BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027E01

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    327   8e-103   Solanum tuberosum [potatoes]
ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    328   1e-102   Solanum tuberosum [potatoes]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    323   4e-101   Solanum lycopersicum
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    323   5e-101   Solanum lycopersicum
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    322   1e-100   Nicotiana tomentosiformis
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    322   2e-100   Nicotiana tomentosiformis
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    322   2e-100   
ref|XP_002510674.1|  protein binding protein, putative                  318   4e-99    Ricinus communis
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    315   3e-98    Fragaria vesca subsp. vesca
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    313   4e-97    Cucumis melo [Oriental melon]
emb|CDP07293.1|  unnamed protein product                                312   6e-97    Coffea canephora [robusta coffee]
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  312   6e-97    
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    311   9e-97    Sesamum indicum [beniseed]
gb|KJB57964.1|  hypothetical protein B456_009G187700                    311   1e-96    Gossypium raimondii
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             311   2e-96    Capsella rubella
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                310   3e-96    Erythranthe guttata [common monkey flower]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    310   6e-96    Tarenaya hassleriana [spider flower]
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    310   6e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    310   7e-96    Camelina sativa [gold-of-pleasure]
dbj|BAD95193.1|  hypothetical protein                                   295   8e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    309   9e-96    
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    309   9e-96    
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    309   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    309   1e-95    Malus domestica [apple tree]
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               308   1e-95    Arabis alpina [alpine rockcress]
gb|KHG01113.1|  hypothetical protein F383_22949                         308   2e-95    Gossypium arboreum [tree cotton]
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             307   4e-95    Prunus persica
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    307   4e-95    Cucumis sativus [cucumbers]
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    307   4e-95    Prunus mume [ume]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    307   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    307   5e-95    Eucalyptus grandis [rose gum]
emb|CBI40712.3|  unnamed protein product                                306   7e-95    Vitis vinifera
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    306   1e-94    Vitis vinifera
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  306   2e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           305   4e-94    
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    306   4e-94    Eucalyptus grandis [rose gum]
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        303   1e-93    
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        303   1e-93    
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    301   1e-92    Populus euphratica
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           301   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    301   1e-92    Populus euphratica
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             300   3e-92    Eutrema salsugineum [saltwater cress]
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  300   4e-92    Morus notabilis
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    298   9e-92    Populus euphratica
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    298   1e-91    Populus euphratica
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    298   2e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    298   2e-91    
emb|CDX97805.1|  BnaC04g41340D                                          297   2e-91    
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    297   3e-91    Oryza brachyantha
emb|CDY29657.1|  BnaA04g17700D                                          298   4e-91    Brassica napus [oilseed rape]
ref|NP_180618.2|  BTB/POZ domain-containing protein                     296   8e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AES98295.2|  BTB/POZ domain plant protein                            296   8e-91    Medicago truncatula
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    296   9e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    296   1e-90    
dbj|BAD93995.1|  hypothetical protein                                   296   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    296   1e-90    
ref|XP_003615337.1|  Kelch-like protein                                 295   5e-90    
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    292   2e-89    Citrus sinensis [apfelsine]
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    293   2e-89    Citrus sinensis [apfelsine]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             292   3e-89    
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    291   4e-89    Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    291   4e-89    
gb|EEE63337.1|  hypothetical protein OsJ_18148                          289   1e-88    Oryza sativa Japonica Group [Japonica rice]
gb|AAV43802.1|  unknown protein                                         289   4e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    288   6e-88    Nelumbo nucifera [Indian lotus]
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    287   2e-87    Brachypodium distachyon [annual false brome]
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             287   2e-87    Phaseolus vulgaris [French bean]
gb|EEC79014.1|  hypothetical protein OsI_19541                          287   2e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    285   8e-87    
emb|CDM85346.1|  unnamed protein product                                285   1e-86    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    285   2e-86    Brassica rapa
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    284   2e-86    Brassica rapa
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    283   9e-86    Nicotiana sylvestris
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    282   9e-86    Cicer arietinum [garbanzo]
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    283   1e-85    Cicer arietinum [garbanzo]
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750          279   3e-84    
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    279   5e-84    
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          274   1e-82    Sorghum bicolor [broomcorn]
gb|EPS65824.1|  hypothetical protein M569_08953                         265   3e-79    Genlisea aurea
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             261   5e-78    
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              249   2e-73    
ref|XP_001751401.1|  predicted protein                                  248   4e-73    
ref|NP_001174372.1|  Os05g0345500                                       229   3e-72    
gb|KIY99757.1|  hypothetical protein MNEG_8204                          213   2e-60    Monoraphidium neglectum
gb|AAB63076.1|  unknown protein                                         192   3e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586              201   2e-56    Chlorella variabilis
ref|XP_005650913.1|  hypothetical protein COCSUDRAFT_46062              182   9e-51    Coccomyxa subellipsoidea C-169
ref|XP_011399599.1|  BTB/POZ domain-containing protein                  160   2e-42    Auxenochlorella protothecoides
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...    133   8e-32    
ref|XP_001697437.1|  predicted protein                                  118   9e-30    Chlamydomonas reinhardtii
ref|XP_002950189.1|  hypothetical protein VOLCADRAFT_48365              117   3e-29    Volvox carteri f. nagariensis
ref|XP_004339299.1|  BTB/POZ domain containing protein                  115   2e-25    Acanthamoeba castellanii str. Neff
ref|XP_005708947.1|  ubiquitin-protein ligase                         97.1    5e-19    Galdieria sulphuraria
ref|XP_004333299.1|  BTB/POZ domain containing protein                94.7    2e-18    Acanthamoeba castellanii str. Neff
gb|KDD72973.1|  hypothetical protein H632_c2675p1                     87.4    4e-18    Helicosporidium sp. ATCC 50920
ref|XP_011189869.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  94.7    4e-18    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189868.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  94.7    4e-18    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189870.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  94.7    4e-18    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  94.7    4e-18    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011199881.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  93.2    1e-17    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199880.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  93.2    1e-17    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199876.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  93.2    1e-17    
ref|XP_011199879.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  93.2    1e-17    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011406508.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.8    2e-17    
ref|XP_005178040.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.8    2e-17    
ref|XP_011290265.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.8    2e-17    Musca domestica
ref|XP_005178039.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.8    2e-17    Musca domestica
ref|XP_011290263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.8    2e-17    Musca domestica
ref|XP_011290264.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.8    2e-17    Musca domestica
ref|XP_004521545.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.4    2e-17    Ceratitis capitata [medfly]
ref|XP_004521542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.4    2e-17    Ceratitis capitata [medfly]
ref|XP_004521546.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.4    2e-17    Ceratitis capitata [medfly]
ref|XP_004521547.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  92.0    3e-17    
ref|XP_011414030.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  91.3    5e-17    Crassostrea gigas
ref|XP_011414031.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  91.3    5e-17    Crassostrea gigas
gb|EKC30956.1|  E3 ubiquitin-protein ligase HECTD1                    91.3    6e-17    
ref|XP_639138.1|  BTB/POZ domain-containing protein                   88.2    4e-16    Dictyostelium discoideum AX4
gb|AAB47544.1|  MigA                                                  87.8    4e-16    Dictyostelium discoideum
ref|XP_002424807.1|  hect E3 ubiquitin ligase, putative               88.2    5e-16    Pediculus humanus corporis [human body lice]
gb|KFB39857.1|  AGAP009511-PA-like protein                            87.8    6e-16    Anopheles sinensis
emb|CDK13341.1|  HECD-1, isoform c                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
emb|CDK13346.1|  HECD-1, isoform h                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
emb|CDK13340.1|  HECD-1, isoform b                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
emb|CDK13345.1|  HECD-1, isoform g                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
emb|CDK13342.1|  HECD-1, isoform d                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
emb|CDK13343.1|  HECD-1, isoform e                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
emb|CDK13339.1|  HECD-1, isoform a                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
emb|CDK13344.1|  HECD-1, isoform f                                    87.0    1e-15    Caenorhabditis elegans [roundworm]
ref|XP_001844071.1|  E3 ubiquitin-protein ligase HECTD1               87.0    1e-15    Culex quinquefasciatus
ref|NP_501120.1|  Protein HECD-1                                      86.7    2e-15    
ref|WP_029637034.1|  hypothetical protein [                           82.4    2e-15    [Scytonema hofmanni] UTEX B 1581
gb|ETN62256.1|  hect E3 ubiquitin ligase                              86.3    2e-15    Anopheles darlingi [American malaria mosquito]
ref|XP_004909451.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  86.3    2e-15    
ref|XP_004864091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  86.3    2e-15    Heterocephalus glaber [naked mole rat]
ref|XP_004909448.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  86.3    2e-15    
ref|XP_007429074.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.9    3e-15    
ref|XP_004909450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.9    3e-15    
ref|XP_004864090.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.9    3e-15    Heterocephalus glaber [naked mole rat]
ref|XP_004864088.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.9    3e-15    Heterocephalus glaber [naked mole rat]
ref|XP_007063755.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  85.9    3e-15    
ref|XP_009004155.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.9    3e-15    Callithrix jacchus [common marmoset]
gb|EMP32200.1|  E3 ubiquitin-protein ligase HECTD1                    85.9    3e-15    Chelonia mydas [green seaturtle]
ref|XP_007429075.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.9    3e-15    
ref|XP_009004153.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.9    3e-15    Callithrix jacchus [common marmoset]
ref|XP_007429073.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    3e-15    
gb|ETN98493.1|  E3 ubiquitin-protein ligase HECTD1                    81.3    3e-15    Reticulomyxa filosa
gb|ETO19266.1|  E3 ubiquitin-protein ligase HECTD1                    84.3    3e-15    Reticulomyxa filosa
ref|XP_005196337.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    3e-15    
ref|XP_009004154.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Callithrix jacchus [common marmoset]
ref|XP_010631867.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Fukomys damarensis [Damara mole rat]
ref|XP_002753836.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Callithrix jacchus [common marmoset]
ref|XP_003792055.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.5    4e-15    
ref|XP_010631866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Fukomys damarensis [Damara mole rat]
ref|XP_008162333.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Chrysemys picta bellii
ref|XP_005196336.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    
ref|XP_009004152.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Callithrix jacchus [common marmoset]
ref|XP_010333269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Saimiri boliviensis boliviensis
ref|XP_010333268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Saimiri boliviensis boliviensis
ref|XP_009909049.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.5    4e-15    Picoides pubescens
ref|XP_010631864.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Fukomys damarensis [Damara mole rat]
ref|XP_004755203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Mustela putorius furo [black ferret]
ref|XP_006056669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    
ref|XP_005695270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    
ref|XP_010961314.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Camelus bactrianus [camel]
ref|XP_004755201.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Mustela putorius furo [black ferret]
ref|XP_010631865.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    Fukomys damarensis [Damara mole rat]
ref|XP_006116433.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    
ref|XP_005285367.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.5    4e-15    
ref|XP_011222356.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Ailuropoda melanoleuca
ref|XP_010845303.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Bison bison bison
ref|XP_010372961.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Rhinopithecus roxellana
ref|XP_006056670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    
ref|XP_007098141.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Panthera tigris altaica
ref|XP_005377022.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    
ref|XP_006085912.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    
ref|XP_005881054.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Myotis brandtii
ref|XP_005285366.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Chrysemys picta bellii
ref|XP_010961316.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Camelus bactrianus [camel]
ref|XP_005881051.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    4e-15    Myotis brandtii
ref|XP_004055105.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    4e-15    
ref|XP_011222354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Ailuropoda melanoleuca
ref|XP_010845301.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bison bison bison
ref|XP_008972942.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Pan paniscus [bonobo]
ref|XP_006056667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005267560.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005377019.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_004801249.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_006056668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_006085913.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005881050.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005695269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005377020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_011374706.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Pteropus vampyrus
ref|XP_010586873.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Loxodonta africana [African bush elephant]
ref|XP_010372959.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Rhinopithecus roxellana
ref|XP_007098140.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Panthera tigris altaica
ref|XP_005695268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005222130.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bos taurus [bovine]
ref|XP_004467983.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Dasypus novemcinctus
ref|XP_005222132.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bos taurus [bovine]
gb|ETO36723.1|  hypothetical protein RFI_00341                        84.7    5e-15    Reticulomyxa filosa
ref|XP_010333267.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Saimiri boliviensis boliviensis
ref|XP_003924275.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Saimiri boliviensis boliviensis
ref|XP_007984591.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Chlorocebus sabaeus
ref|XP_005196334.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_003288046.1|  hypothetical protein DICPUDRAFT_16127            84.3    5e-15    Dictyostelium purpureum
ref|XP_006116431.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008267702.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Oryctolagus cuniculus [domestic rabbit]
ref|XP_005196335.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_007113428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
gb|ELK17058.1|  E3 ubiquitin-protein ligase HECTD1                    85.1    5e-15    Pteropus alecto
ref|XP_008267700.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Oryctolagus cuniculus [domestic rabbit]
ref|XP_007660814.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_006766087.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_008972943.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Pan paniscus [bonobo]
ref|XP_011374705.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Pteropus vampyrus
ref|XP_004467982.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Dasypus novemcinctus
ref|XP_011374703.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Pteropus vampyrus
ref|XP_008708622.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  85.1    5e-15    Ursus maritimus [white bear]
ref|XP_008565372.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Galeopterus variegatus [Malayan flying lemur]
ref|XP_006906925.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  85.1    5e-15    
