BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027E17

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN82364.1|  hypothetical protein VITISV_027615                   92.4    2e-20   Vitis vinifera
ref|XP_010647885.1|  PREDICTED: uncharacterized protein LOC104877276  92.4    2e-20   Vitis vinifera
ref|XP_007041356.1|  Cytochrome P450 82C4, putative isoform 2         89.4    3e-19   
ref|XP_004230836.1|  PREDICTED: uncharacterized protein LOC101256427  88.6    5e-19   Solanum lycopersicum
ref|XP_011092749.1|  PREDICTED: uncharacterized protein LOC105172858  88.6    6e-19   Sesamum indicum [beniseed]
ref|XP_004168718.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  88.6    6e-19   
ref|XP_010999653.1|  PREDICTED: uncharacterized protein LOC105107426  88.2    7e-19   Populus euphratica
ref|XP_006346502.1|  PREDICTED: uncharacterized protein LOC102594981  87.8    1e-18   Solanum tuberosum [potatoes]
ref|XP_011088318.1|  PREDICTED: uncharacterized protein LOC105169591  87.4    1e-18   Sesamum indicum [beniseed]
ref|XP_006356593.1|  PREDICTED: uncharacterized protein LOC102600718  87.4    2e-18   Solanum tuberosum [potatoes]
ref|XP_010263800.1|  PREDICTED: uncharacterized protein LOC104601975  87.0    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006379220.1|  hypothetical protein POPTR_0009s11190g           86.7    2e-18   
gb|KCW55289.1|  hypothetical protein EUGRSUZ_I01216                   85.5    4e-18   Eucalyptus grandis [rose gum]
ref|XP_010028534.1|  PREDICTED: uncharacterized protein LOC104418790  85.9    5e-18   Eucalyptus grandis [rose gum]
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1         91.3    5e-18   
ref|XP_010028532.1|  PREDICTED: uncharacterized protein LOC104418787  85.5    8e-18   
ref|XP_010066069.1|  PREDICTED: uncharacterized protein LOC104453242  85.1    1e-17   Eucalyptus grandis [rose gum]
ref|XP_010096265.1|  Cytochrome b6-f complex subunit 7                83.6    3e-17   Morus notabilis
ref|XP_009770222.1|  PREDICTED: uncharacterized protein LOC104220953  83.6    4e-17   Nicotiana sylvestris
emb|CDO97118.1|  unnamed protein product                              83.6    4e-17   Coffea canephora [robusta coffee]
ref|XP_004306468.1|  PREDICTED: uncharacterized protein LOC101301039  82.8    8e-17   Fragaria vesca subsp. vesca
ref|XP_004290394.1|  PREDICTED: uncharacterized protein LOC101303081  82.0    2e-16   Fragaria vesca subsp. vesca
ref|XP_004288567.1|  PREDICTED: uncharacterized protein LOC101314888  81.3    3e-16   Fragaria vesca subsp. vesca
ref|XP_009769333.1|  PREDICTED: uncharacterized protein LOC104220206  80.5    5e-16   Nicotiana sylvestris
gb|KDO52154.1|  hypothetical protein CISIN_1g033208mg                 79.7    1e-15   Citrus sinensis [apfelsine]
ref|XP_006423129.1|  hypothetical protein CICLE_v10030439mg           79.7    1e-15   
ref|XP_006423127.1|  hypothetical protein CICLE_v10030439mg           79.3    2e-15   Citrus clementina [clementine]
gb|EYU37732.1|  hypothetical protein MIMGU_mgv1a016429mg              79.0    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_002510294.1|  plastoquinol-plastocyanin reductase, putative    79.3    2e-15   
ref|NP_001235238.1|  uncharacterized protein LOC100500243             79.0    2e-15   Glycine max [soybeans]
ref|XP_009613230.1|  PREDICTED: uncharacterized protein LOC104106393  79.0    5e-15   Nicotiana tomentosiformis
gb|AAF34768.1|AF227623_1  unknown                                     76.6    2e-14   Euphorbia esula [wolf's milk]
ref|XP_007201416.1|  hypothetical protein PRUPE_ppa013368mg           75.5    4e-14   
ref|XP_010941885.1|  PREDICTED: uncharacterized protein LOC105060020  75.5    4e-14   
gb|KDP38419.1|  hypothetical protein JCGZ_04344                       74.7    7e-14   Jatropha curcas
ref|XP_004248748.1|  PREDICTED: uncharacterized protein LOC101250638  73.9    2e-13   Solanum lycopersicum
ref|XP_009388518.1|  PREDICTED: cytochrome b6-f complex subunit 7...  73.9    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010684011.1|  PREDICTED: uncharacterized protein LOC104898612  73.9    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008454894.1|  PREDICTED: uncharacterized protein LOC103495201  73.6    2e-13   Cucumis melo [Oriental melon]
gb|AFK46863.1|  unknown                                               72.0    8e-13   Lotus japonicus
ref|XP_004137000.1|  PREDICTED: uncharacterized protein LOC101210...  71.2    1e-12   
gb|EPS66539.1|  hypothetical protein M569_08240                       70.9    2e-12   Genlisea aurea
ref|XP_004136999.1|  PREDICTED: uncharacterized protein LOC101210...  71.2    3e-12   Cucumis sativus [cucumbers]
gb|KGN43969.1|  hypothetical protein Csa_7G075020                     71.2    3e-12   Cucumis sativus [cucumbers]
ref|XP_006398038.1|  hypothetical protein EUTSA_v10001257mg           71.2    3e-12   
emb|CBI32504.3|  unnamed protein product                              74.3    5e-12   Vitis vinifera
ref|XP_008813189.1|  PREDICTED: uncharacterized protein LOC103723892  69.7    5e-12   Phoenix dactylifera
ref|XP_010908023.1|  PREDICTED: uncharacterized protein LOC105034521  69.3    7e-12   Elaeis guineensis
ref|XP_011030865.1|  PREDICTED: uncharacterized protein LOC105130182  68.9    1e-11   Populus euphratica
ref|NP_001236249.1|  uncharacterized protein LOC100500315             67.8    2e-11   Glycine max [soybeans]
ref|XP_007153152.1|  hypothetical protein PHAVU_003G011200g           67.8    2e-11   Phaseolus vulgaris [French bean]
gb|KJB16148.1|  hypothetical protein B456_002G214600                  67.0    4e-11   Gossypium raimondii
ref|XP_010255052.1|  PREDICTED: uncharacterized protein LOC104595834  67.0    5e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010429672.1|  PREDICTED: uncharacterized protein LOC104714114  66.6    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010526008.1|  PREDICTED: uncharacterized protein LOC104803691  65.9    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_006295237.1|  hypothetical protein CARUB_v10024324mg           65.5    1e-10   Capsella rubella
ref|XP_009117004.1|  PREDICTED: uncharacterized protein LOC103842140  65.5    1e-10   Brassica rapa
ref|NP_565623.1|  putative cytochrome b6f complex subunit             65.5    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006605296.1|  PREDICTED: uncharacterized protein LOC100306...  65.5    2e-10   
gb|ABK96760.1|  unknown                                               63.9    2e-10   Populus trichocarpa x Populus deltoides
emb|CDX76703.1|  BnaC08g32890D                                        65.5    2e-10   
ref|XP_002284054.1|  PREDICTED: uncharacterized protein LOC100264352  64.7    2e-10   Vitis vinifera
ref|NP_001051378.1|  Os03g0765900                                     64.3    3e-10   
ref|XP_007136647.1|  hypothetical protein PHAVU_009G061900g           64.7    4e-10   Phaseolus vulgaris [French bean]
ref|XP_011005667.1|  PREDICTED: uncharacterized protein LOC105111889  63.9    5e-10   Populus euphratica
gb|KJB32829.1|  hypothetical protein B456_005G264100                  63.9    5e-10   Gossypium raimondii
ref|XP_008236684.1|  PREDICTED: uncharacterized protein LOC103335458  63.9    6e-10   Prunus mume [ume]
ref|NP_001235647.1|  uncharacterized protein LOC100306224 precursor   63.5    8e-10   
ref|XP_002878972.1|  hypothetical protein ARALYDRAFT_901414           64.3    9e-10   
ref|XP_006384479.1|  cytochrome b6f complex subuni family protein     63.2    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008673960.1|  PREDICTED: plastoquinol-plastocyanin reducta...  63.2    1e-09   
gb|AFK43888.1|  unknown                                               63.2    1e-09   Lotus japonicus
ref|NP_001147411.1|  plastoquinol-plastocyanin reductase              62.8    1e-09   
ref|XP_010417443.1|  PREDICTED: uncharacterized protein LOC104703179  62.8    2e-09   Camelina sativa [gold-of-pleasure]
emb|CAA06667.1|  cytochrome b6f complex subunit                       62.0    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007017399.1|  Cytochrome b6-f complex subunit 7, putative      62.0    2e-09   
ref|NP_001236221.1|  uncharacterized protein LOC100306520             61.6    3e-09   Glycine max [soybeans]
ref|XP_002466396.1|  hypothetical protein SORBIDRAFT_01g007050        60.8    5e-09   Sorghum bicolor [broomcorn]
ref|XP_004981644.1|  PREDICTED: uncharacterized protein LOC101782522  60.8    6e-09   Setaria italica
ref|XP_010472678.1|  PREDICTED: uncharacterized protein LOC104752277  60.8    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006650646.1|  PREDICTED: uncharacterized protein LOC102711...  60.5    7e-09   Oryza brachyantha
ref|NP_001150160.1|  plastoquinol-plastocyanin reductase              59.7    1e-08   Zea mays [maize]
gb|ACN31713.1|  unknown                                               59.7    1e-08   Zea mays [maize]
ref|XP_009342415.1|  PREDICTED: cytochrome b6-f complex subunit 7...  59.7    2e-08   Pyrus x bretschneideri [bai li]
gb|EMT14091.1|  putative Cytochrome b6-f complex subunit 7            58.5    4e-08   
gb|EMS56248.1|  Cytochrome b6-f complex subunit 7                     58.5    4e-08   Triticum urartu
ref|XP_004498178.1|  PREDICTED: uncharacterized protein LOC101488973  58.2    5e-08   
ref|XP_003558921.1|  PREDICTED: uncharacterized protein LOC100835051  57.8    6e-08   Brachypodium distachyon [annual false brome]
ref|XP_002301208.2|  hypothetical protein POPTR_0002s13150g           57.8    7e-08   
gb|ACJ85873.1|  unknown                                               57.4    9e-08   Medicago truncatula
dbj|BAJ89624.1|  predicted protein                                    57.4    9e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006856228.1|  hypothetical protein AMTR_s00059p00208110        57.4    1e-07   Amborella trichopoda
ref|XP_008368152.1|  PREDICTED: cytochrome b6-f complex subunit 7...  57.4    1e-07   
gb|KHN14862.1|  Cytochrome b6-f complex subunit 7                     57.0    1e-07   Glycine soja [wild soybean]
ref|XP_006375019.1|  hypothetical protein POPTR_0014s03630g           56.6    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008362118.1|  PREDICTED: cytochrome b6-f complex subunit 7...  55.1    7e-07   
ref|NP_001077964.1|  putative cytochrome b6f complex subunit          53.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ABK21445.1|  unknown                                               50.8    2e-05   Picea sitchensis
gb|KJB63775.1|  hypothetical protein B456_010G015700                  48.9    1e-04   Gossypium raimondii
gb|ACN30559.1|  unknown                                               50.1    2e-04   Zea mays [maize]
gb|AGT16487.1|  plastoquinol-plastocyanin reductase                   47.0    3e-04   Saccharum hybrid cultivar R570



