK S   R
Sbjct  14   DKLYITIELPDANNPKWKLEPDGKFTFSATTGQEKTFYELDFYLYDRVNVEESKISVNLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  ++KK + KWW +LLK E K   FLKVDWDKWVDEDE+
Sbjct  74   NIICILKKEDKKWWKQLLKTEAKRLPFLKVDWDKWVDEDEE  114



>gb|ADE76981.1| unknown [Picea sitchensis]
Length=207

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKL+IT+ELPDA N K+KLEP+GKF F+A  G + T +E+ F L+D+V+V ESK S   R
Sbjct  14   DKLYITIELPDANNPKWKLEPDGKFTFSATTGQEKTFYELDFYLYDRVNVEESKISVNLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  ++KK + KWW +LLK E K   FLKVDWDKWVDEDE+
Sbjct  74   NIICILKKEDKKWWKQLLKTEAKRLPFLKVDWDKWVDEDEE  114



>emb|CDX89935.1| BnaA10g01470D [Brassica napus]
Length=251

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL DKV+V ESK +   R
Sbjct  32   DKVYLTVLLPDAKDANVKLDPEGVFEFSAKAGPENQVYELKLELSDKVNVEESKINIGLR  91

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWWS+LL+  GKPP ++KVDWDKWVDEDE
Sbjct  92   SIFCIVEKAEPKWWSKLLRVGGKPPHYVKVDWDKWVDEDE  131



>ref|XP_009385408.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=159

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+A AGA N+ +E+  +L+DKV+   SK +   R
Sbjct  14   DKIYITVQLPDAKDAKVNLEPDGIFTFSATAGAGNSTYELKMDLYDKVNKEASKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDED  430
             I  +V+KAE  WW +LL+ +GK P ++KVDWDKWVDED
Sbjct  74   SIFCVVEKAEKGWWKKLLRGDGKAPHYVKVDWDKWVDED  112



>ref|XP_002964192.1| hypothetical protein SELMODRAFT_81672, partial [Selaginella moellendorffii]
 gb|EFJ34525.1| hypothetical protein SELMODRAFT_81672, partial [Selaginella moellendorffii]
Length=135

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLF+TVELPDA +   +L+P+G+F F A A AD+ P+E S EL+  V V ESK +  SR
Sbjct  12   DKLFLTVELPDAVDPSVELQPDGRFVFRA-AAADSAPYEASLELYGSVSVEESKVNVGSR  70

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
            +   ++ K E  WW RLLK EGK P ++KVDW+KW+DEDE+
Sbjct  71   HTLCIIHKQEQGWWKRLLKSEGKMPPYVKVDWNKWIDEDEE  111



>ref|XP_001768873.1| predicted protein [Physcomitrella patens]
 gb|EDQ66227.1| predicted protein, partial [Physcomitrella patens]
Length=114

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TVEL DAK+ + KLEPEG+F F+A  GA++  FE   +LF  +DV +S  +   R
Sbjct  14   DKVFLTVELLDAKHPEVKLEPEGRFTFSATVGANDLKFETDLQLFGAIDVEKSVVNKGQR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
            +   ++ K E  WWSRLLK EGK P F+KVDW+KWVDEDE+
Sbjct  74   HTTLVLVKKEAGWWSRLLKAEGKAPQFVKVDWNKWVDEDEE  114



>ref|XP_006659323.1| PREDICTED: uncharacterized protein Os08g0359500-like [Oryza brachyantha]
Length=204

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L DAKN K  LEPEG F F+A AG D   +E   EL DKV+V ESK S   R
Sbjct  14   DKVYITVQLADAKNAKVNLEPEGVFSFSATAGTDGNLYESKLELNDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|XP_007050894.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX95051.1| HSP20-like chaperones superfamily protein isoform 2 [Theobroma 
cacao]
Length=188

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 77/110 (70%), Gaps = 8/110 (7%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDV--------NE  571
            DK+FITV LPD+KN K  LEPEG F F+A AGADN  +E+  EL DKV+V         E
Sbjct  14   DKVFITVLLPDSKNAKVNLEPEGVFTFSANAGADNNLYELKLELHDKVNVEFLFFFGKKE  73

Query  570  SKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
            SK +   R I  +++KAE  WW++LL+ +GK P ++KVDWDKWVDEDE++
Sbjct  74   SKINIGVRSIFCILEKAEKVWWNKLLRGDGKTPHYVKVDWDKWVDEDEEN  123



>ref|XP_002988870.1| hypothetical protein SELMODRAFT_128863, partial [Selaginella 
moellendorffii]
 gb|EFJ10132.1| hypothetical protein SELMODRAFT_128863, partial [Selaginella 
moellendorffii]
Length=144

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKLF+TVELPDA +   +L+P+G+F F A A AD+ P+E S EL+  V V ESK +  SR
Sbjct  12   DKLFLTVELPDAVDPSVELQPDGRFVFRA-AAADSAPYEASLELYGSVSVEESKVNVGSR  70

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
            +   ++ K E  WW RLLK EGK P ++KVDW+KW+DEDE+
Sbjct  71   HTLCIIHKQEQGWWKRLLKSEGKMPPYVKVDWNKWIDEDEE  111



>ref|XP_003573778.1| PREDICTED: uncharacterized protein Os08g0359500 [Brachypodium 
distachyon]
Length=234

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+A AG+D   +E   +L DKV+V ESK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFSFSATAGSDGNIYESKLDLNDKVNVEESKTSVGPR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  113



>gb|AFX67021.1| putative p23 co-chaperone [Solanum tuberosum]
Length=227

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK ST  R
Sbjct  14   DVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGAGDRHYELKLELQDKVNVEESKISTGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  74   SIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>ref|XP_010481284.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
 ref|XP_010481293.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
Length=202

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV+L DAK+   KL+PEG F F+A+AG+DN  FE+  EL DKV+V ESK +   R
Sbjct  14   DKVYLTVQLTDAKDADVKLDPEGVFNFSAKAGSDNQLFELKLELNDKVNVEESKINIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  112



>gb|AFX66984.1| putative p23 co-chaperone [Solanum tuberosum]
Length=256

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK ST  R
Sbjct  14   DVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGAGDRHYELKLELQDKVNVEESKISTGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  74   SIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>ref|XP_006359384.1| PREDICTED: uncharacterized protein Os08g0359500-like [Solanum 
tuberosum]
Length=230

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK ST  R
Sbjct  14   DVVYLTVMLPDAKDPKVNLDPEGVFNFSASAGAGDRHYELKLELQDKVNVEESKISTGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  74   SIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>ref|XP_009386345.1| PREDICTED: uncharacterized protein OsI_027940-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+VK  LEP+G F F+A AG  N  +E+  +L+DKVD + SK +   R
Sbjct  14   DKVYITVQLPDAKDVKVNLEPDGIFTFSATAGTGNNTYELKMDLYDKVDKDASKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +V KAE +WW +LL+ +GK P +LKVDWDKWV
Sbjct  74   SIFVVVAKAEKQWWKKLLRGDGKAPHYLKVDWDKWV  109