ref|XP_006890036.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004584798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    Ochotona princeps [southern American pika]
ref|XP_004467981.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Dasypus novemcinctus
ref|XP_004421198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004017927.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_003408766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Loxodonta africana [African bush elephant]
sp|Q9ULT8.3|HECD1_HUMAN  RecName: Full=E3 ubiquitin-protein ligas...  85.1    5e-15    Homo sapiens [man]
gb|AAP13073.1|  E3 ligase for inhibin receptor                        85.1    5e-15    Homo sapiens [man]
ref|XP_011314687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Fopius arisanus
gb|ELW63202.1|  E3 ubiquitin-protein ligase HECTD1                    85.1    5e-15    Tupaia chinensis
ref|XP_011222355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Ailuropoda melanoleuca
ref|XP_010845302.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bison bison bison
ref|XP_010372960.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Rhinopithecus roxellana
ref|XP_007984590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Chlorocebus sabaeus
ref|XP_005377021.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005222131.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bos taurus [bovine]
ref|XP_004755202.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Mustela putorius furo [black ferret]
ref|XP_004637178.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_010984469.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  85.1    5e-15    
ref|XP_010961313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Camelus bactrianus [camel]
ref|XP_011222353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Ailuropoda melanoleuca
ref|XP_004755200.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Mustela putorius furo [black ferret]
ref|XP_006152455.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_004755199.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Mustela putorius furo [black ferret]
ref|XP_010372956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Rhinopithecus roxellana
ref|XP_002918561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Ailuropoda melanoleuca
ref|XP_007516893.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    Erinaceus europaeus [common hedgehog]
ref|XP_006056666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bubalus bubalis [domestic water buffalo]
ref|XP_006085911.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_005890166.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    Bos mutus
ref|XP_005881052.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Myotis brandtii
ref|XP_005377018.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Chinchilla lanigera
ref|XP_011281667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_010586874.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Loxodonta africana [African bush elephant]
ref|XP_004467984.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Dasypus novemcinctus
ref|XP_007472586.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Monodelphis domestica
gb|ETO35939.1|  hypothetical protein RFI_01125                        84.3    5e-15    Reticulomyxa filosa
ref|XP_007472588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Monodelphis domestica
ref|XP_004755198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Mustela putorius furo [black ferret]
ref|XP_004376588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_850301.2|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-pr...  85.1    5e-15    Canis lupus familiaris [dogs]
ref|XP_007660828.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_010214811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Tinamus guttatus
ref|XP_008101615.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Anolis carolinensis [Carolina anole]
ref|XP_008101614.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Anolis carolinensis [Carolina anole]
ref|XP_008101612.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Anolis carolinensis [Carolina anole]
ref|XP_008267701.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010586872.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    
ref|XP_010845300.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bison bison bison
ref|XP_010372958.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Rhinopithecus roxellana
ref|XP_007984588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Chlorocebus sabaeus
ref|XP_007098139.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Panthera tigris altaica
ref|XP_005222129.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bos taurus [bovine]
gb|ELR60436.1|  E3 ubiquitin-protein ligase HECTD1                    85.1    5e-15    Bos mutus
ref|XP_002696742.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Bos taurus [bovine]
ref|XP_007098138.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    5e-15    Panthera tigris altaica
ref|XP_006191324.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|XP_003260766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    5e-15    
ref|NP_001248188.1|  E3 ubiquitin-protein ligase HECTD1               85.1    5e-15    
ref|XP_007180745.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  85.1    6e-15    
ref|XP_006116428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    6e-15    
ref|XP_006116432.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    6e-15    
ref|XP_006116430.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    6e-15    
ref|XP_008267699.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    6e-15    
ref|XP_003821255.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    6e-15    
ref|XP_007936773.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    6e-15    
ref|XP_008972941.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    6e-15    
ref|XP_008071204.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    6e-15    
ref|XP_002718172.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  85.1    6e-15    
ref|XP_006835428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    85.1    6e-15    
ref|XP_010709956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_009317632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_009288642.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_009288640.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_009288638.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_007660818.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_007472587.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_007472585.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_007113427.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_007451326.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    6e-15    
ref|XP_007113426.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_004400006.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    6e-15    
ref|XP_004282185.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    6e-15    
gb|EPQ16917.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    6e-15    
ref|XP_011314680.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_007660811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_007660823.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_001512305.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_001364091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_005020674.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_009317628.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_010572566.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_011314686.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_010390298.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_010390290.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_011314688.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_011314684.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_011314681.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_011314679.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_005456015.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_010390313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_010709953.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_009317630.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_005020671.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_010709952.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_005020668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_006022320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_011314682.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    6e-15    
ref|XP_001924707.4|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  84.7    7e-15    
ref|XP_006263085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010572563.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010572562.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009209622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_004941800.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_008565371.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_011314685.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_004324112.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_006729616.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
gb|KFV19064.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    7e-15    
ref|XP_010140687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_008101611.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009209621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_008101608.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
gb|KFO93631.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    7e-15    
ref|XP_009288639.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_003464797.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  84.7    7e-15    
gb|KFV93612.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    7e-15    
ref|XP_003756170.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_004612165.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_010214809.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_008101609.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009288641.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_008101613.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009317629.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
gb|KFP99363.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    7e-15    
ref|XP_010151091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009877228.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009668205.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009574994.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009288636.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_002200542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009317623.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009288632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_008101607.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009288631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005322716.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_010709955.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010286320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009806354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_005561083.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005561082.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005020670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010125887.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009992149.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009644998.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_008923247.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_008637792.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_005417553.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_005479915.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_010390277.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009317625.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009317624.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005020672.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009317631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010169085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_010572561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010709951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010572559.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010307144.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009951548.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009942450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009561891.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009317626.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009100181.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_005520368.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_005149352.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_005020673.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_421227.3|  PREDICTED: E3 ubiquitin-protein ligase HECTD1 i...  84.7    7e-15    
ref|XP_010709950.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010572558.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010709949.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_004941799.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010709948.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005020667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009317622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009317621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009317620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005020666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_004941798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005020665.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005020664.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_010709954.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_005020669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009462362.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.7    7e-15    
ref|XP_009288635.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
ref|XP_009288634.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
gb|EOB00564.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    7e-15    
ref|XP_009288633.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
gb|EMC83831.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    7e-15    
gb|ENN80588.1|  hypothetical protein YQE_02993                        84.7    7e-15    
ref|XP_005456014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    7e-15    
gb|ERL91993.1|  hypothetical protein D910_09315                       84.7    8e-15    
ref|XP_010390306.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    8e-15    
gb|KFP49559.1|  E3 ubiquitin-protein ligase HECTD1                    84.7    8e-15    
ref|XP_010390270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    8e-15    
ref|XP_010390263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    8e-15    
ref|XP_005456013.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.7    8e-15    
ref|XP_645290.1|  hypothetical protein DDB_G0272218                   83.6    8e-15    
ref|XP_009986276.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_010572565.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
gb|KFP02468.1|  E3 ubiquitin-protein ligase HECTD1                    84.3    8e-15    
ref|XP_006263084.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_004698576.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_006263086.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_008312937.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_006022319.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_006022318.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_004941801.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_010572564.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_010015718.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_009507570.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_008942534.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_005502361.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_010572557.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_010572556.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_004941797.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    8e-15    
ref|XP_008494127.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_005047457.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    8e-15    
ref|XP_009075355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    9e-15    
ref|XP_003451257.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    9e-15    
ref|XP_005728612.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  84.3    9e-15    
ref|NP_001131085.1|  HECT domain containing E3 ubiquitin protein ...  84.3    9e-15    
ref|XP_009698490.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    9e-15    
ref|XP_008159020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.3    9e-15    
gb|KFP65021.1|  E3 ubiquitin-protein ligase HECTD1                    84.3    9e-15    
ref|XP_005603478.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    9e-15    
ref|XP_009209620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
dbj|BAA86445.2|  KIAA1131 protein                                     84.3    1e-14    
gb|EHH27804.1|  hypothetical protein EGK_18090                        84.3    1e-14    
gb|KGL94873.1|  E3 ubiquitin-protein ligase HECTD1                    84.3    1e-14    
ref|XP_008565370.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
ref|XP_008521118.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
ref|XP_005603476.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
ref|XP_005603479.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
ref|XP_005603477.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
ref|XP_008521116.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
ref|XP_008312929.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
ref|XP_008312922.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.3    1e-14    
dbj|GAM18790.1|  hypothetical protein SAMD00019534_019650             82.8    1e-14    
ref|XP_004554704.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  84.3    1e-14    
ref|XP_009885241.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.0    1e-14    
gb|KFV06434.1|  E3 ubiquitin-protein ligase HECTD1                    84.0    1e-14    
ref|XP_005240951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.0    1e-14    
ref|XP_008521117.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.0    1e-14    
ref|XP_008521114.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.0    1e-14    
ref|XP_001489913.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.0    1e-14    
ref|XP_008521115.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  84.0    1e-14    
ref|XP_010071203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    84.0    1e-14    
ref|XP_003294753.1|  hypothetical protein DICPUDRAFT_51693            82.8    1e-14    
ref|XP_002089068.1|  GE26196                                          84.0    1e-14    
ref|XP_001969437.1|  GG23957                                          84.0    1e-14    
ref|XP_009968713.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    83.6    1e-14    
ref|XP_008275346.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    1e-14    
ref|XP_310184.4|  AGAP009511-PA                                       83.6    1e-14    
ref|XP_008275345.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    1e-14    
ref|XP_004989701.1|  hypothetical protein PTSG_12883                  83.6    2e-14    
ref|XP_010198466.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    83.2    2e-14    
ref|XP_008837027.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    2e-14    
ref|XP_008837026.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.6    2e-14    
ref|XP_009489109.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    83.2    2e-14    
ref|XP_008837025.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.2    2e-14    
ref|XP_009915163.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    83.2    2e-14    
ref|XP_008837024.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.2    2e-14    
ref|XP_007578188.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.2    2e-14    
ref|XP_002004091.1|  GI19489                                          83.2    2e-14    
ref|XP_006240150.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.2    2e-14    
ref|XP_007637045.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.2    2e-14    
ref|XP_006975329.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.2    2e-14    
ref|XP_011242353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  83.2    2e-14    