>emb|CAN82364.1| hypothetical protein VITISV_027615 [Vitis vinifera]
Length=126

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = -2

Query  376  AKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKG  203
            A   R SQRR T V +I GLNSF+GLKA+N VA+LG+PVC + SFAKIV SL+   +GKG
Sbjct  19   AGLGRTSQRRKTNVHFIGGLNSFDGLKAYNSVASLGLPVCTEQSFAKIVXSLKSXSQGKG  78

Query  202  NGGGALSASCN  170
             GGGALS++CN
Sbjct  79   RGGGALSSTCN  89



>ref|XP_010647885.1| PREDICTED: uncharacterized protein LOC104877276 [Vitis vinifera]
Length=126

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = -2

Query  376  AKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKG  203
            A   R SQRR T V +I GLNSF+GLKA+N VA+LG+PVC + SFAKIV SL+   +GKG
Sbjct  19   AGLGRTSQRRKTNVHFIGGLNSFDGLKAYNSVASLGLPVCTEQSFAKIVGSLKSPSQGKG  78

Query  202  NGGGALSASCN  170
             GGGALS++CN
Sbjct  79   RGGGALSSTCN  89



>ref|XP_007041356.1| Cytochrome P450 82C4, putative isoform 2 [Theobroma cacao]
 gb|EOX97187.1| Cytochrome P450 82C4, putative isoform 2 [Theobroma cacao]
Length=121

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSAS  176
            +R S  V+YI GLN+F GLKAHN+V +LG+PVC + SFAK+VSSLR   KG GGGALS++
Sbjct  23   RRTSVNVKYISGLNAFGGLKAHNNVVSLGLPVCTEQSFAKVVSSLRAPSKGKGGGALSST  82

Query  175  CN  170
            CN
Sbjct  83   CN  84



>ref|XP_004230836.1| PREDICTED: uncharacterized protein LOC101256427 [Solanum lycopersicum]
Length=123

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -2

Query  370  TNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGG  191
            T R S ++ TKV+YI GLNSFEGLKA+NHVA+LG+P+  + SFAKIVSSL+       GG
Sbjct  20   TGRSSSQKVTKVKYISGLNSFEGLKANNHVASLGLPMSTEQSFAKIVSSLKTPSSQAKGG  79

Query  190  ALSASCN  170
            ALS++CN
Sbjct  80   ALSSTCN  86



>ref|XP_011092749.1| PREDICTED: uncharacterized protein LOC105172858 [Sesamum indicum]
Length=121

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 1/65 (2%)
 Frame = -2

Query  364  RFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGAL  185
            R  QRR+T V+Y+ GLNSF+GLKAHN+VA+LG+PVC + SFA IVSSL+   +G  GGAL
Sbjct  22   RSPQRRTT-VKYVNGLNSFDGLKAHNNVASLGLPVCTEQSFANIVSSLKQPSQGRSGGAL  80

Query  184  SASCN  170
            +++CN
Sbjct  81   TSTCN  85



>ref|XP_004168718.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101210164 
[Cucumis sativus]
Length=124

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = -2

Query  388  MVVAAKTNRFSQR-RSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--  218
            M  AA  +  S+R R T   +I GLNSF GLKAHN+V +LG+PVCAD SFAKIVSSL+  
Sbjct  12   MSSAAPISAGSRRQRQTNAHFISGLNSFSGLKAHNNVVSLGLPVCADQSFAKIVSSLKYP  71

Query  217  PRGKGNGGGALSASCN  170
             +G+G GGGALS++CN
Sbjct  72   SKGRGKGGGALSSTCN  87



>ref|XP_010999653.1| PREDICTED: uncharacterized protein LOC105107426 [Populus euphratica]
 ref|XP_010999661.1| PREDICTED: uncharacterized protein LOC105107426 [Populus euphratica]
 ref|XP_010999666.1| PREDICTED: uncharacterized protein LOC105107426 [Populus euphratica]
 ref|XP_010999673.1| PREDICTED: uncharacterized protein LOC105107426 [Populus euphratica]
 ref|XP_011015488.1| PREDICTED: uncharacterized protein LOC105119089 [Populus euphratica]
 ref|XP_011015489.1| PREDICTED: uncharacterized protein LOC105119089 [Populus euphratica]
 ref|XP_011015490.1| PREDICTED: uncharacterized protein LOC105119089 [Populus euphratica]
 ref|XP_011015491.1| PREDICTED: uncharacterized protein LOC105119089 [Populus euphratica]
 ref|XP_011015492.1| PREDICTED: uncharacterized protein LOC105119090 [Populus euphratica]
 ref|XP_011015493.1| PREDICTED: uncharacterized protein LOC105119090 [Populus euphratica]
 ref|XP_011015494.1| PREDICTED: uncharacterized protein LOC105119090 [Populus euphratica]
 ref|XP_011015495.1| PREDICTED: uncharacterized protein LOC105119090 [Populus euphratica]
Length=122

 Score = 88.2 bits (217),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 2/73 (3%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP--RG  209
            +AA T    +R+  KV YI GL+SF GLKAHN+V++LG+PVCA+ SFAK+VSSLR   +G
Sbjct  13   LAAATVSSPERKQIKVNYIMGLDSFGGLKAHNNVSSLGLPVCAEQSFAKVVSSLRAPSKG  72

Query  208  KGNGGGALSASCN  170
            KG  GGALS++C+
Sbjct  73   KGRSGGALSSTCS  85



>ref|XP_006346502.1| PREDICTED: uncharacterized protein LOC102594981 [Solanum tuberosum]
Length=123

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 55/68 (81%), Gaps = 2/68 (3%)
 Frame = -2

Query  370  TNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR-PRGKGNGG  194
            T R S ++ TKV+YI GLNSFEGLKA+NHVA+LG+P+  + +FAKIVSSL+ P  + N G
Sbjct  20   TGRNSSQKGTKVKYISGLNSFEGLKANNHVASLGLPMSTEQAFAKIVSSLKTPSSQAN-G  78

Query  193  GALSASCN  170
            GALS++CN
Sbjct  79   GALSSTCN  86



>ref|XP_011088318.1| PREDICTED: uncharacterized protein LOC105169591 [Sesamum indicum]
Length=118

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = -2

Query  367  NRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGA  188
            +R SQRR T+V+YI GLNSF GLKAHN+VA+LG+PVC + SFAKIVSSL+   +   GGA
Sbjct  18   SRSSQRR-TRVKYISGLNSFGGLKAHNNVASLGLPVCTEQSFAKIVSSLKKPSQDRRGGA  76

Query  187  LSASCN  170
            L+++CN
Sbjct  77   LTSTCN  82



>ref|XP_006356593.1| PREDICTED: uncharacterized protein LOC102600718 [Solanum tuberosum]
Length=124