>ref|NP_001061631.1| Os08g0359500 [Oryza sativa Japonica Group]
 sp|Q6YYB0.1|Y8359_ORYSJ RecName: Full=Uncharacterized protein Os08g0359500 [Oryza sativa 
Japonica Group]
 dbj|BAD03784.1| putative p23 co-chaperone [Oryza sativa Japonica Group]
 dbj|BAD03808.1| putative p23 co-chaperone [Oryza sativa Japonica Group]
 dbj|BAF23545.1| Os08g0359500 [Oryza sativa Japonica Group]
 gb|EAZ42474.1| hypothetical protein OsJ_27041 [Oryza sativa Japonica Group]
 dbj|BAG96959.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99524.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L DAK+ K  LEPEG F F+A AG D   +E   EL DKV+V ESK S   R
Sbjct  14   DKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>sp|P0C8Z0.2|Y8359_ORYSI RecName: Full=Uncharacterized protein OsI_027940 [Oryza sativa 
Indica Group]
Length=210

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L DAK+ K  LEPEG F F+A AG D   +E   EL DKV+V ESK S   R
Sbjct  14   DKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|XP_009119603.1| PREDICTED: uncharacterized protein Os08g0359500-like [Brassica 
rapa]
Length=230

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL DKV+V ESK +   R
Sbjct  14   DKVYLTVLLPDAKDADVKLDPEGVFEFSAKAGPENQVYELKLELNDKVNVEESKINIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +LL   GKPP ++KVDWDKWVDEDE
Sbjct  74   SIFCIVEKAEPKWWGKLLCVGGKPPHYVKVDWDKWVDEDE  113



>gb|EEC83453.1| hypothetical protein OsI_28951 [Oryza sativa Indica Group]
Length=274

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L DAK+ K  LEPEG F F+A AG D   +E   EL DKV+V ESK S   R
Sbjct  14   DKVYITVQLADAKDAKVNLEPEGVFSFSATAGTDGNLYESKLELNDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + K P F+KVDWDKWVDED+
Sbjct  74   SIFCIVEKAEAKWWKKLVRDDQKAPHFVKVDWDKWVDEDD  113



>emb|CDY15271.1| BnaC05g01500D [Brassica napus]
Length=282

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL DKV+V ESK +   R
Sbjct  69   DKVYLTVLLPDAKDADVKLDPEGVFEFSAKAGPENQVYELKLELNDKVNVEESKINIGLR  128

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE +WWS+LL+  GKPP ++KVDWDKWVDEDE
Sbjct  129  SIFCIVEKAEPRWWSKLLRG-GKPPHYVKVDWDKWVDEDE  167



>ref|XP_006418294.1| hypothetical protein EUTSA_v10008755mg [Eutrema salsugineum]
 gb|ESQ36647.1| hypothetical protein EUTSA_v10008755mg [Eutrema salsugineum]
Length=215

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAK+   KL+PEG F F+A+AG +N  +E+  EL DKV+V ESK +   R
Sbjct  14   DKVFLTVLLPDAKDADVKLDPEGVFNFSAKAGPENQLYELKLELNDKVNVEESKINIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKAEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  112



>gb|EEE59155.1| hypothetical protein OsJ_11066 [Oryza sativa Japonica Group]
Length=160

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  630  ADNTPFEVSFELFDKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKVDW  451
            AD+TP+E+  ELFD V+V ESK +  +R ICYL+KKAE KWW RLLK+EGKPPVFLKVDW
Sbjct  20   ADDTPYELDLELFDAVNVEESKAAVAARSICYLIKKAESKWWPRLLKKEGKPPVFLKVDW  79

Query  450  DKWVDEDEQD  421
            DKW DED++D
Sbjct  80   DKWQDEDDED  89



>ref|XP_009769849.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Nicotiana sylvestris]
Length=187

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK S   R
Sbjct  14   DVVYLTVLLPDAKDSKVNLDPEGVFTFSATAGAGDRHYELKLELLDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  74   SIVCVLQKAEPKWWNKLLRGDAKTPHYVKVDWDKWVDEDDE  114



>ref|XP_004247428.1| PREDICTED: uncharacterized protein OsI_027940 [Solanum lycopersicum]
Length=225

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AG  +  +E+  EL D+V+V ESK ST  R
Sbjct  14   DVVYLTVMLPDAKDAKVNLDPEGVFNFSASAGTGDRHYELKLELQDQVNVEESKISTGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ +GK P ++KVDWDKWVDED++
Sbjct  74   SIFCILQKAEPKWWTKLLRGDGKAPHYVKVDWDKWVDEDDE  114



>ref|XP_009414713.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=180

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDA++VK  LEP+G F F+A AGA N  +E+  +L+DKV+   SK +   R
Sbjct  14   DKVYITVQLPDARDVKVNLEPDGSFTFSATAGAGNNTYELQMDLYDKVNKEASKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +V+KAE  WW +LL+ +GK P ++KVDWDKWV
Sbjct  74   SIFCVVEKAEKGWWKKLLRGDGKAPHYVKVDWDKWV  109



>ref|XP_010474870.1| PREDICTED: uncharacterized protein OsI_027940-like [Camelina 
sativa]
Length=217

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV+L DAK+   KL+PEG F F+A+AG+DN  +E+  EL DKV+V ESK +   R
Sbjct  14   DKVYLTVQLTDAKDADVKLDPEGVFNFSAKAGSDNQLYELKLELNDKVNVEESKINIGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++K E KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  74   SIFCILEKTEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  112



>ref|XP_002992410.1| hypothetical protein SELMODRAFT_186712 [Selaginella moellendorffii]
 gb|EFJ06560.1| hypothetical protein SELMODRAFT_186712 [Selaginella moellendorffii]
Length=184

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +++F+T+ELPDAK+   K+EP+GK  F+A AGA +  +EV  ELF +++V  SK ST +R
Sbjct  13   ERVFLTIELPDAKSPVVKIEPQGKLKFSATAGASDEKYEVELELFKEINVEASKISTGAR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVD  436
             I  +++KAE  WW RL+K EG+ P +LKVDW+KWVD
Sbjct  73   QIFVVIEKAEKMWWPRLIKSEGRAPPYLKVDWNKWVD  109



>ref|XP_009414711.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=181

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDA++VK  LEP+G F F+A AGA N  +E+  +L+DKV+   SK +   R
Sbjct  14   DKVYITVQLPDARDVKVNLEPDGSFTFSATAGAGNNTYELQMDLYDKVNKEASKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +V+KAE  WW +LL+ +GK P ++KVDWDKWV
Sbjct  74   SIFCVVEKAEKGWWKKLLRGDGKAPHYVKVDWDKWV  109