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   327 bits (839),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS A
Sbjct  628  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVA  687

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH+
Sbjct  688  GPQMEGGRNASWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHE  747

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQTICKPGQFASWPITG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  748  NDQTICKPGQFASWPITGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS A
Sbjct  648  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVA  707

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH+
Sbjct  708  GPQMEGGRNASWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHE  767

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQTICKPGQFASWPITG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  768  NDQTICKPGQFASWPITGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   323 bits (828),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS A
Sbjct  628  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVA  687

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNLRVH+
Sbjct  688  GPQMEGGRNTSWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHE  747

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQTICKPGQFASWP+TG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  748  NDQTICKPGQFASWPVTGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   323 bits (828),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS A
Sbjct  648  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVA  707

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNLRVH+
Sbjct  708  GPQMEGGRNTSWWMVDIGPDHQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHE  767

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQTICKPGQFASWP+TG N LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  768  NDQTICKPGQFASWPVTGSNALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV++TASSP SR TDPKVLVSRNFQGTS A
Sbjct  628  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLA  687

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH+
Sbjct  688  GPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHE  747

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQ+ICKP QFASWPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  748  NDQSICKPCQFASWPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV++TASSP SR TDPKVLVSRNFQGTS A
Sbjct  650  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLA  709

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH+
Sbjct  710  GPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHE  769

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQ+ICKP QFASWPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  770  NDQSICKPCQFASWPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  826



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV++TASSP SR TDPKVLVSRNFQGTS A
Sbjct  648  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLA  707

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+E G  +SWWM+D+G DHQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH+
Sbjct  708  GPQMEGGRNTSWWMVDVGQDHQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHE  767

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQ+ICKP QFASWPIT PN LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  768  NDQSICKPCQFASWPITDPNALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   318 bits (814),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVL+KR+ +TASSP  R TDPK LVSR +QGTSF
Sbjct  629  QYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPTLRHTDPKALVSRTYQGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDGN  +WWM+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG +WTNLRVH
Sbjct  689  AGPRMEDGNKCAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKSWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            KDDQT+CKPGQFASWPITGPN LLPFRFFR+++TGP TD  +PWN CIC LELYGYFR
Sbjct  749  KDDQTVCKPGQFASWPITGPNSLLPFRFFRVILTGPTTDVSDPWNLCICFLELYGYFR  806



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQW NPVL+KR+ +TASSP SRFTDPKVLVSR +QGTSF
Sbjct  626  QYICDGDSNGVLYFAGTSYGEHQWFNPVLAKRITITASSPPSRFTDPKVLVSRTYQGTSF  685

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP +EDG  ++WWM+D+G DHQL+CNYYT+R DGSRA+MR WNFQGS DG  WTNLRVH
Sbjct  686  AGPHIEDGRNNTWWMVDIGADHQLICNYYTLRHDGSRAYMRYWNFQGSLDGKTWTNLRVH  745

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTICKPGQFASWP+TGPN LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  746  ENDQTICKPGQFASWPVTGPNALLPFRFFRVVLTGPTMDASNPWNFCICFLELYGYFH  803



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   313 bits (801),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVL+FAGTSYG HQWVNP+LSK++ +T SSP SR+TDPKVLVSR +QGTSF
Sbjct  629  QYICDGDSNGVLFFAGTSYGEHQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AG +VEDG   SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  689  AGLRVEDGKTCSWWMVDIGEDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            ++DQT+CKPGQFASWP+TGPN LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  749  ENDQTVCKPGQFASWPVTGPNALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   312 bits (799),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVLSK+V VTASSP SRFTDPKVL SR +QGTSF
Sbjct  625  QYICDGDSNGVLYFAGTSYGKHQWVNPVLSKKVTVTASSPTSRFTDPKVLASRTYQGTSF  684

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AG ++ DG  +SWWM+D+G  HQLMCNYYT+RQDGS+AFMR WNFQGS+DG NWTNLR+H
Sbjct  685  AGSRMGDGRNTSWWMVDIGPGHQLMCNYYTLRQDGSKAFMRCWNFQGSSDGRNWTNLRIH  744

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            + D+T+CKPGQFASWPI  PN LLPFRFFR+ MT P TD+ NPWNCCIC LELYGYF 
Sbjct  745  EKDETLCKPGQFASWPINDPNALLPFRFFRVTMTAPTTDDTNPWNCCICFLELYGYFH  802



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   312 bits (800),  Expect = 6e-97, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  632  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSF  691

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  692  AGPRMEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVH  751

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGY+R
Sbjct  752  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYYR  809



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   311 bits (798),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVLSK+V +T SSP SRFTDPKVLVSR++QGTSF
Sbjct  627  QYICDGDSNGVLYFAGTSYGEHQWVNPVLSKKVTITPSSPLSRFTDPKVLVSRSYQGTSF  686

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP+ EDG  +SWWM+D+G+ HQLMCNYYT+RQDGSRAF+R+W+FQGS DG NWTNLRVH
Sbjct  687  AGPRKEDGRTTSWWMVDIGHGHQLMCNYYTLRQDGSRAFIRNWSFQGSMDGNNWTNLRVH  746

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++D T+CKPGQ+ASWP+ GPN LLPFRFFR V+T P TD  NPW+ CIC LELYGYFR
Sbjct  747  ENDVTMCKPGQYASWPVVGPNALLPFRFFRAVLTAPTTDITNPWSFCICFLELYGYFR  804



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYF+GTSYG H WVNPVLSKR+ +TASSP SR TDPKVLVSR +QGT F
Sbjct  625  QYICDGDSNGVLYFSGTSYGEHPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQGTCF  684

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E+GNI +WWM+D+G DHQLMCNYYT+RQDGSRA++R+W FQG  DG  W +LRVH
Sbjct  685  AGPRMENGNICAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVH  744

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CKPGQFASWP+TGPN LLPFRFFR+++TGP TD  NPWN CIC LELYGYFR
Sbjct  745  ENDQTMCKPGQFASWPVTGPNALLPFRFFRVLLTGPTTDASNPWNLCICFLELYGYFR  802



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   311 bits (797),  Expect = 2e-96, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  632  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSF  691

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LR+H
Sbjct  692  AGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRIH  751

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGYFR
Sbjct  752  EDDQTMCKVGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYFR  809



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   310 bits (795),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVLSK+V +TASSPFSRFTDPKVLVSR++ GTSF
Sbjct  625  QYICDGDSNGVLYFAGTSYGEHQWVNPVLSKKVIITASSPFSRFTDPKVLVSRSYLGTSF  684

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E+G  ++WWM+D+G+ HQLMCN+YT+RQDGSRAFMR+WNFQGS DG NWTNLRVH
Sbjct  685  AGPRMENGRNTAWWMVDIGHSHQLMCNHYTLRQDGSRAFMRNWNFQGSMDGNNWTNLRVH  744

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++D+T+ KPGQFASWP+ GP  LLPFRFFR+V+  P TD  NPW+ CIC LELYGYFR
Sbjct  745  ENDETMSKPGQFASWPVVGPTALLPFRFFRVVLVAPTTDATNPWSLCICFLELYGYFR  802



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   310 bits (793),  Expect = 6e-96, Method: Composition-based stats.
 Identities = 130/178 (73%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVL++AGTSYG HQWVNPVL+K++ +  SSP SRFTDPK L SR + GTSF
Sbjct  627  QYICDGDSNGVLHYAGTSYGDHQWVNPVLAKKITIIVSSPTSRFTDPKTLASRTYMGTSF  686

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG ISSWWM+DLG DHQLMCNYYT+RQDGSR + RSW  QGS DG +W ++RVH
Sbjct  687  AGPRMEDGQISSWWMVDLGKDHQLMCNYYTLRQDGSRTYPRSWKLQGSMDGNSWADVRVH  746

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPI G N LLPFR+FR+VMTGP  D  NPW+ CIC LELYGYFR
Sbjct  747  EDDQTMCKLGQFASWPIVGANSLLPFRYFRVVMTGPTADASNPWSFCICFLELYGYFR  804



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   310 bits (793),  Expect = 6e-96, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  646  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSF  705

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  706  AGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVH  765

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  766  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  823



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   310 bits (793),  Expect = 7e-96, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  632  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSF  691

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  692  AGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVH  751

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  752  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  809



>dbj|BAD95193.1| hypothetical protein [Arabidopsis thaliana]
Length=331

 Score =   295 bits (756),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  154  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSF  213

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH
Sbjct  214  AGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVH  273

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  274  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  331



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   309 bits (792),  Expect = 9e-96, Method: Composition-based stats.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  647  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSF  706

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  707  AGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGRTWTDLRVH  766

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+++TGP TD   PWN CIC LELYGY+R
Sbjct  767  EDDQTMCKAGQFASWPITAANALLPFRFFRLLLTGPTTDTSTPWNFCICYLELYGYYR  824