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = -2

Query  370  TNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNG-G  194
            TN+ SQ+R  KV+YI GLNSFEGLKAHN+VA+LG+P+  + SFA IVSSLR      G G
Sbjct  21   TNKSSQKR-IKVKYISGLNSFEGLKAHNNVASLGLPLSTEQSFANIVSSLRTTSSSQGKG  79

Query  193  GALSASCN  170
            GALS++CN
Sbjct  80   GALSSTCN  87



>ref|XP_010263800.1| PREDICTED: uncharacterized protein LOC104601975 [Nelumbo nucifera]
Length=128

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = -2

Query  382  VAAKTNRFS-QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PR  212
            + + +NR S Q++   V YIRGLNSF GLKAHN VAALG+  C + SFAK+VSSLR   +
Sbjct  18   IVSSSNRISTQKKRNNVVYIRGLNSFGGLKAHNSVAALGLTECTEQSFAKVVSSLRSTSK  77

Query  211  GKGNGGGALSASCN  170
             KG GGGALS++CN
Sbjct  78   SKGRGGGALSSTCN  91



>ref|XP_006379220.1| hypothetical protein POPTR_0009s11190g [Populus trichocarpa]
 gb|ERP57017.1| hypothetical protein POPTR_0009s11190g [Populus trichocarpa]
Length=122

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP--RG  209
            +AA T    +R+  KV YI GL+SF GLKAHN+V++LG+PVC + SFAK+VSSLR   +G
Sbjct  13   LAAATVSSPERKQIKVNYITGLDSFGGLKAHNNVSSLGLPVCTEQSFAKVVSSLRAPSKG  72

Query  208  KGNGGGALSASCN  170
            KG  GGALS++C+
Sbjct  73   KGRSGGALSSTCS  85



>gb|KCW55289.1| hypothetical protein EUGRSUZ_I01216, partial [Eucalyptus grandis]
Length=106

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASC  173
            +R+  + YI G+N+F GLKAHN VA+LGVPVC + SFA +V SLR +GKG GGG LS+ C
Sbjct  24   KRTNNLNYITGMNAFGGLKAHNRVASLGVPVCTEQSFANMVGSLRSQGKGRGGGTLSSKC  83

Query  172  N  170
            N
Sbjct  84   N  84



>ref|XP_010028534.1| PREDICTED: uncharacterized protein LOC104418790 [Eucalyptus grandis]
Length=121

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASC  173
            +R+  + YI G+N+F GLKAHN VA+LGVPVC + SFA +V SLR +GKG GGG LS+ C
Sbjct  24   KRTNNLNYITGMNAFGGLKAHNRVASLGVPVCTEQSFANMVGSLRSQGKGRGGGTLSSKC  83

Query  172  N  170
            N
Sbjct  84   N  84



>ref|XP_007041355.1| Cytochrome P450 82C4, putative isoform 1 [Theobroma cacao]
 gb|EOX97186.1| Cytochrome P450 82C4, putative isoform 1 [Theobroma cacao]
Length=599

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSAS  176
            +R S  V+YI GLN+F GLKAHN+V +LG+PVC + SFAK+VSSLR   KG GGGALS++
Sbjct  23   RRTSVNVKYISGLNAFGGLKAHNNVVSLGLPVCTEQSFAKVVSSLRAPSKGKGGGALSST  82

Query  175  CN  170
            CN
Sbjct  83   CN  84



>ref|XP_010028532.1| PREDICTED: uncharacterized protein LOC104418787 [Eucalyptus grandis]
Length=123

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASC  173
            +R+  + YI G+N+F GLKAHN VA+LGVPVC + SFA +V SLR +GKG GGG LS+ C
Sbjct  26   KRTNNLNYITGMNAFGGLKAHNRVASLGVPVCTEQSFANMVGSLRSQGKGRGGGTLSSKC  85

Query  172  N  170
            N
Sbjct  86   N  86



>ref|XP_010066069.1| PREDICTED: uncharacterized protein LOC104453242 [Eucalyptus grandis]
 gb|KCW63849.1| hypothetical protein EUGRSUZ_G01518 [Eucalyptus grandis]
Length=121

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = -2

Query  385  VVAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGK  206
            V  A +    ++R ++V YI GLNSF GLKAHN VA+LGV VCAD SFAKIVSSLR  GK
Sbjct  11   VTLAASAAVPRQRKSRVNYIAGLNSFGGLKAHNGVASLGVAVCADQSFAKIVSSLRSPGK  70

Query  205  G--NGGGALSASCN  170
                GGGALS++C+
Sbjct  71   SRRGGGGALSSTCS  84



>ref|XP_010096265.1| Cytochrome b6-f complex subunit 7 [Morus notabilis]
 gb|EXB63660.1| Cytochrome b6-f complex subunit 7 [Morus notabilis]
Length=121

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = -2

Query  385  VVAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR-PRG  209
            V    T R  +  + KV Y+ G+NSF GLKA+N V +LG+PVC + SFAKIVSSLR P  
Sbjct  11   VTTVATPRTRKVNTRKVHYLTGMNSFAGLKANNSVVSLGLPVCTEQSFAKIVSSLRAPTA  70

Query  208  KGNGGGALSASCN  170
            K  GGGALS+SCN
Sbjct  71   KTGGGGALSSSCN  83



>ref|XP_009770222.1| PREDICTED: uncharacterized protein LOC104220953 [Nicotiana sylvestris]
Length=113

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = -2

Query  370  TNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGG  191
            TN++S  + TK+ YI GLNSF GLKA+N V +LG PVC   SFAKI+SSL+   +G  GG
Sbjct  21   TNKYSSHKRTKLNYISGLNSFRGLKANNSVISLGFPVCTQQSFAKIISSLKTTSQGK-GG  79

Query  190  ALSASCN  170
            ALS++CN
Sbjct  80   ALSSTCN  86



>emb|CDO97118.1| unnamed protein product [Coffea canephora]
Length=125

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 3/69 (4%)
 Frame = -2

Query  370  TNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNG  197
            + R S RR TKV YI GLNSF GLKAHN+V +LG+PV  + SFAKIV SLR   + KG G
Sbjct  21   SGRTSLRR-TKVTYISGLNSFGGLKAHNNVVSLGLPVSTEQSFAKIVGSLRCPSQSKGRG  79

Query  196  GGALSASCN  170
            GGALS++CN
Sbjct  80   GGALSSTCN  88



>ref|XP_004306468.1| PREDICTED: uncharacterized protein LOC101301039 [Fragaria vesca 
subsp. vesca]
Length=125

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNGGGALS  182
            ++ + +V YI GLNSF GLKAHN VA+LG+P C D SFA IVSSLR   + +G GGGALS
Sbjct  24   KKSANRVHYISGLNSFSGLKAHNTVASLGLPQCTDQSFANIVSSLRAPSQNQGRGGGALS  83

Query  181  ASCN  170
            ++CN
Sbjct  84   STCN  87



>ref|XP_004290394.1| PREDICTED: uncharacterized protein LOC101303081 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458373.1| PREDICTED: uncharacterized protein LOC101303081 [Fragaria vesca 
subsp. vesca]
Length=125

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 49/64 (77%), Gaps = 2/64 (3%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP--RGKGNGGGALS  182
            ++ + KV YI GLNSF GLKAHN VA+LG+P C D SFA IVSSLR   + +G GGGALS
Sbjct  24   RKPANKVHYISGLNSFSGLKAHNSVASLGLPQCTDLSFANIVSSLRAPSQNQGRGGGALS  83

Query  181  ASCN  170
            ++CN
Sbjct  84   STCN  87



>ref|XP_004288567.1| PREDICTED: uncharacterized protein LOC101314888 [Fragaria vesca 
subsp. vesca]
Length=125

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP--RGKGNGGGALS  182
            ++ S  V YI G+NSF GLKAHN VA+LG+P C + SFAKIVSSLR   + KG  GGALS
Sbjct  24   RKSSNNVHYISGVNSFSGLKAHNSVASLGLPQCTEQSFAKIVSSLRTPSQNKGRSGGALS  83

Query  181  ASCN  170
            ++CN
Sbjct  84   STCN  87



>ref|XP_009769333.1| PREDICTED: uncharacterized protein LOC104220206 [Nicotiana sylvestris]
Length=121

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  367  NRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGA  188
             R S ++ TKV YI GLNSF GLKA+N+VA+LG+P+C + SFAKIVSSL+   +   GGA
Sbjct  20   TRMSSQKRTKVNYINGLNSFGGLKANNNVASLGLPMCTEQSFAKIVSSLKTPSQAK-GGA  78

Query  187  LSASCN  170
            LS++C+
Sbjct  79   LSSTCS  84



>gb|KDO52154.1| hypothetical protein CISIN_1g033208mg [Citrus sinensis]
Length=125

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNG--GGALS  182
            +RRS KV YI GLNSF GLKA N + +LG+PV  + +FAKIVSS+R  GKG G  GG L+
Sbjct  25   RRRSVKVSYITGLNSFGGLKAQNSLTSLGMPVSTEQAFAKIVSSVRAPGKGEGQSGGVLT  84