>ref|XP_004494372.1| PREDICTED: uncharacterized protein Os08g0359500-like [Cicer arietinum]
Length=215

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+K+ K  L P+G F F+  AGA +  +E+  ELFDKV+V ESK +   R
Sbjct  14   DKVYITVQLADSKDAKVDLAPDGTFTFSGSAGAGDNQYELKMELFDKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +V+KAE+ WW RLL+ EGKPP ++KVDWDKW 
Sbjct  74   SIFCVVQKAENGWWKRLLRGEGKPPHYVKVDWDKWA  109



>ref|XP_009769848.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Nicotiana sylvestris]
Length=223

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK S   R
Sbjct  14   DVVYLTVLLPDAKDSKVNLDPEGVFTFSATAGAGDRHYELKLELLDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  74   SIVCVLQKAEPKWWNKLLRGDAKTPHYVKVDWDKWVDEDDE  114



>emb|CDP03502.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAKN K  L+P+G F F+  AGA+N  +E+  EL DKVDV ESK +   R
Sbjct  87   DKVYLTVLLPDAKNAKVNLDPDGVFTFSGTAGAENHLYELKLELHDKVDVEESKINIGVR  146

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LL+ +GK P ++KVDWDKW DED+
Sbjct  147  NIFCVLEKAEKNWWKKLLRGDGKAPHYIKVDWDKWADEDD  186



>ref|XP_009799463.1| PREDICTED: uncharacterized protein OsI_027940 [Nicotiana sylvestris]
Length=194

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV+LPDAKN K  L+PEG F F+A AG ++  +E+  ELFDKV+V ESK +   R
Sbjct  14   DVVYLTVQLPDAKNPKVNLDPEGIFTFSATAGPESYAYELKLELFDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             I  +++K+E KWW++LL+ + K P ++KVDWDKWVDED+ +E
Sbjct  74   NIFCVLEKSEKKWWNKLLRGDEKAPHYVKVDWDKWVDEDDDNE  116



>ref|XP_010269540.1| PREDICTED: uncharacterized protein OsI_027940 [Nelumbo nucifera]
Length=177

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV LPDAKN K  LEP+G F F+A AGA+N  +E    L DKV+V ESK +   R
Sbjct  14   DKVFLTVLLPDAKNPKVNLEPDGAFTFSAIAGAENHLYEFKINLHDKVNVEESKINMGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE  WW +LLK + K P ++KVDWDKWVDED+
Sbjct  74   SIFCIIEKAEQGWWKKLLKGDEKTPHYVKVDWDKWVDEDD  113



>ref|XP_002968013.1| hypothetical protein SELMODRAFT_145227 [Selaginella moellendorffii]
 gb|EFJ31360.1| hypothetical protein SELMODRAFT_145227 [Selaginella moellendorffii]
Length=183

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +++F+T+ELPDAK+   K+EP+GK  F+A AGA +  +EV  ELF +++V  SK ST +R
Sbjct  13   ERVFLTIELPDAKSPVVKIEPQGKLKFSATAGASDEKYEVELELFKEINVEASKISTGAR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVD  436
             I  +++KAE  WW RL+K EG+ P +LKVDW+KWVD
Sbjct  73   QIFVVIEKAEKMWWPRLIKGEGRAPPYLKVDWNKWVD  109



>gb|KEH24379.1| CS domain protein [Medicago truncatula]
Length=209

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+V ESK S   R
Sbjct  14   DKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  74   NIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_009598042.1| PREDICTED: uncharacterized protein OsI_027940 isoform X3 [Nicotiana 
tomentosiformis]
Length=187

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK S   R
Sbjct  14   DVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  74   SIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDE  114



>gb|AFK43198.1| unknown [Medicago truncatula]
 gb|KEH19404.1| CS domain protein [Medicago truncatula]
 gb|AES82146.2| CS domain protein [Medicago truncatula]
Length=234

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+V ESK S   R
Sbjct  14   DKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  74   NIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>gb|KEH24380.1| CS domain protein [Medicago truncatula]
Length=242

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+V ESK S   R
Sbjct  22   DKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVNVEESKISVGVR  81

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  82   NIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  116



>ref|XP_002892131.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68390.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=228

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 1/100 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV+L DAK+   KL+PEG F F+A+AG DN  +E+  EL DKV+V ESK +   R
Sbjct  19   DIVYLTVQLADAKDADVKLDPEGIFSFSAKAGPDNQLYELKLELNDKVNVEESKINIGLR  78

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE KWW++LL+  GKPP ++KVDWDKWVDEDE
Sbjct  79   SIVCILEKAEPKWWNKLLRG-GKPPHYVKVDWDKWVDEDE  117



>ref|XP_009598041.1| PREDICTED: uncharacterized protein OsI_027940 isoform X2 [Nicotiana 
tomentosiformis]
Length=198

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK S   R
Sbjct  14   DVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  74   SIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDE  114



>dbj|BAJ94677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=224

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F A AG D   +E   +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDKVNVEASKVSVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  74   SIFCILEKAEAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  113



>gb|KEH24381.1| CS domain protein [Medicago truncatula]
Length=213

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+V ESK S   R
Sbjct  14   DKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  74   NIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_008775907.1| PREDICTED: uncharacterized protein OsI_027940-like [Phoenix dactylifera]
Length=181

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++IT++LPDAK+ K  LEP+G F F+A AGA+   +E+  +L+DKV+V  SK +T  R
Sbjct  14   DKVYITIQLPDAKDAKVNLEPDGIFSFSATAGAEKNLYELKMDLYDKVNVEGSKINTGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+K E  WW +LL+ + K P ++KVDWDKWVDED+
Sbjct  74   SIFCVVEKVEKGWWKKLLRGDEKTPHYVKVDWDKWVDEDD  113



>ref|XP_009598040.1| PREDICTED: uncharacterized protein OsI_027940 isoform X1 [Nicotiana 
tomentosiformis]
Length=229

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV LPDAK+ K  L+PEG F F+A AGA +  +E+  EL DKV+V ESK S   R
Sbjct  14   DVVYLTVLLPDAKDPKVNLDPEGIFTFSATAGAGDRHYELKLELQDKVNVEESKISIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE KWW++LL+ + K P ++KVDWDKWVDED++
Sbjct  74   SIVCVLQKAEPKWWNKLLRGDAKAPHYVKVDWDKWVDEDDE  114



>ref|XP_010522788.1| PREDICTED: uncharacterized protein OsI_027940 [Tarenaya hassleriana]
Length=204