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   309 bits (791),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR ++GTSF
Sbjct  626  QYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRGTSF  685

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGPQ+EDG+ S+WW +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH
Sbjct  686  AGPQIEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVH  745

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTICKPGQFASWP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  746  ENDQTICKPGQFASWPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  803



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   309 bits (792),  Expect = 1e-95, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  641  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSF  700

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  701  AGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVH  760

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  761  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  818



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   309 bits (791),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR ++GTSF
Sbjct  628  QYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRGTSF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGPQ+EDG+ S+WW +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH
Sbjct  688  AGPQIEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTICKPGQFASWP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  748  ENDQTICKPGQFASWPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  805



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   308 bits (790),  Expect = 1e-95, Method: Composition-based stats.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  630  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSF  689

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  690  AGPRMEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVH  749

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGY R
Sbjct  750  ENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTVDTSTPWNFCICYLELYGYLR  807



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYF+GTSYG H WVNPVLSKR+ +TASSP SR TDPKVLVSR +QGT F
Sbjct  625  QYICDGDSNGVLYFSGTSYGEHPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQGTCF  684

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E+GNI +WWM+D+G DHQLMCNYYT+RQDGSRA++R+W FQG  DG  W +LRVH
Sbjct  685  AGPRMENGNICAWWMVDIGKDHQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVH  744

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CKPGQFASWP+TGPN LLPFRFFR+++TG  TD  NPWN CIC LELYGYFR
Sbjct  745  ENDQTMCKPGQFASWPVTGPNALLPFRFFRVLLTGLTTDASNPWNLCICFLELYGYFR  802



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVLYFAGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR +QGTSF
Sbjct  628  QYIRDGDSNGVLYFAGTSYGKHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGPQ+ DG+  +WWM+D+  DHQL+CNYYT+RQDGSR +MR W FQGS DG  WTNLRVH
Sbjct  688  AGPQIIDGHNCTWWMVDISADHQLICNYYTLRQDGSRTYMRYWKFQGSLDGKTWTNLRVH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTICKPGQFASWP+TGPN LLP+RFFR+V+TGP TD  NPWN CIC+LELYGYF 
Sbjct  748  ENDQTICKPGQFASWPVTGPNALLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYFH  805



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVL+FAGTSYG HQWVNP+LSK++ +T SSP SR+TDPKVLVSR +QGTSF
Sbjct  629  QYICDGDSNGVLFFAGTSYGEHQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
             G +VEDG   SWWM+D+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  689  TGLRVEDGKTCSWWMVDIGEDHQLMCNYYTLRQDGSRAFIRYWNLQGSFDGKTWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            ++DQT+CKPGQFASW +TGPN LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  749  ENDQTVCKPGQFASWAVTGPNALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   307 bits (787),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVLYFAGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR +QGTSF
Sbjct  628  QYIRDGDSNGVLYFAGTSYGKHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGPQ+ DG+  +WWM+D+  DHQL+CNYYT+RQDGSRA+MR W FQGS DG  WTNLRVH
Sbjct  688  AGPQIIDGHNCTWWMVDISADHQLICNYYTLRQDGSRAYMRYWKFQGSLDGKTWTNLRVH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTICKPGQFASWP+TGPN LLP+RFFR+V+TGP TD  NPWN CIC+LELYGY  
Sbjct  748  ENDQTICKPGQFASWPVTGPNALLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYLH  805



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   307 bits (787),  Expect = 4e-95, Method: Composition-based stats.
 Identities = 133/178 (75%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  632  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSF  691

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  692  AGPRMEGGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVH  751

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP TD   PWN  IC LELYGYFR
Sbjct  752  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTTDTSTPWNFYICYLELYGYFR  809



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   307 bits (786),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            Q+I DGDSNGV+YFAGTSYG HQWVNPV++KR+ +TASSP SR+TDPKVLVSR FQGTSF
Sbjct  625  QHISDGDSNGVMYFAGTSYGEHQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQGTSF  684

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+  SWWM+D+G DHQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+LR H
Sbjct  685  AGPRIEDGHNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAH  744

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
             +DQTICKPGQFASWPITGPN LLPFR+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  745  DNDQTICKPGQFASWPITGPNALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYFR  802



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   306 bits (784),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVL+FAGTSYG HQWVNP+L+KR+ +TASSP SR TDPKVLVSR +QGTSF
Sbjct  612  QYICDGDSNGVLHFAGTSYGEHQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQGTSF  671

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
             GP+VEDG   SWWM+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG  WTNLRVH
Sbjct  672  TGPRVEDGKNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVH  731

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CKPGQ+ASWPI  PN LLPFRFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  732  ENDQTMCKPGQYASWPIMAPNALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYFH  789



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   306 bits (784),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVL+FAGTSYG HQWVNP+L+KR+ +TASSP SR TDPKVLVSR +QGTSF
Sbjct  629  QYICDGDSNGVLHFAGTSYGEHQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
             GP+VEDG   SWWM+D+G DHQLMCNYYT+RQDGSRA++R WN QGS DG  WTNLRVH
Sbjct  689  TGPRVEDGKNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CKPGQ+ASWPI  PN LLPFRFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  749  ENDQTMCKPGQYASWPIMAPNALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYFH  806



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   306 bits (785),  Expect = 2e-94, Method: Composition-based stats.
 Identities = 131/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  678  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSF  737

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH
Sbjct  738  AGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVH  797

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  798  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  855



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   305 bits (780),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQW+NPVL+KR+ +TASSP SR+TDPK LVSR +QGTSF
Sbjct  629  QYICDGDSNGVLYFAGTSYGEHQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP +EDG+I +WWM+D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  689  AGPCMEDGHIRAWWMVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK  QFASWPITGP+ LLPFRFFR+V+TGP TD  NP N CIC LELYGYF 
Sbjct  749  ENDQTMCKADQFASWPITGPHALLPFRFFRVVLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   306 bits (783),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            Q+I DGDSNGV+YFAGTSYG HQWVNPV++KR+ +TASSP SR+TDPKVLVSR FQGTSF
Sbjct  676  QHISDGDSNGVMYFAGTSYGEHQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQGTSF  735

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+  SWWM+D+G DHQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+LR H
Sbjct  736  AGPRIEDGHNCSWWMVDIGEDHQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAH  795

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
             +DQTICKPGQFASWPITGPN LLPFR+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  796  DNDQTICKPGQFASWPITGPNALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYFR  853



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   303 bits (777),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNG+LYFAGTSYG H WVNPVLSKR+A+TASSP SR+TDPKVLVSR +QGT F
Sbjct  612  QYICDGDSNGILYFAGTSYGEHPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCF  671

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G I +WWMID+G DHQL+CNYYT+RQDGSRA++R W  QGS DG +W +LRVH
Sbjct  672  AGPRMEGGRICAWWMIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVH  731

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CKPGQFASWP+TG N LLPFRFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  732  ENDQTMCKPGQFASWPVTGTNALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  789



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   303 bits (777),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNG+LYFAGTSYG H WVNPVLSKR+A+TASSP SR+TDPKVLVSR +QGT F
Sbjct  628  QYICDGDSNGILYFAGTSYGEHPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E G I +WWMID+G DHQL+CNYYT+RQDGSRA++R W  QGS DG +W +LRVH
Sbjct  688  AGPRMEGGRICAWWMIDIGQDHQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CKPGQFASWP+TG N LLPFRFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  748  ENDQTMCKPGQFASWPVTGTNALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  805



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVLYFAGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT F
Sbjct  631  QYISDGDSNGVLYFAGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCF  690

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP+VE G I +WWMID+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  691  AGPRVEGGQIHAWWMIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVH  750

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPITGP  LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  751  ENDQTMCKAGQFASWPITGPQALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  808



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVLYFAGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT F
Sbjct  624  QYISDGDSNGVLYFAGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCF  683

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP+VE G I +WWMID+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  684  AGPRVEGGQIHAWWMIDIGQDHQLMCNHYTLRQDGSRAFIRCWNLQGSLDGKTWTNLRVH  743

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPITGP  LLPFRFFR+V+TGP TD  NP N CIC LELYGYF 
Sbjct  744  ENDQTMCKAGQFASWPITGPQALLPFRFFRVVLTGPTTDGSNPHNLCICFLELYGYFH  801



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVLYFAGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT F
Sbjct  624  QYISDGDSNGVLYFAGTSYGEHQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCF  683

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP+VE G I +WWMID+G DHQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  684  AGPRVEGGQIHAWWMIDIGQDHQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVH  743

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPITGP  LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  744  ENDQTMCKAGQFASWPITGPQALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  801



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  629  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKTYVGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP+ EDG+ISSWWM+DLG DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH
Sbjct  689  AGPRKEDGHISSWWMVDLGEDHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+ +TGP TD   PWN CIC LELYGYFR
Sbjct  749  EDDQTMCKAGQFASWPITAANALLPFRFFRLFLTGPTTDTSTPWNFCICYLELYGYFR  806



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVL+K + +TASSP SRFTDPKVL SR +QGTSF
Sbjct  633  QYICDGDSNGVLYFAGTSYGEHQWVNPVLAKTITITASSPPSRFTDPKVLASRTYQGTSF  692

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ S+WWM+D+G +HQLMCNYYT+RQDGSRA++RSW+ QGS DG  WTNL VH
Sbjct  693  AGPRIEDGHSSTWWMVDIGSNHQLMCNYYTLRQDGSRAYIRSWSLQGSLDGKTWTNLSVH  752

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPI GPN L PFRFFR ++TGP TD  NP N CIC LELYGYF 
Sbjct  753  ENDQTVCKLGQFASWPIVGPNALRPFRFFRALLTGPTTDISNPCNLCICFLELYGYFH  810



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   298 bits (764),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQW+NPVL+KR+ +TASSP SR+TDPK LVSR +QGTSF
Sbjct  629  QYICDGDSNGVLYFAGTSYGEHQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP +E+G+I +WW +D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  689  AGPCMENGHIRAWWTVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK  QFASWP+TGP+ LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  749  ENDQTMCKADQFASWPVTGPHALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   298 bits (763),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGTSF
Sbjct  629  QYICDGDSNGVLYFAGTSYGEHQWINPILAKRITITASSPPSRYTDPKTLVSRTYQGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP +E+G+I +WW +D+G DHQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH
Sbjct  689  AGPCMENGHIRAWWTVDIGQDHQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK  QFASWP+TGP+ LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  749  ENDQTMCKADQFASWPVTGPHALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLY+AGTSYG H+WVNP+LS R+ +T SSP SRFTDPKVL SR +QGTSF
Sbjct  628  QYICDGDSNGVLYYAGTSYGEHRWVNPMLSNRITITTSSPISRFTDPKVLASRTYQGTSF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            +GP+ EDG   SWWMID+G DHQLMCNYYT+RQDGSR F+R WN QGS DG +WTNLR H
Sbjct  688  SGPRFEDGRTCSWWMIDVGEDHQLMCNYYTLRQDGSRTFIRHWNLQGSLDGKHWTNLREH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            K+DQ ICKPGQFASWP+TGP  LL FRFFR+++TGP TD    W  CIC LELYGYFR
Sbjct  748  KNDQKICKPGQFASWPVTGPQALLSFRFFRVILTGPTTDPTETWKFCICFLELYGYFR  805