Query  181  ASCN  170
            ++CN
Sbjct  85   STCN  88



>ref|XP_006423129.1| hypothetical protein CICLE_v10030439mg [Citrus clementina]
 gb|ESR36369.1| hypothetical protein CICLE_v10030439mg [Citrus clementina]
Length=128

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNG--GGALS  182
            +RRS KV YI GLNSF GLKA N + +LG+PV  + +FAKIVSS+R  GKG G  GG L+
Sbjct  28   RRRSVKVNYITGLNSFGGLKAQNSLTSLGMPVSTEQAFAKIVSSVRAPGKGKGQSGGVLT  87

Query  181  ASCN  170
            ++CN
Sbjct  88   STCN  91



>ref|XP_006423127.1| hypothetical protein CICLE_v10030439mg [Citrus clementina]
 ref|XP_006423128.1| hypothetical protein CICLE_v10030439mg [Citrus clementina]
 ref|XP_006479375.1| PREDICTED: uncharacterized protein LOC102620918 [Citrus sinensis]
 gb|ESR36367.1| hypothetical protein CICLE_v10030439mg [Citrus clementina]
 gb|ESR36368.1| hypothetical protein CICLE_v10030439mg [Citrus clementina]
Length=125

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNG--GGALS  182
            +RRS KV YI GLNSF GLKA N + +LG+PV  + +FAKIVSS+R  GKG G  GG L+
Sbjct  25   RRRSVKVNYITGLNSFGGLKAQNSLTSLGMPVSTEQAFAKIVSSVRAPGKGKGQSGGVLT  84

Query  181  ASCN  170
            ++CN
Sbjct  85   STCN  88



>gb|EYU37732.1| hypothetical protein MIMGU_mgv1a016429mg [Erythranthe guttata]
Length=122

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 2/58 (3%)
 Frame = -2

Query  337  VRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNGGGALSASCN  170
            V YI GLNSF GLKA+N VAALG+PVC DHSFA IVSSL+   + +  GGGAL+++CN
Sbjct  29   VNYINGLNSFGGLKANNSVAALGLPVCTDHSFAMIVSSLKKPSQSRNGGGGALTSTCN  86



>ref|XP_002510294.1| plastoquinol-plastocyanin reductase, putative [Ricinus communis]
 gb|EEF52481.1| plastoquinol-plastocyanin reductase, putative [Ricinus communis]
Length=128

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 47/67 (70%), Gaps = 5/67 (7%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR-----PRGKGNGGG  191
            Q+R  KV YIRGLNSF GLKAHN V +LG+PVC +  FA  VSS++       GKG GGG
Sbjct  25   QKRMDKVVYIRGLNSFGGLKAHNSVVSLGMPVCTEQCFANFVSSIKAAAAASNGKGKGGG  84

Query  190  ALSASCN  170
            ALS+ C+
Sbjct  85   ALSSKCS  91



>ref|NP_001235238.1| uncharacterized protein LOC100500243 [Glycine max]
 ref|XP_006582858.1| PREDICTED: uncharacterized protein LOC100500243 isoform X1 [Glycine 
max]
 gb|ACU15263.1| unknown [Glycine max]
 gb|KHN45317.1| Cytochrome b6-f complex subunit 7 [Glycine soja]
Length=124

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = -2

Query  385  VVAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PR  212
            VVA  +   ++RR   V +IRGLNSF GLKA N V +LG+PVC +  FAK+VSSL+    
Sbjct  14   VVAISSVASTKRRERNVHFIRGLNSFGGLKAQNSVTSLGLPVCTEQCFAKVVSSLKYQSS  73

Query  211  GKGNGGGALSASCN  170
             KG GGGA S++CN
Sbjct  74   SKGRGGGAASSTCN  87



>ref|XP_009613230.1| PREDICTED: uncharacterized protein LOC104106393 [Nicotiana tomentosiformis]
Length=180

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = -2

Query  367  NRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGA  188
             R S ++ TKV YI GLNSF GLKA+N+VA+LG+P+C + SFAKIVSSL+   +   GGA
Sbjct  79   TRMSSQKRTKVNYISGLNSFGGLKANNNVASLGLPMCTEQSFAKIVSSLKTPSQAK-GGA  137

Query  187  LSASCN  170
            LS++C+
Sbjct  138  LSSTCS  143



>gb|AAF34768.1|AF227623_1 unknown [Euphorbia esula]
Length=128

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 3/66 (5%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP---RGKGNGGGA  188
            SQ++ +K+ YIRGLNS+ GLKAHN VA+LG+PV  +  FA ++SSL+     GKG  GGA
Sbjct  25   SQKKESKIVYIRGLNSYGGLKAHNTVASLGMPVSTEQGFANVISSLKTSSSNGKGKSGGA  84

Query  187  LSASCN  170
            L + C+
Sbjct  85   LGSKCS  90



>ref|XP_007201416.1| hypothetical protein PRUPE_ppa013368mg [Prunus persica]
 gb|EMJ02615.1| hypothetical protein PRUPE_ppa013368mg [Prunus persica]
Length=126

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP--RGKGN-GGGAL  185
            +R +  V YI GLNSF GLKAH+ VA+LG+P   + SFAKIVSSLR   +GKG  GGGAL
Sbjct  22   RRAANNVNYITGLNSFSGLKAHSSVASLGLPQGTEQSFAKIVSSLRAPSQGKGRVGGGAL  81

Query  184  SASCN  170
            S++CN
Sbjct  82   SSTCN  86



>ref|XP_010941885.1| PREDICTED: uncharacterized protein LOC105060020 [Elaeis guineensis]
Length=124

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 2/65 (3%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNGGGAL  185
            S R+   V YI GLNSF GLKAHN V+ LG+P C   SFA +VSSL+   RGK   GGAL
Sbjct  23   SMRKKPSVVYIEGLNSFGGLKAHNKVSNLGLPACTAQSFAMVVSSLKSSSRGKKGKGGAL  82

Query  184  SASCN  170
            S++CN
Sbjct  83   SSTCN  87



>gb|KDP38419.1| hypothetical protein JCGZ_04344 [Jatropha curcas]
Length=125

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP-RGKGNGGGALSA  179
            Q++     YIRGLN++ GLKAHN V +LG+PVC +  FA +VSSL+   GKG GGGALS+
Sbjct  25   QKKVNGAVYIRGLNAYGGLKAHNTVVSLGMPVCTEQCFANVVSSLKASNGKGRGGGALSS  84

Query  178  SCN  170
             C+
Sbjct  85   KCS  87



>ref|XP_004248748.1| PREDICTED: uncharacterized protein LOC101250638 [Solanum lycopersicum]
Length=125

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 9/72 (13%)
 Frame = -2

Query  370  TNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIV-----SSLRPRGK  206
            TN+ SQ+R TKV+YI GLNSFEGLKAHN+VA+LG P+  + SFA IV     +S   +GK
Sbjct  21   TNKCSQKR-TKVKYISGLNSFEGLKAHNNVASLGHPLSTEQSFANIVSSLRTTSSSSQGK  79

Query  205  GNGGGALSASCN  170
               GGALS++CN
Sbjct  80   ---GGALSSTCN  88



>ref|XP_009388518.1| PREDICTED: cytochrome b6-f complex subunit 7, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=126

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNG-GGA  188
            S RR   V+Y++G+NSF GLKA+N+V++LG+P C   +FAK++SSLR  P+GK    GGA
Sbjct  23   SMRRKHSVKYMQGMNSFGGLKANNNVSSLGLPACTAAAFAKVLSSLRAPPKGKTKSRGGA  82

Query  187  LSASCN  170
            LS++CN
Sbjct  83   LSSTCN  88



>ref|XP_010684011.1| PREDICTED: uncharacterized protein LOC104898612 [Beta vulgaris 
subsp. vulgaris]
Length=129

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP----RGKGNGGG  191
            +QR+  KV Y+ GLNS+ GLKA+N V  LG PVC +  FA +VSSLR     +G+  GGG
Sbjct  26   AQRKMNKVVYMSGLNSYGGLKANNTVVGLGNPVCTEQCFANVVSSLRSTSSKKGRLGGGG  85

Query  190  ALSASCN  170
            ALS++CN
Sbjct  86   ALSSTCN  92



>ref|XP_008454894.1| PREDICTED: uncharacterized protein LOC103495201 [Cucumis melo]
Length=125

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR---PRGKGNGGGAL  185
            ++R T V YI GLNSF GLKAHN+V +LG+PVCAD SFAKIVSSL+        NGGGAL
Sbjct  24   RQRQTNVHYITGLNSFGGLKAHNNVVSLGLPVCADQSFAKIVSSLKYPSKGKGKNGGGAL  83

Query  184  SASCN  170
            S++CN
Sbjct  84   SSTCN  88



>gb|AFK46863.1| unknown [Lotus japonicus]
Length=132

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = -2

Query  388  MVVAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR---  218
            MV ++     +++R TK  ++RGLNSF GLKA N V ++G+P   +H FAKIVSS++   
Sbjct  17   MVSSSSNTTATKKRMTKAIHVRGLNSFGGLKATNDVISMGLPSSTEHCFAKIVSSVKATS  76