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV+LPD+K+ K  L+PEG F F+A AG +N  +E+  EL DKV+V  SK +   R
Sbjct  14   DKIFLTVQLPDSKDAKVNLDPEGVFTFSANAGPENHLYELKLELHDKVNVEASKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE K W +LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  74   NIFCILEKAEPKRWDKLLRG-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_011082475.1| PREDICTED: uncharacterized protein OsI_027940-like [Sesamum indicum]
Length=196

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAKN K  ++PEG F F+A AG DN  +E+  +L +KV+V E K +   R
Sbjct  14   DKVYLTVLLPDAKNAKVNVDPEGTFTFSATAGTDNNLYELKLDLLEKVNVEECKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KAE KWW +LL+   K P ++KVDWDKWVDED+
Sbjct  74   NIFCVLEKAEKKWWEKLLRGNEKAPHYVKVDWDKWVDEDD  113



>ref|XP_009586785.1| PREDICTED: uncharacterized protein OsI_027940-like [Nicotiana 
tomentosiformis]
Length=193

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D +++TV+LPDAK+ K  L+PEG F F+A AG ++  +E+  ELFDK++V ESK +   R
Sbjct  14   DVVYLTVQLPDAKSSKVNLDPEGIFTFSATAGPESHAYELKLELFDKINVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             I  +++K+E KWW++LL+ + K P ++KVDWDKWVDED+ ++
Sbjct  74   NIFCVLEKSEKKWWNKLLRGDEKAPHYVKVDWDKWVDEDDDND  116



>gb|EMS68218.1| hypothetical protein TRIUR3_30845 [Triticum urartu]
Length=230

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F A AG D   +E   +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDKVNVEASKVSVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KA+ KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  74   SIFCILEKADAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  113



>ref|XP_010922352.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Elaeis guineensis]
Length=181

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+VK  LE +G F F+A AGA+   +E+  +L+DKV+V  SK +T  R
Sbjct  14   DKVYITVQLPDAKDVKVNLESDGIFTFSATAGAEKNLYELKMDLYDKVNVEGSKINTGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+K E  WW +LL+ + K P ++KVDWDKWVDED+
Sbjct  74   SIFCMVEKVEKVWWKKLLRGDEKTPHYVKVDWDKWVDEDD  113



>ref|XP_003625928.1| RING finger protein 113A [Medicago truncatula]
Length=394

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+V ESK S   R
Sbjct  14   DKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  74   NIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_003628460.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
Length=358

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+V ESK S   R
Sbjct  14   DKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE  WW RLL+ EGK P ++K+DWDKW
Sbjct  74   NIFCVVQKAESGWWKRLLRGEGKAPHYVKIDWDKW  108



>ref|XP_010556743.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Tarenaya hassleriana]
Length=206

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV+L D+KN K  L+PEG F F+A AG +N  +E+  EL DKV+V  SK +   R
Sbjct  14   DKVFLTVQLADSKNTKVNLDPEGVFTFSANAGPENHVYELKLELHDKVNVEPSKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE K W +LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  74   NIFCILEKAEPKRWEKLLRG-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_010556742.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Tarenaya hassleriana]
Length=224

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV+L D+KN K  L+PEG F F+A AG +N  +E+  EL DKV+V  SK +   R
Sbjct  14   DKVFLTVQLADSKNTKVNLDPEGVFTFSANAGPENHVYELKLELHDKVNVEPSKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE K W +LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  74   NIFCILEKAEPKRWEKLLRG-GKPPHYVKVDWDKWVDEDEE  113



>gb|EMT10253.1| hypothetical protein F775_29406 [Aegilops tauschii]
Length=335

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F A AG D   +E   +L DKV+V  SK S   R
Sbjct  116  DKVYITVQLPDAKDAKVNLEPDGVFSFFATAGTDGNSYESKLDLNDKVNVEASKVSVGVR  175

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +++KA+ KWW++L++ + K P F+KVDWDKWVDED+
Sbjct  176  SIFCILEKADAKWWNKLVRDDQKAPHFVKVDWDKWVDEDD  215



>ref|XP_007163102.1| hypothetical protein PHAVU_001G206400g [Phaseolus vulgaris]
 gb|ESW35096.1| hypothetical protein PHAVU_001G206400g [Phaseolus vulgaris]
Length=186

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV+L D+KN K  L PEG F F+  AG+++  +E+  ELF+KV+V ESK +   R
Sbjct  14   DKVFVTVQLADSKNAKVDLTPEGVFTFSGSAGSEDHQYELKLELFEKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +V+KAE  WW R L+ EGK P ++KVDWDKWV
Sbjct  74   SIFCVVQKAEIGWWKRFLRAEGKTPHYVKVDWDKWV  109



>gb|ACJ83262.1| unknown [Medicago truncatula]
Length=217

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L D+KN K  L PEG F F+  AGA +  +E+  ELFDKV+V ESK S   R
Sbjct  14   DKVYITVQLADSKNSKVDLTPEGDFTFSGSAGAGDNQYELKLELFDKVNVEESKISVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE  WW RLL+ EGK P ++K+ WDKW
Sbjct  74   NIFCVVQKAESGWWKRLLRGEGKAPHYVKIVWDKW  108



>gb|AGV54501.1| zinc finger CCCH domain-containing protein [Phaseolus vulgaris]
Length=186

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV+L D+KN K  L PEG F F+  AG+++  +E+  ELF+KV+V ESK +   R
Sbjct  14   DKVYVTVQLADSKNAKVDLTPEGVFTFSGSAGSEDHQYELKLELFEKVNVEESKINVGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +V+KAE  WW R L+ EGK P ++KVDWDKWV
Sbjct  74   SIFCVVQKAEIGWWKRFLRAEGKTPHYVKVDWDKWV  109



>gb|ABR17014.1| unknown [Picea sitchensis]
Length=157

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DKL++TV LPDAKNV  K EP+GKF F+A  G    PF++  ELF K++   SK +   R
Sbjct  14   DKLYLTVCLPDAKNVLVKPEPDGKFSFSA-IGLHAEPFQLELELFGKLNSEGSKINIGLR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  ++KK E  WW RLLK EGKP  ++KVDW+KW DEDE++
Sbjct  73   NIFCVLKKEEKGWWKRLLKSEGKPAPYIKVDWNKWCDEDEEE  114



>ref|XP_010906988.1| PREDICTED: uncharacterized protein OsI_027940-like [Elaeis guineensis]
Length=174

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 71/95 (75%), Gaps = 1/95 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+VK  LEP+G F F+A AGA+N  +E+  +L+DKV+V  S+ +T  R
Sbjct  14   DKVYITVQLPDAKDVKVNLEPDGIFTFSATAGAENNLYELKMDLYDKVNVEGSRINTGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+K E  WW +LL+ +GK P ++KVDWDKW
Sbjct  74   SIFCVVEKVEKGWWKKLLR-DGKTPHYVKVDWDKW  107