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+YF+GTSYG HQWVNPVLSK++ VTASSP SR+TDPK LVSR +QGTSF
Sbjct  628  QYISDGDNNGVIYFSGTSYGEHQWVNPVLSKKITVTASSPASRYTDPKTLVSRAYQGTSF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG   +WWM+D+G DHQLMCNYYT+RQDGS  +MRSW FQGS DG NWTNLRVH
Sbjct  688  AGPRIEDGMNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWAFQGSMDGENWTNLRVH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTIC+PGQFASWPI G   LLPFRFFR+++TGP T   N WN CIC +ELYGYFR
Sbjct  748  ENDQTICRPGQFASWPIIGSTSLLPFRFFRVILTGPATGYSNVWNLCICFIELYGYFR  805



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   297 bits (761),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  619  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSF  678

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH
Sbjct  679  AGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVH  738

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  739  ENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  796



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   297 bits (760),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+Y+AGTS+G HQW+NPVL+K + V ASSP SR+TDPK LVS+N+QGT F
Sbjct  628  QYISDGDNNGVIYYAGTSFGKHQWINPVLAKNIKVIASSPNSRYTDPKALVSKNYQGTCF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG + SWWM+D+G+DHQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LR+H
Sbjct  688  AGPRLEDGKMCSWWMVDIGHDHQLMCNYYTVRQDGSTTFMRSWVLQGSMDGQNWTSLRIH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            KDDQTIC+PGQFASWPITGP+ LLPFRFFR+++TG  T   N WN CIC LELYGYFR
Sbjct  748  KDDQTICQPGQFASWPITGPSALLPFRFFRVMLTGHATGVSNTWNLCICFLELYGYFR  805



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   298 bits (762),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  667  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSF  726

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH
Sbjct  727  AGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVH  786

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  787  ENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  844



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   296 bits (758),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  632  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSF  691

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH
Sbjct  692  AGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVH  751

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  752  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  809



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   296 bits (757),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT
Sbjct  620  QYICDGDDHGVLYFAGTSYGEHQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGT  679

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLR  372
             FAGP++E+G+  SWWMIDLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LR
Sbjct  680  CFAGPRLENGHNCSWWMIDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLR  739

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            VH++D+T+CKPGQFASWP+ GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  740  VHENDRTVCKPGQFASWPVVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  798



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   296 bits (757),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGD NGV+YFAGTSYG H WVNPVLSK++ +TASSP SR+TD K LVSR +Q TSF
Sbjct  626  QYICDGDKNGVIYFAGTSYGEHAWVNPVLSKKITLTASSPASRYTDSKALVSRTYQATSF  685

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ S+WWM+D+G+DHQLMCNYYT+RQDGS  ++RSW FQGS DG NWTNLRVH
Sbjct  686  AGPRIEDGHSSAWWMVDIGHDHQLMCNYYTLRQDGSSTYIRSWAFQGSVDGKNWTNLRVH  745

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
             DDQTIC+ GQFASWP+ GP  LLPFR FR+++TGP + + N WN CIC +ELYGYF
Sbjct  746  NDDQTICRSGQFASWPVIGPMALLPFRIFRVILTGPASGDANVWNLCICFIELYGYF  802



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGD+NGV+YF+GTSYG HQWVNPVL+K++ VTASSP SR+TDPK LVSR +QGTSF
Sbjct  626  QYICDGDNNGVIYFSGTSYGEHQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQGTSF  685

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG   +WWM+D+G DHQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNLRVH
Sbjct  686  AGPRIEDGKNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVH  745

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTIC+PGQFASW +TG   LLPFRFFR+++TGP + + + WN CIC +ELYGYFR
Sbjct  746  ENDQTICRPGQFASWTVTGSTALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYFR  803



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++ +T+SSP SRFTDPK L S+ + GTSF
Sbjct  635  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSF  694

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH
Sbjct  695  AGPRMEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVH  754

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  755  EDDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  812



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGD+NGV+YF+GTSYG HQWVNPVL+K++ VTASSP SR+TDPK LVSR +QGTSF
Sbjct  628  QYICDGDNNGVIYFSGTSYGEHQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQGTSF  687

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG   +WWM+D+G DHQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNLRVH
Sbjct  688  AGPRIEDGKNCAWWMVDIGQDHQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVH  747

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTIC+PGQFASW +TG   LLPFRFFR+++TGP + + + WN CIC +ELYGYFR
Sbjct  748  ENDQTICRPGQFASWTVTGSTALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYFR  805



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   295 bits (756),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT
Sbjct  705  QYICDGDDHGVLYFAGTSYGEHQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGT  764

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLR  372
             FAGP++E+G+  SWWMIDLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LR
Sbjct  765  CFAGPRLENGHNCSWWMIDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLR  824

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            VH++D+T+CKPGQFASWP+ GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  825  VHENDRTVCKPGQFASWPVVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  883



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG H WVNPVL+KR+ +TASSP SR+TDPK L SR +QG SF
Sbjct  629  QYICDGDSNGVLYFAGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+  +WWM+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH
Sbjct  689  AGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASW + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  749  ENDQTMCKHGQFASWAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  806



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG H WVNPVL+KR+ +TASSP SR+TDPK L SR +QG SF
Sbjct  640  QYICDGDSNGVLYFAGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSF  699

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+  +WWM+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH
Sbjct  700  AGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVH  759

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASW + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  760  ENDQTMCKHGQFASWAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  817



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG H WVNPVL+KR+ +TASSP SR+TDPK L SR +QG SF
Sbjct  641  QYICDGDSNGVLYFAGTSYGEHPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSF  700

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG+  +WWM+D+G DHQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH
Sbjct  701  AGPRMEDGHNCTWWMVDIGQDHQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVH  760

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASW + GPN L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  761  ENDQTMCKHGQFASWAVIGPNALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  818



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT
Sbjct  623  QYICDGDDHGVLYFAGTSYGEHPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGT  682

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLR  372
             FAGP++E+G   SWWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLR
Sbjct  683  CFAGPRLENGQNCSWWMVDLGQDHQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLR  742

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            VH++D++ICKPGQFASWPI GPN LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  743  VHENDRSICKPGQFASWPIIGPNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  801



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT
Sbjct  627  QYICDGDDHGVLYFAGTSYGEHPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGT  686

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLR  372
             FAGP++E+G   SWWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLR
Sbjct  687  CFAGPRLENGQNCSWWMVDLGQDHQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLR  746

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            VH++D++ICKPGQFASWPI GPN LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  747  VHENDRSICKPGQFASWPIIGPNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  805



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+Y+AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+Q T F
Sbjct  557  QYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCF  616

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG + SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH
Sbjct  617  AGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVH  676

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQTIC+PGQFASWPITG   LLPFRFFR+++T P T   N WN CIC LELYGYFR
Sbjct  677  EDDQTICQPGQFASWPITGQTALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYFR  734



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   289 bits (739),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+Y+AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+Q T F
Sbjct  629  QYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG + SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH
Sbjct  689  AGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQTIC+PGQFASWPITG   LLPFRFFR+++T P T   N WN CIC LELYGYFR
Sbjct  749  EDDQTICQPGQFASWPITGQTALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYFR  806



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   288 bits (738),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGD+NGV+YFAGTSYG HQWVNPVL++++ VTASSP SR+TDPKVLVSR +Q TSF
Sbjct  629  QYICDGDNNGVIYFAGTSYGEHQWVNPVLAQKITVTASSPASRYTDPKVLVSRTYQATSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG   +WWM+DLG DHQLMCN YT+RQDGS  +MR W  QGS DG NWT+L+VH
Sbjct  689  AGPRMEDGKNCAWWMVDLGQDHQLMCNCYTLRQDGSNVYMRCWALQGSLDGRNWTDLKVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
             +DQTICKPGQFASWP+ GP  +LPFRFFR+++TGP T   +PWN  IC LELYGYF 
Sbjct  749  GNDQTICKPGQFASWPVQGPAAVLPFRFFRVILTGPTTSNSSPWNLSICFLELYGYFH  806



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+Y+AGTS+G HQW+NPVL+K + V ASSP SR+T+PK LVS+N+QGT F
Sbjct  635  QYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVMASSPNSRYTNPKALVSKNYQGTCF  694

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP+ E+G   SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW FQGS DG NWT+L VH
Sbjct  695  AGPRDENGKKCSWWMVDIGEDHQLMCNYYTVRQDGSTTFMRSWVFQGSMDGENWTSLGVH  754

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +++QTIC+PGQFASWPITGP+ LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  755  EEEQTICQPGQFASWPITGPSALLPFRFFRLALTGPATGMSNTWNLCICFLELYGYFR  812



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT
Sbjct  623  QYICDGDDHGVLYFAGTSYGEHPWVNPLLAEQRKITITASSPHSRYTDPKVLVSRTYQGT  682

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLR  372
             FAGP++E+G   +WWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS +G +WTNL 
Sbjct  683  CFAGPRLENGQNCTWWMVDLGQDHQLMCNYYTLRQDGSKAFPRFWNIQGSQEGKSWTNLW  742

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            VH++D+++CKPGQFASWPI GPN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  743  VHENDRSVCKPGQFASWPIVGPNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  801



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   287 bits (734),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+Y+AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+Q T F
Sbjct  629  QYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG + SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH
Sbjct  689  AGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DDQTIC+PGQFASWPITG   LLPFRFFR+++T P T   + WN CIC LELYGYFR
Sbjct  749  EDDQTICQPGQFASWPITGQTALLPFRFFRVMLTAPATGVSHTWNLCICFLELYGYFR  806



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   285 bits (730),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 147/178 (83%), Gaps = 8/178 (4%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGDSNGVLYFAGTSYG HQWVNPVL+KR+ +TASSP SRFTDPK LVSR ++    
Sbjct  628  QYICDGDSNGVLYFAGTSYGEHQWVNPVLAKRITITASSPPSRFTDPKALVSRTYR----  683

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
                +EDG+ S+WW +D+G DHQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH
Sbjct  684  ----IEDGHKSTWWTVDIGADHQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVH  739

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQTICKPGQFASWP+ G N LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  740  ENDQTICKPGQFASWPVIGQNALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  797