Query  217  -PRGKGNGGGALSASCN  170
               G+G  GGALS++CN
Sbjct  77   SSTGRGKRGGALSSTCN  93



>ref|XP_004137000.1| PREDICTED: uncharacterized protein LOC101210164 isoform 2 [Cucumis 
sativus]
Length=125

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR---PRGKGNGGGAL  185
            ++R T   +I GLNSF GLKAHN+V +LG+PVCAD SFAKIVSSL+        NGGGAL
Sbjct  24   RQRQTNAHFISGLNSFSGLKAHNNVVSLGLPVCADQSFAKIVSSLKYPSKGKGKNGGGAL  83

Query  184  SASCN  170
            S++CN
Sbjct  84   SSTCN  88



>gb|EPS66539.1| hypothetical protein M569_08240 [Genlisea aurea]
Length=124

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 4/68 (6%)
 Frame = -2

Query  370  TNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP-RGKGNGG  194
            + +   +R+ KV Y+   +SF GLKAHNHV +LGVPV  +H+FAKIV +L P + K  GG
Sbjct  22   SRKLLPQRAAKVNYV---SSFGGLKAHNHVVSLGVPVSTEHAFAKIVGALVPSKEKRGGG  78

Query  193  GALSASCN  170
            GALS++CN
Sbjct  79   GALSSTCN  86



>ref|XP_004136999.1| PREDICTED: uncharacterized protein LOC101210164 isoform 1 [Cucumis 
sativus]
Length=169

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 3/65 (5%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR---PRGKGNGGGAL  185
            ++R T   +I GLNSF GLKAHN+V +LG+PVCAD SFAKIVSSL+        NGGGAL
Sbjct  68   RQRQTNAHFISGLNSFSGLKAHNNVVSLGLPVCADQSFAKIVSSLKYPSKGKGKNGGGAL  127

Query  184  SASCN  170
            S++CN
Sbjct  128  SSTCN  132



>gb|KGN43969.1| hypothetical protein Csa_7G075020 [Cucumis sativus]
Length=201

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR-PR--GKGNGGGAL  185
            ++R T   +I GLNSF GLKAHN+V +LG+PVCAD SFAKIVSSL+ P      NGGGAL
Sbjct  100  RQRQTNAHFISGLNSFSGLKAHNNVVSLGLPVCADQSFAKIVSSLKYPSKGKGKNGGGAL  159

Query  184  SASCN  170
            S++CN
Sbjct  160  SSTCN  164



>ref|XP_006398038.1| hypothetical protein EUTSA_v10001257mg [Eutrema salsugineum]
 gb|ESQ39491.1| hypothetical protein EUTSA_v10001257mg [Eutrema salsugineum]
Length=176

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPRGK  206
            +A K+ +  ++   KV YIRGLNS+ GLKA N+ V ++G+P+C D  FA +V SL  +G+
Sbjct  70   IAYKSGQTQRKSEMKVSYIRGLNSYGGLKAQNNKVVSMGLPLCTDQCFANVVMSL--KGR  127

Query  205  GNGGGALSASCN  170
             +GGGA++++CN
Sbjct  128  TSGGGAITSTCN  139



>emb|CBI32504.3| unnamed protein product [Vitis vinifera]
Length=1085

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = -2

Query  376   AKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRG  209
             A   R SQRR T V +I GLNSF+GLKA+N VA+LG+PVC + SFAKIV SL+  G
Sbjct  1026  AGLGRTSQRRKTNVHFIGGLNSFDGLKAYNSVASLGLPVCTEQSFAKIVGSLKYSG  1081



>ref|XP_008813189.1| PREDICTED: uncharacterized protein LOC103723892 [Phoenix dactylifera]
Length=122

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNGGGAL  185
            S R+ + V YI GLNS+ GLKAHN V  LG+P C   SFA +VSSLR   +GK   GGAL
Sbjct  21   SMRKKSSVGYIEGLNSYGGLKAHNKVTNLGLPACTTQSFAMVVSSLRSLSQGKKGKGGAL  80

Query  184  SAS  176
            S++
Sbjct  81   SST  83



>ref|XP_010908023.1| PREDICTED: uncharacterized protein LOC105034521 [Elaeis guineensis]
Length=124

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNGGGALSA  179
            R+ + V YI GLNSF GLKAHN V+ LG+P C   SFA  VS+L+   +GK   GGALS+
Sbjct  25   RKKSSVVYIEGLNSFGGLKAHNKVSNLGLPACTAQSFAMAVSTLKSSSQGKKRKGGALSS  84

Query  178  SCN  170
            +C+
Sbjct  85   TCS  87



>ref|XP_011030865.1| PREDICTED: uncharacterized protein LOC105130182 [Populus euphratica]
Length=163

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR--PRGKGNGGGALSA  179
            +R++KV Y+ G+NS+ GLKAHN V +L +PV  +  FAK++SSLR    GKG  GGALS+
Sbjct  64   KRTSKVVYLGGMNSYGGLKAHNSVLSLNMPVSTEQCFAKVISSLRAASNGKGGDGGALSS  123

Query  178  SC  173
             C
Sbjct  124  KC  125



>ref|NP_001236249.1| uncharacterized protein LOC100500315 [Glycine max]
 gb|ACU15354.1| unknown [Glycine max]
 gb|KHN22288.1| Cytochrome b6-f complex subunit 7 [Glycine soja]
Length=122

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = -2

Query  340  KVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP---RGKGNGGGALSASCN  170
            +V ++RGLNSF GLKA N V +LG+P+  +  FAK+VSS++     GKG GGGALS++CN
Sbjct  24   RVVHVRGLNSFGGLKASNGVVSLGLPMSTEKCFAKVVSSVKAATSNGKGKGGGALSSTCN  83



>ref|XP_007153152.1| hypothetical protein PHAVU_003G011200g [Phaseolus vulgaris]
 gb|ESW25146.1| hypothetical protein PHAVU_003G011200g [Phaseolus vulgaris]
Length=122

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -2

Query  331  YIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASCN  170
            +IRG+N F GLKA N V +LG+PVC +  FAK+VSSL+   KG  GGA S++CN
Sbjct  32   FIRGVNHFGGLKAQNSVTSLGLPVCTEQCFAKVVSSLKYPSKGRRGGAASSTCN  85



>gb|KJB16148.1| hypothetical protein B456_002G214600 [Gossypium raimondii]
Length=124

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 4/65 (6%)
 Frame = -2

Query  352  RRSTKVR--YIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP--RGKGNGGGAL  185
            RR TKV   YI GLNSF GLKAHN+V +LG PVC + SFAK+VSSLR   +GKG+GGGAL
Sbjct  23   RRRTKVNVNYITGLNSFGGLKAHNNVVSLGQPVCIEQSFAKVVSSLRAPSKGKGSGGGAL  82

Query  184  SASCN  170
            S++CN
Sbjct  83   SSTCN  87



>ref|XP_010255052.1| PREDICTED: uncharacterized protein LOC104595834 [Nelumbo nucifera]
Length=126

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIV  230
            +Q+R + V YI GLNSF GLKAHN VAALG+PVC + SFAKIV
Sbjct  25   TQKRKSNVVYIGGLNSFGGLKAHNSVAALGLPVCTEQSFAKIV  67



>ref|XP_010429672.1| PREDICTED: uncharacterized protein LOC104714114 [Camelina sativa]
Length=127

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 50/72 (69%), Gaps = 3/72 (4%)
 Frame = -2

Query  382  VAAKTNRFSQRRST-KVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGK  206
            + +K+ +  Q+++  KV Y+ GLNS+ GLKA N V ++G P+C +  FA +V SL+ R +
Sbjct  18   IVSKSGQTQQKKTEMKVSYVTGLNSYGGLKAQNKVVSMGSPLCTEQCFANVVMSLKGR-R  76

Query  205  GNGGGALSASCN  170
            G+ GGALS +CN
Sbjct  77   GS-GGALSTTCN  87



>ref|XP_010526008.1| PREDICTED: uncharacterized protein LOC104803691 [Tarenaya hassleriana]
 ref|XP_010526009.1| PREDICTED: uncharacterized protein LOC104803691 [Tarenaya hassleriana]
Length=122

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 5/73 (7%)
 Frame = -2

Query  379  AAKTNRFSQRR---STKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRG  209
            AA  N F+Q +     K+ YIRG+NS+ GLKA N   ++G+P+  +  FA +V++L+ R 
Sbjct  15   AAMVNTFTQTKKKTDMKISYIRGINSYGGLKAQNKAVSMGMPMSTEQCFANVVTALKGRR  74

Query  208  KGNGGGALSASCN  170
             GN  G+LS++CN
Sbjct  75   GGN--GSLSSTCN  85



>ref|XP_006295237.1| hypothetical protein CARUB_v10024324mg [Capsella rubella]
 gb|EOA28135.1| hypothetical protein CARUB_v10024324mg [Capsella rubella]
Length=125

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPRGK  206
            + +K+ +  ++   KV YI GLNS+ GLKA N+ V ++G P+C +  FA +V SL+ R +
Sbjct  17   IVSKSGQTQKKTEMKVSYITGLNSYGGLKAQNNKVVSMGSPLCTEQCFANVVMSLKGR-R  75