>gb|ACN35583.1| unknown [Zea mays]
 gb|AFW60896.1| hypothetical protein ZEAMMB73_488396 [Zea mays]
Length=120

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|ACN34684.1| unknown [Zea mays]
Length=191

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|ACF88149.1| unknown [Zea mays]
 gb|ACG29923.1| hypothetical protein [Zea mays]
 gb|AFW60897.1| co-chaperone protein SBA1 [Zea mays]
Length=192

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>ref|XP_008792885.1| PREDICTED: uncharacterized protein OsI_027940-like [Phoenix dactylifera]
Length=200

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+VK  LEP+G F F+A AGA+N  +E+  +L+DKV+V  S+ +T  R
Sbjct  28   DKVYITVQLPDAKDVKVNLEPDGIFTFSATAGAENNLYELKMDLYDKVNVEGSRINTGVR  87

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPV-----FLKVDWDKWVDEDE  427
             I  +V+K E  WW +LL+ + K        +LKVDWD WVDED+
Sbjct  88   SIFCVVEKVEKGWWKKLLRGDDKNTSLSESRYLKVDWDMWVDEDD  132



>tpg|DAA49201.1| TPA: hypothetical protein ZEAMMB73_435161 [Zea mays]
Length=128

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|KFK30837.1| hypothetical protein AALP_AA6G032100 [Arabis alpina]
Length=234

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +K+F+T+ L DAK+ K  L PEG   F+A+AG +N  FE+  EL DKV+V ESK +   R
Sbjct  14   EKIFLTIVLADAKDAKVNLAPEGVLDFSAKAGPENHVFELKLELHDKVNVEESKINIGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++KAE   W +LL+  GKPP ++KVDWDKWVDEDE++
Sbjct  74   SIFCIIEKAEPARWDKLLRG-GKPPHYVKVDWDKWVDEDEEN  114



>ref|XP_011079678.1| PREDICTED: uncharacterized protein Os08g0359500 [Sesamum indicum]
Length=182

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV L DAKN K K++P+G F F+A AG DN  +E+  +L DKV+V ESK +   R
Sbjct  14   DKVYLTVLLSDAKNPKVKVDPDGTFTFSATAGTDNNLYELKLDLLDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +++KAE +WW +LL+   K P ++KVDWDKWV
Sbjct  74   NIFCVLEKAEQQWWKKLLRGNAKAPHYVKVDWDKWV  109



>ref|NP_001241744.1| co-chaperone protein SBA1 [Zea mays]
 gb|ACG34656.1| co-chaperone protein SBA1 [Zea mays]
Length=198

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+   G +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFTFSGSVGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>ref|NP_001148972.1| LOC100282592 [Zea mays]
 gb|ACG33684.1| co-chaperone protein SBA1 [Zea mays]
Length=205

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>gb|ACR38464.1| unknown [Zea mays]
 tpg|DAA49202.1| TPA: co-chaperone protein SBA1 [Zea mays]
Length=205

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>ref|XP_010456028.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=234

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D K+ K  L PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  14   DKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELKLELHDKVNVEESKINVGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  74   SIFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDEE  113



>tpg|DAA49203.1| TPA: hypothetical protein ZEAMMB73_435161 [Zea mays]
Length=210

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  20   DKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  77

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  78   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  117



>ref|NP_001150702.1| co-chaperone protein SBA1 [Zea mays]
 ref|XP_008676569.1| PREDICTED: LOC100282592 isoform X1 [Zea mays]
 gb|ACG40054.1| co-chaperone protein SBA1 [Zea mays]
 tpg|DAA49204.1| TPA: co-chaperone protein SBA1 [Zea mays]
Length=211

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  L+P+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  20   DKVYITVQLPDAKDAKVNLDPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  77

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  78   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  117



>ref|XP_010429707.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=240

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D K+ K  L PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  14   DKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELKLELHDKVNVEESKINVGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  74   SIFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDEE  113



>emb|CBI29165.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  636  AGADNTPFEVSFELFDKVDVNESKGSTTSRYICYLVKKAEDKWWSRLLKQEGKPPVFLKV  457
            A  D+ P+EV  ELFDK+ V +SK +   R I Y++ KAE KWW+RL+K EGKPPVFLKV
Sbjct  4    ATKDDVPYEVDIELFDKIKVEDSKCNVGVRSIVYVIAKAEKKWWARLIKNEGKPPVFLKV  63

Query  456  DWDKWVDEDEQDEK  415
            DWDKWVDE++++EK
Sbjct  64   DWDKWVDEEDENEK  77



>ref|XP_006288563.1| hypothetical protein CARUB_v10001852mg [Capsella rubella]
 gb|EOA21461.1| hypothetical protein CARUB_v10001852mg [Capsella rubella]
Length=237

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D K+ K  L PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  14   DKIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHVYELKLELHDKVNVEESKINVGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+  GKPP ++KVDWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDDE  113



>ref|XP_010422586.1| PREDICTED: uncharacterized protein Os08g0359500-like [Camelina 
sativa]
Length=231

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = -3

Query  723  KLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSRY  544
            K+F+TV L D K+ K  L PEG F F+A+ G +N  +E++ EL DKV+V ESK +   R 
Sbjct  15   KIFLTVVLADTKDTKVNLAPEGVFDFSAKVGPENHLYELNLELHDKVNVEESKINVGERS  74

Query  543  ICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
            I  +++KAE + W++LL+  GKPP ++KVDWDKWVDEDE+
Sbjct  75   IFCIIEKAEPERWNKLLRV-GKPPHYVKVDWDKWVDEDEE  113



>ref|XP_006396454.1| hypothetical protein EUTSA_v10028946mg [Eutrema salsugineum]
 gb|ESQ37907.1| hypothetical protein EUTSA_v10028946mg [Eutrema salsugineum]
Length=225

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D+K+ K  L PEG F F+A+AG +N  FE+  EL DKV+V ESK +   R
Sbjct  14   DKIFLTVVLADSKDAKVNLNPEGVFDFSAKAGPENHVFELKLELHDKVNVEESKINIGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++L++  GK P ++KVDWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWNKLIRG-GKAPHYVKVDWDKWVDEDDE  113



>ref|XP_010259596.1| PREDICTED: uncharacterized protein OsI_027940-like [Nelumbo nucifera]
Length=187

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAKN K  LEP+G F F+A  G +N  +E+   L DKV+V ESK +   R
Sbjct  14   DKVYLTVLLPDAKNSKVNLEPDGVFTFSATTGPENLLYELKINLHDKVNVEESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWV  439
             I  +++KAE  WW +LL+ + K P ++KVDWDKWV
Sbjct  74   NIFCVIEKAEKGWWKKLLQADEKTPHYVKVDWDKWV  109



>ref|XP_009134431.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X2 
[Brassica rapa]
Length=210