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 150/178 (84%), Gaps = 2/178 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+Y+AGTS+G HQW+NPVL+K + VTASSP SR+TDPK LVS+N+QGT F
Sbjct  630  QYISDGDNNGVIYYAGTSFGKHQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQGTCF  689

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP+ EDG   SWWM+D+G DHQLMCNYYT+RQDGS AFMRSW  QGS DG NWT+L V+
Sbjct  690  AGPRDEDGKKCSWWMVDIGQDHQLMCNYYTVRQDGSTAFMRSWVLQGSMDGENWTSLVVN  749

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +D++ IC+PGQFASWPITGP+ LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  750  EDERAICQPGQFASWPITGPSALLPFRFFRLALTGPTTS--NTWNLCICFLELYGYFR  805



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++++T+SSP SRFTDPK L S+ + GTSF
Sbjct  624  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVGTSF  683

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH
Sbjct  684  AGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVH  743

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  744  ENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  801



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGVL+F GTSYG+HQWVNPVL+K++++T+SSP SRFTDPK L S+ + GTSF
Sbjct  629  QYIRDGDSNGVLHFVGTSYGSHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVGTSF  688

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++EDG ISSWWM+DLG DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH
Sbjct  689  AGPRMEDGRISSWWMVDLGEDHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVH  748

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++DQT+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  749  ENDQTMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  806



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   283 bits (723),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 144/177 (81%), Gaps = 14/177 (8%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YICDGDSNGVLYFAGTSYG HQWVNPVLSKRV +TASSP SR TDPKVLVSRNFQGTS A
Sbjct  648  YICDGDSNGVLYFAGTSYGKHQWVNPVLSKRVTITASSPISRCTDPKVLVSRNFQGTSLA  707

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GPQ+EDG  +SWWM+D+G DHQLMCNYYT+RQDGS AFMR WNFQGS DG +WTNLR+  
Sbjct  708  GPQMEDGRNASWWMVDVGQDHQLMCNYYTLRQDGSGAFMRRWNFQGSLDGKSWTNLRI--  765

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
                 C P        TGPN LLPFRFFR++MT P TD+ NPWNCCIC LELYGYFR
Sbjct  766  ----XCSP--------TGPNALLPFRFFRLLMTAPTTDDTNPWNCCICFLELYGYFR  810



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   282 bits (722),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT
Sbjct  616  QYICDGDDHGVLYFAGTSYGEHQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGT  675

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLR  372
             FAGP++E+G+  SWWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR
Sbjct  676  CFAGPRLENGHNCSWWMVDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELR  735

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            +H++D TICKPGQFASWPI  PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  736  IHENDGTICKPGQFASWPIVAPNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  794



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 148/179 (83%), Gaps = 2/179 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG HQWVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT
Sbjct  636  QYICDGDDHGVLYFAGTSYGEHQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGT  695

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLR  372
             FAGP++E+G+  SWWM+DLG DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR
Sbjct  696  CFAGPRLENGHNCSWWMVDLGQDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELR  755

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            +H++D TICKPGQFASWPI  PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  756  IHENDGTICKPGQFASWPIVAPNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  814



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 144/178 (81%), Gaps = 0/178 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYICDGD NGVLY++GTSYG H WVNP L+KRV VTASSP SR+TDPK LVSR +Q TSF
Sbjct  650  QYICDGDQNGVLYYSGTSYGEHDWVNPFLAKRVIVTASSPASRYTDPKSLVSRTYQATSF  709

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++  G   +WW ID+G DH+LMCNYYTIRQDGS  F R W+ QGS D  NWT+LRVH
Sbjct  710  AGPRIVGGKNCAWWKIDIGQDHELMCNYYTIRQDGSTGFTRHWSLQGSRDAENWTDLRVH  769

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            ++D+TICKP QFASWPI  PN LLPFRFFR+++TG  T + NPWN C+C LELYGYFR
Sbjct  770  ENDRTICKPAQFASWPIHPPNALLPFRFFRVLLTGLTTSDSNPWNLCMCFLELYGYFR  827



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   279 bits (713),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGDSNGV+Y+AGTS+G HQW+NPVL+K + V ASSP SR TDPK LVS+N+QGT F
Sbjct  683  QYISDGDSNGVIYYAGTSFGKHQWMNPVLAKNITVVASSPNSRHTDPKALVSKNYQGTCF  742

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP +EDG   SWWM+D+G DHQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LRVH
Sbjct  743  AGPCIEDGKKISWWMVDIGQDHQLMCNYYTVRQDGSTTFMRSWVLQGSMDGRNWTSLRVH  802

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGP--GTDEMNPWNCCICVLELYGYFR  192
            ++D TIC PGQFASWP+ GP  LLPFRFFR+ +TGP  G    N WN CIC LELYGY R
Sbjct  803  EEDATICHPGQFASWPVVGPPALLPFRFFRVALTGPAAGGSVSNAWNLCICFLELYGYLR  862



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            QYI DGD+NGV+Y+AGTS+G HQW+NPVL+K + V ASSP SR TDPK LVS+N+QGT F
Sbjct  632  QYISDGDNNGVIYYAGTSFGKHQWMNPVLTKNITVVASSPNSRHTDPKALVSKNYQGTCF  691

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP +E+G   SWWM+D+G D+QLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LRVH
Sbjct  692  AGPCIENGKKLSWWMVDIGQDYQLMCNYYTVRQDGSTTFMRSWALQGSMDGRNWTSLRVH  751

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
             DD TIC PGQFASWPI GP  LLPFRFFR+ +TGP       WN CIC LELYGYFR
Sbjct  752  DDDPTICHPGQFASWPIVGPAALLPFRFFRVALTGPAAG--CAWNLCICFLELYGYFR  807



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            Q+ICDGD+NGVLYFAGTSYG HQWVNPVLSK+V +T SSP SRFTDPKVLVSR++QGTSF
Sbjct  626  QFICDGDNNGVLYFAGTSYGQHQWVNPVLSKKVFITGSSPVSRFTDPKVLVSRSYQGTSF  685

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
            AGP++E+G  ++WWM+D+G DHQL+CNYYTIRQDGSRAF+R W+ QGSTDG NW +LRVH
Sbjct  686  AGPRMENGKNTAWWMVDIGDDHQLICNYYTIRQDGSRAFLRHWSLQGSTDGANWASLRVH  745

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTG  261
            ++D T+CK GQ+ASWP+ G N LLPFRFFRI +TG
Sbjct  746  ENDATMCKSGQYASWPVVGSNALLPFRFFRIALTG  780



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   261 bits (668),  Expect = 5e-78, Method: Composition-based stats.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            Y+CDGD NGVLY+AGTSYGAH+W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFA
Sbjct  616  YLCDGDGNGVLYYAGTSYGAHEWMNPMVTKQITLSASSPHSRYTDPKVLASRNYQATSFA  675

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GP +E G   SWW +DLG DH+LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+
Sbjct  676  GPCIERGETVSWWRVDLGPDHKLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHE  735

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
             D +I +P Q+ASWP+ G   L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  736  KDHSIYRPAQYASWPVHGSKSLIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  791



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            Y+CDGD NGVLY+AGTSYGAH+W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFA
Sbjct  596  YLCDGDGNGVLYYAGTSYGAHEWMNPMVTKQITLSASSPPSRYTDPKVLASRNYQATSFA  655

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GP +E G   SWW +DLG DH+LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+
Sbjct  656  GPCIERGETVSWWRVDLGPDHKLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHE  715

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
             D +I +P Q+ASWP+ G   L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  716  KDHSIYRPAQYASWPVHGSKSLIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  771



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            YI DGD NGV Y+ GTSYG+H W+NP L+K++ V+ASSP SRFTD K LVSRN+QGTSFA
Sbjct  608  YISDGDCNGVFYYLGTSYGSHPWMNPALTKKLVVSASSPPSRFTDAKALVSRNYQGTSFA  667

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GP    G +S+WW +DLG D QL+CNYYT+RQD S +FMR+W+ QGS DG  WT LR H 
Sbjct  668  GPCNVGGQMSAWWKVDLGADQQLLCNYYTVRQDSSSSFMRNWSLQGSVDGQRWTQLRTHH  727

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            +DQTI   GQ+ASWP+ G N LLPFRFFR+++ GP T    PWN  +C LELYGY R
Sbjct  728  NDQTIGHGGQYASWPVFGANALLPFRFFRVILLGPTTSVSTPWNLSLCYLELYGYLR  784



>ref|NP_001174372.1| Os05g0345500 [Oryza sativa Japonica Group]
 dbj|BAH93100.1| Os05g0345500 [Oryza sativa Japonica Group]
Length=152

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  623  VTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQD  444
            VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQD
Sbjct  9    VTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQD  68

Query  443  GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMT  264
            GS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T
Sbjct  69   GSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLT  128

Query  263  GPGTDEMNPWNCCICVLELYGYFR  192
             P T   N WN CIC LELYGYFR
Sbjct  129  APATGVSNTWNLCICFLELYGYFR  152



>gb|KIY99757.1| hypothetical protein MNEG_8204 [Monoraphidium neglectum]
Length=725

 Score =   213 bits (543),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 96/176 (55%), Positives = 118/176 (67%), Gaps = 0/176 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            Y+ DGD NGV+    T YG+ QWVNPVL+KR+ V ASSP SRFTDPK LVS  F  TSFA
Sbjct  509  YVYDGDRNGVIAHIATDYGSKQWVNPVLAKRIEVRASSPASRFTDPKALVSGAFLRTSFA  568

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
             P+ E G  SSWW++DLG  H+L+CNYYT+R D S  F R W  Q S D  +W +LR H 
Sbjct  569  CPRYEGGQPSSWWLVDLGPSHRLLCNYYTMRHDSSSDFPRHWVLQASNDLQHWVDLRRHI  628

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
             D  I  PGQ+ASWP++GP   +PFR FR+++ GP      PWN C+  +E YGYF
Sbjct  629  ADAAIRLPGQYASWPVSGPASHMPFRAFRLLLAGPTLSAATPWNFCLSHVEFYGYF  684



>gb|AAB63076.1| unknown protein [Arabidopsis thaliana]
Length=114

 Score =   192 bits (487),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -2

Query  533  VEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQ  354
            +EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQ
Sbjct  1    MEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQ  60

Query  353  TICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  192
            T+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  61   TMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  114



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 122/176 (69%), Gaps = 0/176 (0%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            Y+ DGD NGV +  G+  G+  WVNPVL+ R+ V ASSP  R TDPK L   NF   +FA
Sbjct  478  YMYDGDKNGVCWHLGSRGGSQPWVNPVLAGRLQVRASSPACRSTDPKALAGNNFARCNFA  537