Query  205  GNGGGALSASCN  170
            GN GGALS +CN
Sbjct  76   GN-GGALSTTCN  86



>ref|XP_009117004.1| PREDICTED: uncharacterized protein LOC103842140 [Brassica rapa]
 emb|CDY11479.1| BnaA09g40450D [Brassica napus]
Length=123

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = -2

Query  379  AAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPRGKG  203
            A K+ +   +   KV Y+RGLNS+ GLKA N+ V ++G+PVC +  FA +V SL  +G+ 
Sbjct  18   AFKSGQAQMKSEMKVSYVRGLNSYGGLKAQNNKVVSMGLPVCTEQCFANVVMSL--KGRT  75

Query  202  NGGGALSASCN  170
            + GGAL+++CN
Sbjct  76   SRGGALTSTCN  86



>ref|NP_565623.1| putative cytochrome b6f complex subunit [Arabidopsis thaliana]
 ref|NP_850079.1| putative cytochrome b6f complex subunit [Arabidopsis thaliana]
 gb|AAK53043.1|AF375459_1 At2g26500 [Arabidopsis thaliana]
 gb|AAL31172.1| At2g26500/T9J22.17 [Arabidopsis thaliana]
 gb|AAM14841.1| expressed protein [Arabidopsis thaliana]
 gb|AAM67055.1| unknown [Arabidopsis thaliana]
 gb|AEC07845.1| putative cytochrome b6f complex subunit [Arabidopsis thaliana]
 gb|AEC07846.1| putative cytochrome b6f complex subunit [Arabidopsis thaliana]
Length=125

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPRGK  206
            + +K+ +  ++   KV YI GLNS+ GLKA N+ V ++G P+C +  FA +V SL+ R +
Sbjct  17   IVSKSGQTQKKSEMKVSYITGLNSYGGLKAQNNKVVSMGSPLCTEQCFANVVMSLKGR-R  75

Query  205  GNGGGALSASCN  170
            GN GGALS +CN
Sbjct  76   GN-GGALSTTCN  86



>ref|XP_006605296.1| PREDICTED: uncharacterized protein LOC100306224 isoform X1 [Glycine 
max]
 gb|KHM99011.1| Cytochrome b6-f complex subunit 7 [Glycine soja]
Length=127

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 6/79 (8%)
 Frame = -2

Query  388  MVVAAKTNRFSQRRSTK--VRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP  215
            + V A +     RRS K  V +IRGLNSF GLKA N+V  LG+PVC +  FAK+VSSL+ 
Sbjct  12   ITVVAASPSVGSRRSGKRNVNFIRGLNSFGGLKAQNNVTLLGLPVCTEQCFAKVVSSLKY  71

Query  214  RG----KGNGGGALSASCN  170
                  KG GGGA  ++CN
Sbjct  72   PSSSSRKGRGGGAAFSTCN  90



>gb|ABK96760.1| unknown [Populus trichocarpa x Populus deltoides]
Length=69

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            +R+ T V YI GLNSF GLKAHN V++LG+ V  + SFAKIVSSLR
Sbjct  22   KRKQTNVNYITGLNSFGGLKAHNSVSSLGLSVGTEQSFAKIVSSLR  67



>emb|CDX76703.1| BnaC08g32890D [Brassica napus]
Length=123

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = -2

Query  373  KTNRFSQRRSTKVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPRGKGNG  197
            K+ +   +   KV Y+RGLNS+ GLKA N+ V ++G+PVC +  FA +V SL  +G+ + 
Sbjct  20   KSGQAQMKSEMKVSYVRGLNSYGGLKAQNNKVVSMGLPVCTEQCFANVVMSL--KGRTSR  77

Query  196  GGALSASCN  170
            GGAL+++CN
Sbjct  78   GGALTSTCN  86



>ref|XP_002284054.1| PREDICTED: uncharacterized protein LOC100264352 [Vitis vinifera]
 ref|XP_010664621.1| PREDICTED: uncharacterized protein LOC100264352 [Vitis vinifera]
 emb|CBI19592.3| unnamed protein product [Vitis vinifera]
Length=122

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSA  179
            +Q+   KV Y+ GLNSF GLKAHN V A+GVP+C +  FA +VSSL+ +    GGGALS+
Sbjct  24   TQKGEKKVVYVAGLNSFGGLKAHNSVVAMGVPMCTEQCFANVVSSLKAK-GRGGGGALSS  82

Query  178  SCN  170
            +C+
Sbjct  83   TCS  85



>ref|NP_001051378.1| Os03g0765900 [Oryza sativa Japonica Group]
 gb|AAP50955.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99049.1| cytochrome b6f complex subunit, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13292.1| Os03g0765900 [Oryza sativa Japonica Group]
 gb|EAY91971.1| hypothetical protein OsI_13659 [Oryza sativa Indica Group]
 gb|EAZ28695.1| hypothetical protein OsJ_12709 [Oryza sativa Japonica Group]
Length=118

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSA  179
            + R+ + V Y+ G+N++ GLKA N V  LGV   AD+SFAK+V+ L P G  + GGA  A
Sbjct  19   AARKRSGVTYVEGMNAYSGLKALNKVTLLGVRKTADYSFAKVVAKLSPAGGKSRGGAFGA  78

Query  178  SCN  170
             CN
Sbjct  79   QCN  81



>ref|XP_007136647.1| hypothetical protein PHAVU_009G061900g [Phaseolus vulgaris]
 gb|ESW08641.1| hypothetical protein PHAVU_009G061900g [Phaseolus vulgaris]
Length=129

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 3/57 (5%)
 Frame = -2

Query  331  YIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP---RGKGNGGGALSASCN  170
            ++RGLNSF GLKA N V ALG+P+  +  FAKIVSS++     GKG  GGALS++CN
Sbjct  34   HVRGLNSFGGLKASNGVVALGLPLSTEKCFAKIVSSVKATASNGKGKRGGALSSTCN  90



>ref|XP_011005667.1| PREDICTED: uncharacterized protein LOC105111889 [Populus euphratica]
 ref|XP_011005668.1| PREDICTED: uncharacterized protein LOC105111889 [Populus euphratica]
Length=122

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            +R+ T V YI GLNSF GLKAHN V++LG+ V  + SFAKIVSSLR
Sbjct  22   KRKQTNVNYITGLNSFGGLKAHNSVSSLGLSVGTEQSFAKIVSSLR  67



>gb|KJB32829.1| hypothetical protein B456_005G264100 [Gossypium raimondii]
Length=124

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 5/77 (6%)
 Frame = -2

Query  388  MVVAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP--  215
            M+ AA TN   ++ +T V YI GLNSF GLKAHN V +LG  VC + SFA +VSSL+   
Sbjct  12   MLAAATTNP-KKKTNTNVNYITGLNSFGGLKAHNKVVSLGQRVCTEQSFANVVSSLKAPT  70

Query  214  --RGKGNGGGALSASCN  170
              +   +GGGALS++CN
Sbjct  71   KGKTGKSGGGALSSTCN  87



>ref|XP_008236684.1| PREDICTED: uncharacterized protein LOC103335458 [Prunus mume]
 ref|XP_008236687.1| PREDICTED: uncharacterized protein LOC103335458 [Prunus mume]
Length=126

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 3/65 (5%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGK---GNGGGAL  185
            +R +  V YI GLNSF GLKAH+ VA+LG+P   + SFAKIVSSLR   +     GGGAL
Sbjct  22   RRATNNVNYITGLNSFSGLKAHSSVASLGLPQGTEQSFAKIVSSLRAPSQGKGRGGGGAL  81

Query  184  SASCN  170
            S++CN
Sbjct  82   SSTCN  86



>ref|NP_001235647.1| uncharacterized protein LOC100306224 precursor [Glycine max]
 gb|ACU14307.1| unknown [Glycine max]
Length=127

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 6/79 (8%)
 Frame = -2

Query  388  MVVAAKTNRFSQRRSTK--VRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP  215
            + V A +     RRS K  V + RGLNSF GLKA N+V  LG+PVC +  FAK+VSSL+ 
Sbjct  12   ITVVAASPSVGSRRSGKRNVNFTRGLNSFGGLKAQNNVTLLGLPVCTEQCFAKVVSSLKY  71

Query  214  RG----KGNGGGALSASCN  170
                  KG GGGA  ++CN
Sbjct  72   PSSSSRKGRGGGAAFSTCN  90



>ref|XP_002878972.1| hypothetical protein ARALYDRAFT_901414 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55231.1| hypothetical protein ARALYDRAFT_901414 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 3/72 (4%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPRGK  206
            + +K+ +  ++   KV YI GLNS+ GLKA N+ V ++G P+C +  FA +V SL+ R +
Sbjct  82   IVSKSGQTQKKTEMKVSYITGLNSYGGLKAQNNKVVSMGSPLCTEQCFANVVVSLKGR-R  140

Query  205  GNGGGALSASCN  170
            GN GGALS +CN
Sbjct  141  GN-GGALSTTCN  151



>ref|XP_006384479.1| cytochrome b6f complex subuni family protein [Populus trichocarpa]
 gb|ABK95140.1| unknown [Populus trichocarpa]
 gb|ERP62276.1| cytochrome b6f complex subuni family protein [Populus trichocarpa]
Length=122