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D+K  K  L+PEG F F+A+AG +N  +E+  EL DKV+V ESK +   R
Sbjct  14   DKIFLTVVLADSKETKVNLDPEGVFDFSAKAGPENHVYELKLELHDKVNVEESKINIGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W +L++  GK P ++KVDWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWDKLIRG-GKAPHYVKVDWDKWVDEDDE  113



>ref|XP_002444216.1| hypothetical protein SORBIDRAFT_07g015140 [Sorghum bicolor]
 gb|EES13711.1| hypothetical protein SORBIDRAFT_07g015140 [Sorghum bicolor]
Length=214

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+L DAK+ K  LEP+G F F+   G +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLSDAKDAKVNLEPDGVFTFSGSVGTN--VYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDE  427
             I  +V+KAE KWW +L++ + + P F+KVDWDKWVDED+
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKWVDEDD  111



>ref|XP_001763304.1| predicted protein [Physcomitrella patens]
 gb|EDQ71834.1| predicted protein [Physcomitrella patens]
Length=156

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TVELPDA N + KL+P+G+F F A   + +  +E  F+LF +V V+ S      R
Sbjct  17   DKIYLTVELPDAINAQVKLQPDGRFTFTA--SSKDAKYEADFQLFGRVKVDVSNIDEGRR  74

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
            +   +++K E  WW RLLK EGK P F+K DW++W+DEDE++E
Sbjct  75   HTFCVIQKEESGWWDRLLK-EGKAPPFVKADWNRWIDEDEEEE  116



>gb|AAT68744.1| hypothetical protein At3g03773 [Arabidopsis thaliana]
Length=117

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K+ + E + +   R
Sbjct  14   DKVYLTVALPDAKDISVKCEPQGLFSFSA-LGAQGERFEFSLELYGKI-MTEYRKNVGLR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  72   NIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>ref|XP_009144563.1| PREDICTED: uncharacterized protein Os08g0359500-like [Brassica 
rapa]
Length=218

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DKV+V+ESK +   R
Sbjct  14   DKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHAYELKLELHDKVNVDESKINIGVR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++L++  GK P ++K+DWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWNKLIRG-GKAPHYVKIDWDKWVDEDDE  113



>pdb|2KMW|A Chain A, Solution Structure Of At3g03773.1 Protein From Arabidopsis 
Thaliana
Length=150

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K+ + E + +   R
Sbjct  14   DKVYLTVALPDAKDISVKCEPQGLFSFSA-LGAQGERFEFSLELYGKI-MTEYRKNVGLR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  72   NIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>ref|NP_683525.2| p23 co-chaperone protein [Arabidopsis thaliana]
 sp|Q6ID70.1|Y3377_ARATH RecName: Full=Uncharacterized protein At3g03773 [Arabidopsis 
thaliana]
 gb|AAT41786.1| At3g03773 [Arabidopsis thaliana]
 gb|AAT68743.1| hypothetical protein At3g03773 [Arabidopsis thaliana]
 gb|AAT70471.1| At3g03773 [Arabidopsis thaliana]
 gb|AAX55169.1| hypothetical protein At3g03773 [Arabidopsis thaliana]
 gb|AEE73986.1| p23 co-chaperone protein [Arabidopsis thaliana]
Length=150

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K+ + E + +   R
Sbjct  14   DKVYLTVALPDAKDISVKCEPQGLFSFSA-LGAQGERFEFSLELYGKI-MTEYRKNVGLR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  72   NIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>emb|CDX90937.1| BnaA03g26170D [Brassica napus]
Length=240

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D+K  K  L+PEG F F+A++G +N  +E+  EL DKV+V ESK +   R
Sbjct  35   DKIFLTVVLADSKETKVNLDPEGVFDFSAKSGPENHVYELKLELHDKVNVEESKINIGER  94

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W +L++  GK P ++KVDWDKWVDED++
Sbjct  95   SIFCIIEKAEPERWDKLIRG-GKAPHYVKVDWDKWVDEDDE  134



>ref|XP_009134430.1| PREDICTED: uncharacterized protein OsI_027940-like isoform X1 
[Brassica rapa]
Length=239

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D+K  K  L+PEG F F+A+AG +N  +E+  EL DKV+V ESK +   R
Sbjct  43   DKIFLTVVLADSKETKVNLDPEGVFDFSAKAGPENHVYELKLELHDKVNVEESKINIGER  102

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W +L++  GK P ++KVDWDKWVDED++
Sbjct  103  SIFCIIEKAEPERWDKLIRG-GKAPHYVKVDWDKWVDEDDE  142



>ref|XP_006826339.1| hypothetical protein AMTR_s00004p00112630 [Amborella trichopoda]
 gb|ERM93576.1| hypothetical protein AMTR_s00004p00112630 [Amborella trichopoda]
Length=158

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP G F F+A+ G +N  F+ S EL+  +    +K +   R
Sbjct  15   DKVYVTVALPDAKDISIKSEPHGLFIFSAK-GRNNESFDFSLELYGPIVPESNKSNFGLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I  +++K E+ WW RL+K +GKP  ++KVDW+KW DEDE++
Sbjct  74   NILCVIQKKEEGWWPRLVKSDGKPAPYIKVDWNKWCDEDEEE  115



>emb|CDY18019.1| BnaC03g30910D [Brassica napus]
Length=304

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DKV+V ESK +   R
Sbjct  96   DKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHVYELKLELHDKVNVEESKINIGER  155

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE   W +L+++ GK P ++KVDWDKWVDED++
Sbjct  156  SIFCIIEKAEPARWDKLIRR-GKAPHYVKVDWDKWVDEDDE  195



>ref|NP_001154201.1| HSP20-like chaperone [Arabidopsis thaliana]
 gb|AEE82174.1| HSP20-like chaperone [Arabidopsis thaliana]
Length=240

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  14   EKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADKVNVEESKINIGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>ref|XP_002872836.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49095.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  14   EKIFLTVVLADTKDAKVNLDPEGVFDFSAKVGPENHVYELKLELHDKVNVEESKINIGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>ref|NP_192154.2| HSP20-like chaperone [Arabidopsis thaliana]
 gb|AAM83226.1| AT4g02450/T14P8_5 [Arabidopsis thaliana]
 gb|AAN18096.1| At4g02450/T14P8_5 [Arabidopsis thaliana]
 gb|AEE82173.1| HSP20-like chaperone [Arabidopsis thaliana]
Length=241

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  14   EKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADKVNVEESKINIGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>ref|XP_007151769.1| hypothetical protein PHAVU_004G073200g [Phaseolus vulgaris]
 gb|ESW23763.1| hypothetical protein PHAVU_004G073200g [Phaseolus vulgaris]
Length=119