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            GP++E+G +SSWW++DLG +H+L+CN+YT+R DGS  F+RSW  QGS DG +W +LR H 
Sbjct  538  GPRMENGQLSSWWVLDLGPEHRLICNHYTLRHDGSTDFLRSWVLQGSNDGASWADLRRHI  597

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
             D+T+  PGQ+ASWP++     +P+R FR+++ GP  +  NP + C+   ELYGY 
Sbjct  598  SDRTVRMPGQYASWPVSSHAAAVPYRMFRLLLVGPNPEAANPHHVCLSFWELYGYL  653



>ref|XP_005650913.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26369.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
Length=448

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            Y+C+GD NGV ++ GT+YG  ++VNP LS R+ VTASSP  RFTDPK +VS +F   + A
Sbjct  265  YMCNGDHNGVCHYIGTAYGQQKFVNPALSGRLQVTASSPSCRFTDPKAVVSGHFLRNNAA  324

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHK  363
            G Q  DG   +WW +DLG  H+LMCNYYT+R D S  + RSW  Q STDG  W +LR H 
Sbjct  325  G-QRRDGG--TWWRVDLGEQHRLMCNYYTMRHDASPDYARSWALQASTDGTVWVDLRQHA  381

Query  362  DDQTICKPGQFASWPITGPNPLLPFRFFRIVMT--GPGTDEMNPWNCCICVLELYGYF  195
            DD TI   GQ+ASWP+TG     PFRFF++++T   P + + N     +  LE YGYF
Sbjct  382  DDCTINMAGQYASWPVTGHAARRPFRFFQLLLTPAAPASGKANGRVFSLSYLEFYGYF  439



>ref|XP_011399599.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
 gb|KFM26661.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
Length=465

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 104/178 (58%), Gaps = 2/178 (1%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            ++C GD NGV Y+  T  G  QWVNP+LS RV V ASSP  R T+P   V+      +FA
Sbjct  265  FVCPGDKNGVTYWLATQGGQQQWVNPMLSGRVKVQASSPACRSTNPASCVALGPPRLNFA  324

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDG--VNWTNLRV  369
             P+ E G + SWW +DLG  HQL C+ YT+R D S   +RSW  Q S DG    W +LR 
Sbjct  325  APRSEAGRLVSWWSLDLGPRHQLACSAYTLRHDKSHDPLRSWTLQASRDGPQCGWEDLRR  384

Query  368  HKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            H++D T+  PGQ+ SW +TG    +P+R FRI +        NPW+  +  +ELYG  
Sbjct  385  HENDLTLRLPGQYGSWAVTGHAATVPYRCFRICVMQMQKGNENPWHASLAQIELYGNL  442



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 2/85 (2%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLS--KRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            QYICDGD +GVLYFAGTSYG H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT
Sbjct  627  QYICDGDDHGVLYFAGTSYGEHPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGT  686

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQ  477
             FAGP++E+G   SWWM+DLG DHQ
Sbjct  687  CFAGPRLENGQNCSWWMVDLGQDHQ  711



>ref|XP_001697437.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00099.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=113

 Score =   118 bits (296),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = -2

Query  527  DGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  348
            +G  SSWW +DLG  HQL   YYT+R DGS+ F RSW  QGS D  NW +L+ H +D T+
Sbjct  1    NGVASSWWQVDLGEQHQLAITYYTLRHDGSQDFARSWVLQGSHDLSNWVDLKRHANDTTV  60

Query  347  CKPGQFASWPITGPNPLLPFRFFRIVMTGPGT--DEMNPWNCCICVLELYGYF  195
              PGQ+ASWP+ GP    P+R FR+++T P    +  + +N C+  +E YG+ 
Sbjct  61   KVPGQYASWPVIGPAAATPYRAFRLLLTAPNASPNPASRYNFCLSNVEFYGFM  113



>ref|XP_002950189.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
 gb|EFJ48857.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
Length=108

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 4/109 (4%)
 Frame = -2

Query  512  SWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQ  333
            SWW +DLG  HQL   YYT+R DGS+ F+RSW  QGS D   W +L+ H +D TI  PGQ
Sbjct  1    SWWQVDLGEQHQLAITYYTLRHDGSQDFVRSWVLQGSHDLAVWVDLKRHSNDTTIKVPGQ  60

Query  332  FASWPITGPNPLLPFRFFRIVMTGPGTDEMNP---WNCCICVLELYGYF  195
            +ASWP+ GP   +P+R FR+++T P     NP    N C+  LELYG+ 
Sbjct  61   YASWPVIGPAAAVPYRAFRLLLTAPNASP-NPASRHNFCLSNLELYGFL  108



>ref|XP_004339299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR17286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=775

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 96/178 (54%), Gaps = 14/178 (8%)
 Frame = -2

Query  710  GDSNGVLYFAGTSY------GAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
            GD++G+ ++ GTS           WVNP  +  V V  S+P SR+++P+ +V R F  T 
Sbjct  605  GDASGLFHWLGTSGGAGGGAKERGWVNPCRAGLVKVVCSAPPSRYSNPEAVVDRAFHTTW  664

Query  548  FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRV  369
            +       G    W ++ L  +   +   Y IRQDGS  F+RSW+ QGS DG +W +L  
Sbjct  665  YTS-----GRPHPWLIVQLLKEKAFVMKGYAIRQDGSTVFLRSWSMQGSNDGQSWVDLST  719

Query  368  HKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            H +D  +  P ++  WP++    ++P+  FR++MTGP    ++P    +  +E YG+F
Sbjct  720  HVNDCGLASPSRWVFWPVSS---VVPYAQFRLIMTGPSASPVSPNTLALSNIEFYGFF  774



>ref|XP_005708947.1| ubiquitin-protein ligase [Galdieria sulphuraria]
 gb|EME32427.1| ubiquitin-protein ligase [Galdieria sulphuraria]
Length=970

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 89/159 (56%), Gaps = 8/159 (5%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAH---QWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGT  552
            YI    S GVLY+ G  YG       VNP     V++T+SS  SRF   + L   +   +
Sbjct  795  YIPKLHSVGVLYYLGCFYGLQLGGTRVNPHKYNIVSITSSSG-SRFAKLESLAESSVNRS  853

Query  551  SFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNL  375
             FA   + + +   W+ +DLG +  L C++YT+  DGS + F+R+W  +GS DG +WT L
Sbjct  854  CFA---LSNSSSLVWFALDLGAERVLACSFYTLAHDGSESNFLRNWCLEGSKDGKSWTVL  910

Query  374  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGP  258
            + H++D+T+  P Q A+W +  P   + +R+FR++   P
Sbjct  911  KEHQNDETLQSPLQRATWRLEEPTSQVFYRYFRVIARPP  949



>ref|XP_004333299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=764

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 87/164 (53%), Gaps = 14/164 (9%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            Y  D D  G++++  T+ G   W NP  + R+ VTASS      DP  LVS+        
Sbjct  596  YAYDYDQKGIIFWIATNRGREPWTNPHSAGRLRVTASS--IEKGDPVKLVSKK-------  646

Query  542  GPQVEDGNI-SSWWMIDLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLR  372
              ++  G++ +SW+ IDLG    L+ NYYT+R  G+     +R+W+ QGS+DG  W  L+
Sbjct  647  PSELWSGDVPASWFAIDLGPSRTLVPNYYTLRHGGNYKADSLRTWDLQGSSDGKTWIVLK  706

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMN  240
             H +D ++  P    SWPI  P+    +R FRI+ TG  +   N
Sbjct  707  RHTNDTSLSGPFATHSWPI--PSVTEAYRHFRILQTGHNSSNHN  748



>gb|KDD72973.1| hypothetical protein H632_c2675p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=110

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = -2

Query  500  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  321
            +DLG   +L   +Y +R D SR F+R W  Q S DG  W ++R H  D ++    Q+A+W
Sbjct  1    VDLGPRRRLALTHYALRHDASRDFLRDWVVQASADGEAWVDVRRHASDPSLKVAHQWAAW  60

Query  320  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
            P+ G     P+R  R+++  P     NPW+  +   E YG+ 
Sbjct  61   PLVGHAAARPWRALRVLLDRPNAGADNPWHLALSAWEFYGHL  102



>ref|XP_011189869.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
cucurbitae]
Length=2893

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 56/158 (35%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1153  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1206

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L 
Sbjct  1207  VNCHTKD-NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLV  1263

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1264  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189868.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
cucurbitae]
Length=2901

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 56/158 (35%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1165  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1218

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L 
Sbjct  1219  VNCHTKD-NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLV  1275

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1276  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1313



>ref|XP_011189870.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
cucurbitae]
Length=2889

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 56/158 (35%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1153  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1206

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L 
Sbjct  1207  VNCHTKD-NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLV  1263

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1264  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
 ref|XP_011189867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
Length=2905

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 56/158 (35%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1165  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1218

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    L+ N YT+R  +   R+ +R+W  QGS DGV WT L 
Sbjct  1219  VNCHTKD-NKKAWFAIDLGV--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLV  1275

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1276  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1313



>ref|XP_011199881.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
dorsalis]
Length=2883

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1148  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1201

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L 
Sbjct  1202  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLV  1258

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1259  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199880.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
dorsalis]
Length=2887

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1148  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1201

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L 
Sbjct  1202  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLV  1258

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1259  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199876.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199877.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199878.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
Length=2899

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1160  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1213

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L 
Sbjct  1214  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLV  1270

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1271  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1308



>ref|XP_011199879.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
dorsalis]
Length=2895

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++Y+ G++ G   WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1160  DFDEEGLMYYIGSNGGTCDWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1213

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG+ WT L 
Sbjct  1214  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLV  1270

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  R+   G
Sbjct  1271  THTDDKSLVEPGSTATWPIVCAPDEMHGFRHIRVQQNG  1308



>ref|XP_011406508.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Amphimedon 
queenslandica]
Length=2146

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 56/185 (30%), Positives = 95/185 (51%), Gaps = 17/185 (9%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQ  558
             Q++ D D NG+ Y+ G++     WVNP     V V++S     P+    D   ++ R+  
Sbjct  1003  QHVSDFDENGIFYWIGSNARTCDWVNPAAHHIVVVSSSDGRILPYGNLDD---ILCRD--  1057

Query  557   GTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQD---GSRAFMRSWNFQGSTDGVN  387
               + A    +D + +SW+ +D G        +Y++R     G+R+ +RSW+FQ S DGV 
Sbjct  1058  -DTPANCHTKD-DRNSWFAVDTGV--WFFPTHYSLRHSRGYGNRSALRSWDFQVSKDGVT  1113

Query  386   WTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLEL  207
             WT +  H +D ++ +PG  ASW ++ P     +R  R+++TGP       +   +  LE+
Sbjct  1114  WTTVYSHVNDNSLNEPGSTASWSLSPPTDPEGWRHLRLILTGPNASGHTHY-LSLSGLEV  1172