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            +R+ T V YI GLNSF GLKAHN V++LG+ V ++ SFAKIVSSL+
Sbjct  22   KRKQTNVNYITGLNSFGGLKAHNSVSSLGLSVGSEQSFAKIVSSLK  67



>ref|XP_008673960.1| PREDICTED: plastoquinol-plastocyanin reductase isoform X1 [Zea 
mays]
 tpg|DAA51597.1| TPA: plastoquinol-plastocyanin reductase [Zea mays]
Length=117

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSA  179
            +++RS  V Y+ G+N++ GLK  N V  LGV   AD+SFAK+V+SL P G+   GGA  A
Sbjct  18   AKKRSGGVTYVEGMNAYSGLKGLNKVNMLGVRKTADYSFAKVVASLSPAGRKRRGGAFGA  77

Query  178  SCN  170
              N
Sbjct  78   QMN  80



>gb|AFK43888.1| unknown [Lotus japonicus]
Length=132

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 4/58 (7%)
 Frame = -2

Query  331  YIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP----RGKGNGGGALSASCN  170
            ++RGLNSF GLKA N V ++G+P   +H FAKIVSS++      G+G  GGALS++CN
Sbjct  36   HVRGLNSFGGLKATNDVISMGLPSSTEHCFAKIVSSVKATSSSTGRGKRGGALSSTCN  93



>ref|NP_001147411.1| plastoquinol-plastocyanin reductase [Zea mays]
 gb|ACG27420.1| plastoquinol-plastocyanin reductase [Zea mays]
 gb|ACG30483.1| plastoquinol-plastocyanin reductase [Zea mays]
Length=117

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSA  179
            +++RS  V Y+ G+N++ GLK  N V  LGV   AD+SFAK+V+SL P G+   GGA  A
Sbjct  18   AKKRSGGVTYVEGMNAYSGLKGLNKVNMLGVRKTADYSFAKVVASLSPAGRKRRGGAFGA  77

Query  178  SCN  170
              N
Sbjct  78   QMN  80



>ref|XP_010417443.1| PREDICTED: uncharacterized protein LOC104703179 [Camelina sativa]
Length=128

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 5/74 (7%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNH---VAALGVPVCADHSFAKIVSSLRPR  212
            + +K+ +  ++   KV Y+ GLNS+ GLKA N+   V ++G P+C    FA +V SL  +
Sbjct  18   IVSKSGQTQKKTEMKVSYVTGLNSYGGLKAQNNNNKVVSMGSPLCTQQCFANVVMSL--K  75

Query  211  GKGNGGGALSASCN  170
            GK   GGALS +CN
Sbjct  76   GKRGSGGALSTTCN  89



>emb|CAA06667.1| cytochrome b6f complex subunit [Arabidopsis thaliana]
Length=96

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = -2

Query  340  KVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASCN  170
            KV YI GLNS+ GLKA N+ V ++G P+C +  FA +V SL+ R +GN GGALS +CN
Sbjct  2    KVSYITGLNSYGGLKAQNNKVVSMGSPLCTEQCFANVVMSLKGR-RGN-GGALSTTCN  57



>ref|XP_007017399.1| Cytochrome b6-f complex subunit 7, putative [Theobroma cacao]
 gb|EOY14624.1| Cytochrome b6-f complex subunit 7, putative [Theobroma cacao]
Length=129

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = -2

Query  385  VVAAKTNRFSQRRSTKVRYIRGLNSFEGLKAH--NHVAALGVPVCADHSFAKIVSSL-RP  215
            VV   +N+ +++ + KV YI G++S+ GLKAH  N+V +LG+P C +  FA ++SSL + 
Sbjct  17   VVRCGSNK-TKQTTPKVVYIGGMSSYGGLKAHSNNNVVSLGLPRCTEQCFANVISSLKKA  75

Query  214  RGKG-NGGGALSASCN  170
             G+G  GGGALS++CN
Sbjct  76   HGEGRTGGGALSSTCN  91



>ref|NP_001236221.1| uncharacterized protein LOC100306520 [Glycine max]
 gb|ACU14729.1| unknown [Glycine max]
 gb|KHN04531.1| Cytochrome b6-f complex subunit 7 [Glycine soja]
Length=124

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP---RGKGNGGGAL  185
             +   +V ++RG+NSF GLKA N V +LG+P+  +  FAK+VSS++     GKG  GGAL
Sbjct  22   SKTKKRVVHVRGINSFGGLKASNGVVSLGIPMSTEKCFAKVVSSVKAATSNGKGK-GGAL  80

Query  184  SASCN  170
            S++CN
Sbjct  81   SSTCN  85



>ref|XP_002466396.1| hypothetical protein SORBIDRAFT_01g007050 [Sorghum bicolor]
 gb|EER93394.1| hypothetical protein SORBIDRAFT_01g007050 [Sorghum bicolor]
Length=118

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSAS  176
            +R S  V Y+ G+N++ GLK  N V  LGV   AD+SFAKIV+SL P GK   G A  A 
Sbjct  20   KRSSGGVTYVEGMNAYSGLKGLNKVNMLGVRKTADYSFAKIVASLSPAGKNRRGSAFGAQ  79

Query  175  CN  170
             N
Sbjct  80   MN  81



>ref|XP_004981644.1| PREDICTED: uncharacterized protein LOC101782522 [Setaria italica]
Length=117

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 0/62 (0%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSAS  176
            +R S  V Y+ G+N++ GLK  N V  LG+   AD+SFAKIV+SL P GK   G A  A 
Sbjct  19   KRSSGGVTYVEGMNAYSGLKGLNKVTMLGMRKTADYSFAKIVASLSPAGKTRRGSAFGAQ  78

Query  175  CN  170
             N
Sbjct  79   MN  80



>ref|XP_010472678.1| PREDICTED: uncharacterized protein LOC104752277 [Camelina sativa]
Length=129

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 7/68 (10%)
 Frame = -2

Query  358  SQRRST--KVRYIRGLNSFEGLKAHNH---VAALGVPVCADHSFAKIVSSLRPRGKGNGG  194
            +Q++ T  KV YI GLNS+ GLKA N+   V ++G P+C +  FA +V SL+ R +G+ G
Sbjct  25   TQKKKTEMKVSYITGLNSYGGLKAQNNNNKVVSMGSPLCTEQCFANVVMSLKGR-RGS-G  82

Query  193  GALSASCN  170
            GALS +CN
Sbjct  83   GALSTTCN  90



>ref|XP_006650646.1| PREDICTED: uncharacterized protein LOC102711791 isoform X1 [Oryza 
brachyantha]
 ref|XP_006650647.1| PREDICTED: uncharacterized protein LOC102711791 isoform X2 [Oryza 
brachyantha]
Length=117

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSA  179
            + R+   V Y+ G+N++ GLKA N V  LGV   AD+SFA++V+ L P G  + GG+  A
Sbjct  18   AARKRGGVTYVEGMNAYSGLKALNKVTLLGVRKSADYSFARVVAKLSPAGGKSRGGSFGA  77

Query  178  SCN  170
             CN
Sbjct  78   QCN  80



>ref|NP_001150160.1| plastoquinol-plastocyanin reductase [Zea mays]
 gb|ACG38081.1| plastoquinol-plastocyanin reductase [Zea mays]
Length=117

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -2

Query  337  VRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASCN  170
            V Y+ G+N++ GLK  N V  LGV   AD+SFAK+V+SL P G+   GGA  A  N
Sbjct  25   VTYVEGMNAYSGLKGLNKVTMLGVRKTADYSFAKVVASLSPAGRKRRGGAFGAQMN  80



>gb|ACN31713.1| unknown [Zea mays]
Length=117

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -2

Query  337  VRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASCN  170
            V Y+ G+N++ GLK  N V  LGV   AD+SFAK+V+SL P G+   GGA  A  N
Sbjct  25   VTYVEGMNAYSGLKGLNKVTMLGVRKTADYSFAKVVASLSPAGRKRRGGAFGAQMN  80



>ref|XP_009342415.1| PREDICTED: cytochrome b6-f complex subunit 7, chloroplastic [Pyrus 
x bretschneideri]
 ref|XP_009342416.1| PREDICTED: cytochrome b6-f complex subunit 7, chloroplastic [Pyrus 
x bretschneideri]
Length=129

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 3/59 (5%)
 Frame = -2

Query  385  VVAAKTNRFSQRR---STKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            +VAA T   S+RR   +  V Y+ GLN+F GLKA + VA+LG+P   +HSFA++VSSLR
Sbjct  12   MVAATTVAKSRRRMSSANNVTYLTGLNAFSGLKAQSSVASLGLPRTTEHSFARVVSSLR  70



>gb|EMT14091.1| putative Cytochrome b6-f complex subunit 7 [Aegilops tauschii]
Length=119

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASC  173
            ++ + V Y+ G+N++ GLK  N V  LGV   AD+ FA+IV+SL P GK   GG+  A C
Sbjct  22   KKRSGVTYVEGMNAYSGLKGLNKVTMLGVRKSADYKFARIVASLSPAGK-RRGGSFGAQC  80