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK+V  K EP+G F F+A +G  +  +  S EL+  ++    K  +  R
Sbjct  14   DKVYLTVALPDAKDVSVKCEPQGLFSFSA-SGVQDESYSFSLELYGSIEPEGCKTKSGLR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I   V+K E  WW RLLK E KP  +LKVDW+KW DEDE+
Sbjct  73   NILCSVQKGEKGWWKRLLKSEEKPAPYLKVDWNKWCDEDEE  113



>emb|CAC16575.1| p23 co-chaperone [Arabidopsis thaliana]
Length=241

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  14   EKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADKVNVEESKINIGER  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  74   SIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  113



>ref|XP_008386859.1| PREDICTED: uncharacterized protein At3g03773 [Malus domestica]
Length=153

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EPEG F F+A  G    PF  + EL+  +  +  K  T  R
Sbjct  17   DKVYLTVALPDAKDITVKCEPEGLFSFSA-VGVQGEPFHFTLELYGPITPDGCKTRTGLR  75

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I   ++K +  WW RLLK E KP  ++KVDW+KW DEDE+
Sbjct  76   NILCSIQKEQRGWWKRLLKTEEKPAPYIKVDWNKWCDEDEE  116



>ref|NP_001154589.1| p23 co-chaperone protein [Arabidopsis thaliana]
 gb|AEE73987.1| p23 co-chaperone protein [Arabidopsis thaliana]
Length=204

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K+ + E + +   R
Sbjct  68   DKVYLTVALPDAKDISVKCEPQGLFSFSA-LGAQGERFEFSLELYGKI-MTEYRKNVGLR  125

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  126  NIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  166



>ref|XP_002882306.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58565.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=150

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP G F F+A  GA    FE S EL+ K+ + E + +   R
Sbjct  14   DKVYLTVALPDAKDISVKCEPRGLFSFSA-LGAQGERFEFSLELYGKI-MPEYRKNVGLR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  72   NIIFSIQKEEKSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>emb|CDY29960.1| BnaC01g40480D [Brassica napus]
Length=157

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ KV V E + +   R
Sbjct  21   DKVYLTVALPDAKDISVKCEPQGLFTFSA-LGAQGKLFEFSLELYGKV-VPEYRKNVGLR  78

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW R+LK E KP  ++KVDW+KW DEDE+
Sbjct  79   NIIFSIQKEERSWWPRILKSEEKPAPYIKVDWNKWCDEDEE  119



>ref|XP_004489674.1| PREDICTED: uncharacterized protein At3g03773-like [Cicer arietinum]
Length=151

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 1/103 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK+V  K EP G F F+A +   +  +  S EL+  ++    K  T+SR
Sbjct  14   DKVYLTVALPDAKDVTVKCEPHGLFSFSA-SRVQHESYSFSLELYGSIEPGGCKTKTSSR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQDE  418
             I   ++K +  WW RLLK E KP  +LKVDW+KW DEDE+ +
Sbjct  73   NILCSIQKGQRGWWKRLLKSEEKPAPYLKVDWNKWCDEDEESD  115



>gb|AAC19287.1| T14P8.5 [Arabidopsis thaliana]
 emb|CAB80738.1| putative protein [Arabidopsis thaliana]
Length=262

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            +K+F+TV L D K+ K  L+PEG F F+A+ G +N  +E+  EL DKV+V ESK +   R
Sbjct  18   EKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADKVNVEESKINIGER  77

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++LL+ + KPP ++KVDWDKWVDED++
Sbjct  78   SIFCIIEKAEPERWNKLLRVK-KPPHYVKVDWDKWVDEDDE  117



>emb|CDX97265.1| BnaA02g20560D [Brassica napus]
Length=1121

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726   DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
             DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DKV+V+ESK +   R
Sbjct  936   DKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHAYELKLELHDKVNVDESKINIGVR  995

Query  546   YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
              I  +++KAE + W++L++  GK P ++K+DWDKWVDED++
Sbjct  996   SIFCIIEKAEPERWNKLIRG-GKAPHYVKIDWDKWVDEDDE  1035



>ref|XP_009366492.1| PREDICTED: uncharacterized protein At3g03773-like [Pyrus x bretschneideri]
 ref|XP_009366493.1| PREDICTED: uncharacterized protein At3g03773-like [Pyrus x bretschneideri]
 ref|XP_009350547.1| PREDICTED: uncharacterized protein At3g03773-like [Pyrus x bretschneideri]
Length=153

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EPEG F F+A  G    PF  + EL+  +  +  K  T  R
Sbjct  17   DKVYLTVALPDAKDITVKCEPEGFFSFSA-VGVQGEPFHFTLELYGPITPDGCKTRTGLR  75

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I   ++K +  WW RLLK E KP  ++KVDW+KW DEDE+
Sbjct  76   NILCSIQKEQRGWWKRLLKTEEKPAPYIKVDWNKWCDEDEE  116



>emb|CDX91318.1| BnaC02g27290D [Brassica napus]
Length=886

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+F+TV L D+K  K  L PEG F F+A+AG +N  +E+  EL DKV+V+ESK +   R
Sbjct  697  DKIFLTVVLADSKETKVNLLPEGVFDFSAKAGPENHVYELKLELHDKVNVDESKINIGVR  756

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I  +++KAE + W++L++  GK P ++K+DWDKWVDED++
Sbjct  757  SIFCIIEKAEPERWNKLIRG-GKAPHYVKIDWDKWVDEDDE  796



>ref|XP_007202648.1| hypothetical protein PRUPE_ppa012211mg [Prunus persica]
 gb|EMJ03847.1| hypothetical protein PRUPE_ppa012211mg [Prunus persica]
Length=179

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  G    PF  + +L+  +  +  K     R
Sbjct  72   DKVYLTVALPDAKDINIKCEPQGSFSFSA-IGVQGEPFHFTLDLYGPITPDGCKTKAGLR  130

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I   ++K ++ WW RLLK E KP  ++KVDW+KW DEDE+D
Sbjct  131  NILCSIQKDQNGWWKRLLKTEEKPAPYIKVDWNKWCDEDEED  172



>ref|XP_004973281.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X2 [Setaria italica]
Length=214

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  14   DKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE KWW +L++ + + P F+KVDWDKW
Sbjct  72   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKW  106



>gb|AFK42085.1| unknown [Lotus japonicus]
Length=150

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK+V  K EP G F F+A +G  + P+  S EL+  ++    K     R
Sbjct  14   DKVYLTVALPDAKDVSVKCEPHGLFSFSA-SGVQHEPYSFSLELYGSIEPEGCKIKAGLR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I   V+K +  WW RLLK E KP  +LKVDW++W DED+++
Sbjct  73   NILCSVQKGQKGWWKRLLKSEDKPAPYLKVDWNRWCDEDDEE  114



>ref|XP_008244127.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Prunus 
mume]
Length=127