Query  172  N  170
            N
Sbjct  81   N  81



>gb|EMS56248.1| Cytochrome b6-f complex subunit 7 [Triticum urartu]
Length=119

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASC  173
            ++ + V Y+ G+N++ GLK  N V  LGV   AD+ FA+IV+SL P GK   GG+  A C
Sbjct  22   KKRSGVTYVEGMNAYSGLKGLNKVTMLGVRKSADYKFARIVASLSPAGK-RRGGSFGAQC  80

Query  172  N  170
            N
Sbjct  81   N  81



>ref|XP_004498178.1| PREDICTED: uncharacterized protein LOC101488973 [Cicer arietinum]
Length=127

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = -2

Query  367  NRFSQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGK----GN  200
             + S+ + + V++I GL+SF GLKA N V +LG+P+C + +FAK++ SL+   K      
Sbjct  21   TKSSRNKKSNVKFINGLSSFNGLKAQNTVTSLGLPLCTEQAFAKVMMSLKYPSKGGRRSG  80

Query  199  GGGALSASCN  170
            GGGA+S++CN
Sbjct  81   GGGAVSSTCN  90



>ref|XP_003558921.1| PREDICTED: uncharacterized protein LOC100835051 [Brachypodium 
distachyon]
 ref|XP_010229334.1| PREDICTED: uncharacterized protein LOC100835051 [Brachypodium 
distachyon]
Length=116

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSA  179
            + ++ + V Y+ G+N++ GLK  N V  LGV   AD+ FA+IV+SL P GK   GG   A
Sbjct  17   AAKKRSGVTYVEGMNAYSGLKGLNKVTMLGVRKSADYKFARIVASLSPAGK-RRGGTFGA  75

Query  178  SCN  170
             CN
Sbjct  76   QCN  78



>ref|XP_002301208.2| hypothetical protein POPTR_0002s13150g [Populus trichocarpa]
 gb|EEE80481.2| hypothetical protein POPTR_0002s13150g [Populus trichocarpa]
Length=128

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGK--GNGGGALSA  179
            RR+ KV  I G N + GLKA N V AL +PV  +  FAK+V SLR      G GGGALS+
Sbjct  26   RRTNKVVDIVGTNPYGGLKASNSVLALSIPVSTEQCFAKVVGSLRAASNTHGRGGGALSS  85

Query  178  SCN  170
             C+
Sbjct  86   KCS  88



>gb|ACJ85873.1| unknown [Medicago truncatula]
 gb|AFK40669.1| unknown [Medicago truncatula]
 gb|KEH40761.1| cytochrome b6f complex subunit (PetM), putative [Medicago truncatula]
Length=127

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 39/52 (75%), Gaps = 5/52 (10%)
 Frame = -2

Query  358  SQRRSTK----VRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLR  218
            ++ RSTK    V++I GLNS+ GLKA N  V +LGVP+C + +FAK++SSL+
Sbjct  22   TKSRSTKKGNNVKFITGLNSYNGLKAQNSTVTSLGVPMCTEQAFAKVMSSLK  73



>dbj|BAJ89624.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99347.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99381.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=119

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSASC  173
            ++ + V Y+ G+N++ GLK  N V  LGV   AD+ FA++V+SL P GK   GG   A C
Sbjct  22   KKRSGVTYVEGMNAYSGLKGLNKVTMLGVRKSADYKFARVVASLSPAGK-RRGGTFGAQC  80

Query  172  N  170
            N
Sbjct  81   N  81



>ref|XP_006856228.1| hypothetical protein AMTR_s00059p00208110 [Amborella trichopoda]
 gb|ERN17695.1| hypothetical protein AMTR_s00059p00208110 [Amborella trichopoda]
Length=121

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (66%), Gaps = 4/64 (6%)
 Frame = -2

Query  355  QRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPR-GKGNG-GGALS  182
            +R+ T   +I GLNSF GLKA N ++ LG+P   DHSF+   +S+R   G   G GGALS
Sbjct  23   KRKPT--NFIVGLNSFGGLKAQNKLSTLGLPKSTDHSFSLFANSMRASMGSSKGKGGALS  80

Query  181  ASCN  170
            ++CN
Sbjct  81   STCN  84



>ref|XP_008368152.1| PREDICTED: cytochrome b6-f complex subunit 7, chloroplastic-like 
[Malus domestica]
 ref|XP_008368153.1| PREDICTED: cytochrome b6-f complex subunit 7, chloroplastic-like 
[Malus domestica]
Length=130

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -2

Query  385  VVAAKTNRFSQRR---STKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            +VAA T   S+RR   +  V Y+ GLN+F GLKA + VA+LG+P   + SFA++VSSLR
Sbjct  12   MVAATTVAKSRRRMSSANNVTYLTGLNAFSGLKAQSSVASLGLPRTTEQSFARVVSSLR  70



>gb|KHN14862.1| Cytochrome b6-f complex subunit 7, partial [Glycine soja]
Length=109

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = -2

Query  325  RGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRP---RGKGNGGGALSASCN  170
            +G+ SF GLKA N V +LG P+  +  FAK+VSS++     GKG  GGALS++CN
Sbjct  16   KGVLSFGGLKASNGVVSLGFPMSTEKCFAKVVSSVKTTTSNGKGKSGGALSSTCN  70



>ref|XP_006375019.1| hypothetical protein POPTR_0014s03630g [Populus trichocarpa]
 gb|ERP52816.1| hypothetical protein POPTR_0014s03630g [Populus trichocarpa]
Length=125

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  352  RRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            +R+ KV Y+ G+NS+ GLKAHN V +L +PV  +  FAK+VSSLR
Sbjct  26   KRTNKVVYMGGMNSYGGLKAHNSVLSLNMPVSTEQCFAKVVSSLR  70



>ref|XP_008362118.1| PREDICTED: cytochrome b6-f complex subunit 7, chloroplastic [Malus 
domestica]
 ref|XP_008355273.1| PREDICTED: cytochrome b6-f complex subunit 7, chloroplastic-like 
[Malus domestica]
Length=128

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -2

Query  385  VVAAKTNRFSQRRSTK---VRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            +VAA T   S+R ++    V YI GLN+F GL+A + VA+LG+P   + SFA++VSSLR
Sbjct  12   MVAATTVAKSRRMTSSANNVTYITGLNAFSGLRAQSSVASLGLPQSTEPSFARVVSSLR  70



>ref|NP_001077964.1| putative cytochrome b6f complex subunit [Arabidopsis thaliana]
 gb|AEC07847.1| putative cytochrome b6f complex subunit [Arabidopsis thaliana]
Length=93

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -2

Query  382  VAAKTNRFSQRRSTKVRYIRGLNSFEGLKAHNH-VAALGVPVCADHSFAKIVSSLRPR  212
            + +K+ +  ++   KV YI GLNS+ GLKA N+ V ++G P+C +  FA +V SL+ R
Sbjct  17   IVSKSGQTQKKSEMKVSYITGLNSYGGLKAQNNKVVSMGSPLCTEQCFANVVMSLKGR  74



>gb|ABK21445.1| unknown [Picea sitchensis]
 gb|ACN40600.1| unknown [Picea sitchensis]
Length=129

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -2

Query  358  SQRRSTKVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVS---SLRPRGKGNGGGA  188
            S+ +  KV  +RGL S+ GLK  N V  LGV V +D  FA++V+   +L+    G  GGA
Sbjct  26   SKPKMNKVCCVRGLKSYAGLKPENKVMNLGVAVHSDKQFARLVTMCRALKANSGGGRGGA  85

Query  187  LSASCN  170
            L+++CN
Sbjct  86   LASTCN  91



>gb|KJB63775.1| hypothetical protein B456_010G015700 [Gossypium raimondii]
Length=126

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = -2

Query  379  AAKTNRFSQRRST--KVRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLR  218
            A+  N  S+ R T  K  YI G++ + GLKAHN+V +LG+PV  +  FA +VS+L+
Sbjct  16   ASVVNYGSKARKTTPKAVYIGGMSCYGGLKAHNNVVSLGMPVSTEKWFANVVSNLK  71



>gb|ACN30559.1| unknown [Zea mays]
Length=279

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  337  VRYIRGLNSFEGLKAHNHVAALGVPVCADHSFAKIVSSLRPRGKGNGGGALSA  179
            V Y+ G+ ++ GLK  N V  LGV   AD+SFAK+V+SL   G+   GGA  A
Sbjct  25   VTYVEGMKAYSGLKGLNKVTMLGVRKTADYSFAKVVASLSLAGRKRRGGAFGA  77



>gb|AGT16487.1| plastoquinol-plastocyanin reductase [Saccharum hybrid cultivar 
R570]
Length=89

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 2/52 (4%)
 Frame = -2

Query  319  LNSFEGLKAHNHVAALGVPVCADHSFAKIVSSL-RPRG-KGNGGGALSASCN  170
            +N++ GLK  N V  LGV   AD+SFAKIV+SL  P G K  GGGA  A  N
Sbjct  1    MNAYSGLKGLNKVNMLGVRKTADYSFAKIVASLSSPAGSKRRGGGAFGAQMN  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720