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  G    PF  + +L+  +  +  K     R
Sbjct  14   DKVYLTVALPDAKDINIKCEPQGSFSFSA-IGVQGEPFHFTLDLYGPITPDGCKTKAGLR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I   ++K +  WW RLLK E KP  ++KVDW+KW DEDE+D
Sbjct  73   NILCSIQKDQKGWWKRLLKTEEKPAPYIKVDWNKWCDEDEED  114



>ref|XP_004973280.1| PREDICTED: uncharacterized protein Os08g0359500-like isoform 
X1 [Setaria italica]
Length=220

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 66/95 (69%), Gaps = 2/95 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK++ITV+LPDAK+ K  LEP+G F F+  AG +   +E+  +L DKV+V  SK S   R
Sbjct  20   DKVYITVQLPDAKDAKVNLEPDGVFTFSGSAGTN--LYELKLDLNDKVNVEASKISVGVR  77

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKW  442
             I  +V+KAE KWW +L++ + + P F+KVDWDKW
Sbjct  78   SIFCIVEKAEAKWWKKLVRDDQRAPHFVKVDWDKW  112



>ref|XP_010514039.1| PREDICTED: uncharacterized protein At3g03773 isoform X1 [Camelina 
sativa]
 ref|XP_010514104.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Camelina 
sativa]
 ref|XP_010463839.1| PREDICTED: uncharacterized protein At3g03773 [Camelina sativa]
 ref|XP_010485732.1| PREDICTED: uncharacterized protein At3g03773 [Camelina sativa]
Length=149

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 68/101 (67%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE S EL+ K+ + E + +   R
Sbjct  14   DKVYLTVALPDAKDLSVKCEPQGLFSFSA-LGALGERFEFSLELYGKI-LPEYRKNVGLR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW+RLLK E KP  ++KVDW+KW DEDE+
Sbjct  72   NIIFSIQKEEKSWWTRLLKSEEKPAPYIKVDWNKWCDEDEE  112



>ref|XP_009102082.1| PREDICTED: uncharacterized protein At3g03773 [Brassica rapa]
Length=150

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE   EL+ KV V E + +   R
Sbjct  14   DKVYLTVALPDAKDISVKCEPQGLFTFSA-LGAQGKLFEFGLELYGKV-VPEYRKNVGLR  71

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW R+LK E KP  ++KVDW+KW DEDE+
Sbjct  72   NIIFSIQKEERSWWPRILKSEEKPAPYIKVDWNKWCDEDEE  112



>ref|XP_004136663.1| PREDICTED: uncharacterized protein At3g03773-like [Cucumis sativus]
 ref|XP_004171162.1| PREDICTED: uncharacterized protein At3g03773-like [Cucumis sativus]
 gb|KGN59490.1| hypothetical protein Csa_3G822410 [Cucumis sativus]
Length=151

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP G F F+A+ G   + F+ + ELF  +     K   + R
Sbjct  15   DKVYLTVSLPDAKDISVKCEPHGLFSFSAK-GLQGSSFDFTLELFGSIVPEGCKTKVSLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I   ++K +  WW RLLK E KP  +LKVDW+KW DEDE D
Sbjct  74   NIICSIQKEQKGWWKRLLKTEEKPAPYLKVDWNKWCDEDESD  115



>ref|XP_008443309.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Cucumis 
melo]
 ref|XP_008443310.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Cucumis 
melo]
 ref|XP_008443311.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Cucumis 
melo]
 ref|XP_008443312.1| PREDICTED: uncharacterized protein At3g03773 isoform X2 [Cucumis 
melo]
Length=134

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D++++TV LPDAK++  K EP G F F+A+ G   + F+ + ELF  +     K   + R
Sbjct  15   DRVYLTVSLPDAKDISVKCEPHGLFSFSAK-GLQGSSFDFTLELFGSIVPEGCKTKVSLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I   ++K +  WW RLLK E KP  +LKVDW+KW DEDE D
Sbjct  74   NIICSIQKEQKGWWKRLLKTEEKPAPYLKVDWNKWCDEDESD  115



>ref|XP_006408265.1| hypothetical protein EUTSA_v10021254mg [Eutrema salsugineum]
 gb|ESQ49718.1| hypothetical protein EUTSA_v10021254mg [Eutrema salsugineum]
Length=288

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  + EP+G F F+A  GA    FE S EL+ K+ V E + +   R
Sbjct  53   DKVYLTVALPDAKDISVRCEPQGLFSFSA-IGAQGKHFEFSLELYGKI-VPEYRKNVGLR  110

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW R+LK E KP  ++KVDW+KW DEDE+
Sbjct  111  NIIFSIQKEERSWWPRILKSEDKPAPYIKVDWNKWCDEDEE  151



>emb|CDY21163.1| BnaA01g33940D [Brassica napus]
Length=194

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 2/101 (2%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAK++  K EP+G F F+A  GA    FE   EL+ KV V E + +   R
Sbjct  59   DKVYLTVALPDAKDISVKCEPQGLFTFSA-LGAQGKLFEFGLELYGKV-VPEYRKNVGLR  116

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQ  424
             I + ++K E  WW R+LK E KP  ++KVDW+KW DEDE+
Sbjct  117  NIIFSIQKEERSWWPRILKSEEKPAPYIKVDWNKWCDEDEE  157



>ref|XP_003550100.1| PREDICTED: uncharacterized protein At3g03773-like isoform 1 [Glycine 
max]
Length=151

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 64/102 (63%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            DK+++TV LPDAKNV  K EP+G F F+A +G     +  S EL+  ++    K  +  R
Sbjct  14   DKVYLTVALPDAKNVSVKCEPQGLFTFSA-SGVQEEAYSFSLELYGCIEPEGCKTKSGLR  72

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I   ++K E  WW RLLK E KP  +LKVDW++W DED+++
Sbjct  73   NILCSIQKGEKGWWKRLLKSEEKPAPYLKVDWNRWCDEDDEE  114



>ref|XP_008443308.1| PREDICTED: uncharacterized protein At3g03773 isoform X1 [Cucumis 
melo]
Length=151

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 1/102 (1%)
 Frame = -3

Query  726  DKLFITVELPDAKNVKFKLEPEGKFYFAAEAGADNTPFEVSFELFDKVDVNESKGSTTSR  547
            D++++TV LPDAK++  K EP G F F+A+ G   + F+ + ELF  +     K   + R
Sbjct  15   DRVYLTVSLPDAKDISVKCEPHGLFSFSAK-GLQGSSFDFTLELFGSIVPEGCKTKVSLR  73

Query  546  YICYLVKKAEDKWWSRLLKQEGKPPVFLKVDWDKWVDEDEQD  421
             I   ++K +  WW RLLK E KP  +LKVDW+KW DEDE D
Sbjct  74   NIICSIQKEQKGWWKRLLKTEEKPAPYLKVDWNKWCDEDESD  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455