Query  206   YGYFR  192
             YG  R
Sbjct  1173  YGEVR  1177



>ref|XP_005178040.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Musca 
domestica]
Length=2792

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 84/159 (53%), Gaps = 16/159 (10%)
 Frame = -2

Query  716   CDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             CD D  G++Y+ G++    +WVNP     V VT+S     P+ +  D   ++SR+    S
Sbjct  1127  CDFDEEGLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----S  1179

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
              +       N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L
Sbjct  1180  ISVNCHTKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTL  1237

Query  374   RVHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
               H DD+++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1238  VTHADDKSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1276



>ref|XP_011290265.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Musca 
domestica]
Length=2804

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 84/159 (53%), Gaps = 16/159 (10%)
 Frame = -2

Query  716   CDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             CD D  G++Y+ G++    +WVNP     V VT+S     P+ +  D   ++SR+    S
Sbjct  1139  CDFDEEGLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----S  1191

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
              +       N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L
Sbjct  1192  ISVNCHTKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTL  1249

Query  374   RVHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
               H DD+++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1250  VTHADDKSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1288



>ref|XP_005178039.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Musca 
domestica]
Length=2847

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 84/159 (53%), Gaps = 16/159 (10%)
 Frame = -2

Query  716   CDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             CD D  G++Y+ G++    +WVNP     V VT+S     P+ +  D   ++SR+    S
Sbjct  1182  CDFDEEGLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----S  1234

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
              +       N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L
Sbjct  1235  ISVNCHTKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTL  1292

Query  374   RVHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
               H DD+++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1293  VTHADDKSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1331



>ref|XP_011290263.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Musca 
domestica]
Length=2848

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 84/159 (53%), Gaps = 16/159 (10%)
 Frame = -2

Query  716   CDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             CD D  G++Y+ G++    +WVNP     V VT+S     P+ +  D   ++SR+    S
Sbjct  1183  CDFDEEGLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----S  1235

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
              +       N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L
Sbjct  1236  ISVNCHTKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTL  1293

Query  374   RVHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
               H DD+++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1294  VTHADDKSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1332



>ref|XP_011290264.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Musca 
domestica]
Length=2836

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 56/159 (35%), Positives = 84/159 (53%), Gaps = 16/159 (10%)
 Frame = -2

Query  716   CDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             CD D  G++Y+ G++    +WVNP     V VT+S     P+ +  D   ++SR+    S
Sbjct  1171  CDFDEEGLIYYIGSNGKTCEWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----S  1223

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
              +       N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L
Sbjct  1224  ISVNCHTKDNKKAWFAIDLGV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTL  1281

Query  374   RVHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
               H DD+++ +PG  A+WPI   P+    FR  RI   G
Sbjct  1282  VTHADDKSLVEPGSTATWPIVCAPDENQGFRHIRIQQNG  1320



>ref|XP_004521545.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X4 
[Ceratitis capitata]
Length=2896

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++++ G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1162  DFDEEGLMFYIGSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1215

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L 
Sbjct  1216  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLV  1272

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  RI   G
Sbjct  1273  THNDDKSLVEPGSTATWPIVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521542.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Ceratitis capitata]
 ref|XP_004521543.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Ceratitis capitata]
 ref|XP_004521544.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X3 
[Ceratitis capitata]
Length=2900

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++++ G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1162  DFDEEGLMFYIGSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1215

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L 
Sbjct  1216  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLV  1272

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  RI   G
Sbjct  1273  THNDDKSLVEPGSTATWPIVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521546.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X5 
[Ceratitis capitata]
Length=2888

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++++ G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1150  DFDEEGLMFYIGSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1203

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L 
Sbjct  1204  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLV  1260

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  RI   G
Sbjct  1261  THNDDKSLVEPGSTATWPIVCSPDEMQGFRHIRIQQNG  1298



>ref|XP_004521547.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X6 
[Ceratitis capitata]
Length=2477

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 85/158 (54%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D  G++++ G++ G  +WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1162  DFDEEGLMFYIGSNGGTCEWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVS  1215

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  +W+ IDLG    ++ N YT+R  +   R+ +R+W  QGS DG  WT L 
Sbjct  1216  VNCHTKD-NKKAWFAIDLGV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLV  1272

Query  371   VHKDDQTICKPGQFASWPIT-GPNPLLPFRFFRIVMTG  261
              H DD+++ +PG  A+WPI   P+ +  FR  RI   G
Sbjct  1273  THNDDKSLVEPGSTATWPIVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_011414030.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Crassostrea gigas]
Length=2448

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 18/182 (10%)
 Frame = -2

Query  722   YICDGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQ  558
             Y  D D NG++Y+ G+ +  A +WVNP     + VT+S     P+ +  D   +VSR+  
Sbjct  1080  YQSDFDENGLIYWIGSNAKTAVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD--  1134

Query  557   GTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNW  384
               S A     + +  +W+ IDLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW
Sbjct  1135  --SAALNCHTNDDKKAWFAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINW  1190

Query  383   TNLRVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLEL  207
               L+ HKDD ++ +PG  A+WP+T P +    +R  +I  TG        +   +  +E+
Sbjct  1191  VTLKTHKDDTSLNEPGSTATWPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEI  1249

Query  206   YG  201
             YG
Sbjct  1250  YG  1251



>ref|XP_011414031.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Crassostrea gigas]
Length=2445

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 18/182 (10%)
 Frame = -2

Query  722   YICDGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQ  558
             Y  D D NG++Y+ G+ +  A +WVNP     + VT+S     P+ +  D   +VSR+  
Sbjct  1077  YQSDFDENGLIYWIGSNAKTAVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD--  1131

Query  557   GTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNW  384
               S A     + +  +W+ IDLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW
Sbjct  1132  --SAALNCHTNDDKKAWFAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINW  1187

Query  383   TNLRVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLEL  207
               L+ HKDD ++ +PG  A+WP+T P +    +R  +I  TG        +   +  +E+
Sbjct  1188  VTLKTHKDDTSLNEPGSTATWPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEI  1246

Query  206   YG  201
             YG
Sbjct  1247  YG  1248



>gb|EKC30956.1| E3 ubiquitin-protein ligase HECTD1 [Crassostrea gigas]
Length=2380

 Score = 91.3 bits (225),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 18/182 (10%)
 Frame = -2

Query  722   YICDGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQ  558
             Y  D D NG++Y+ G+ +  A +WVNP     + VT+S     P+ +  D   +VSR+  
Sbjct  1077  YQSDFDENGLIYWIGSNAKTAVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD--  1131

Query  557   GTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNW  384
               S A     + +  +W+ IDLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW
Sbjct  1132  --SAALNCHTNDDKKAWFAIDLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINW  1187

Query  383   TNLRVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLEL  207
               L+ HKDD ++ +PG  A+WP+T P +    +R  +I  TG        +   +  +E+
Sbjct  1188  VTLKTHKDDTSLNEPGSTATWPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEI  1246

Query  206   YG  201
             YG
Sbjct  1247  YG  1248



>ref|XP_639138.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
 gb|EAL65772.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
Length=863

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/178 (33%), Positives = 88/178 (49%), Gaps = 16/178 (9%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS-PFSRFTDPKVLVSRNFQGTS  549
            +Y  D D  G++++  T  G  +W NP  + ++ +T+SS       D   L    F    
Sbjct  689  EYSFDFDFKGIIFWISTDGGNEKWSNPHSTSKIKITSSSIDKGNLYDIVELTPNAFWTKD  748

Query  548  FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNL  375
                       +SW MIDLG +  ++  YYTIR   S     +R+W+FQGST+G  WT L
Sbjct  749  VP---------ASWVMIDLGPNRTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVL  799

Query  374  RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
            + H +D ++       SWP+TG      FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  800  KRHTNDPSLNYKYATHSWPVTGCET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  853



>gb|AAB47544.1| MigA [Dictyostelium discoideum]
Length=813

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 60/177 (34%), Positives = 92/177 (52%), Gaps = 14/177 (8%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            +Y  D D  G++++  T  G  +W NP  + ++ +T+SS         V ++ N    +F
Sbjct  639  EYSFDFDFKGIIFWISTDGGNEKWSNPHSTSKIKITSSSIDKGNLYDIVELTPN----AF  694

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLR  372
                V     +SW MIDLG +  ++  YYTIR   S     +R+W+FQGST+G  WT L+
Sbjct  695  WTKDVP----ASWVMIDLGPNRTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLK  750

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
             H +D ++       SWP+TG      FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  751  RHTNDPSLNYKYATHSWPVTGCET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  803



>ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
 gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
Length=2686

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 60/159 (38%), Positives = 87/159 (55%), Gaps = 17/159 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NGV+Y+ GT+   + +WVNP     V VT+S     P+ R  D   ++SR+   +S
Sbjct  1084  DFDENGVIYWIGTNGKTSSEWVNPAQYGLVMVTSSDGRNLPYGRLED---ILSRD---SS  1137

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                    D +  +W+ IDLG    L+ + YTIR  +   R+ +R+W FQ S DGVNWT L
Sbjct  1138  ALNCHTND-DRKAWFAIDLGL--WLIPSCYTIRHARGYGRSALRNWLFQVSKDGVNWTTL  1194

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTG  261
               H DD ++ +PG  ASWP+  P +    +R  R+  TG
Sbjct  1195  YTHTDDTSLNEPGSTASWPLDPPLDETQGWRHVRLQQTG  1233



>gb|KFB39857.1| AGAP009511-PA-like protein [Anopheles sinensis]
Length=3042

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 52/147 (35%), Positives = 79/147 (54%), Gaps = 15/147 (10%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQ  558
             Q+  D D NG++YF GT+    +WVNP     V VT+S     P+ +  D   ++SR+  
Sbjct  1154  QHQQDFDENGIIYFIGTNGKTSEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD--  1208

Query  557   GTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNW  384
              +       +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW
Sbjct  1209  -SVSVNCHTKD-NKKSWFAIDLGM--YIIPTAYTLRHARGYGRSALRNWMFQLSKDGVNW  1264

Query  383   TNLRVHKDDQTICKPGQFASWPITGPN  303
                  H DD+++ +PG   +WPI  P+
Sbjct  1265  VTALTHTDDKSLAEPGSTCTWPIDCPS  1291



>emb|CDK13341.1| HECD-1, isoform c [Caenorhabditis elegans]
Length=2607

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1153  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1210

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1211  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1266

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1267  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1322



>emb|CDK13346.1| HECD-1, isoform h [Caenorhabditis elegans]
Length=2609

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1155  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1212

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1213  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1268

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1269  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1324



>emb|CDK13340.1| HECD-1, isoform b [Caenorhabditis elegans]
Length=2611

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1157  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1214

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1215  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1270

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1271  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1326



>emb|CDK13345.1| HECD-1, isoform g [Caenorhabditis elegans]
Length=2613

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1159  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1216

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1217  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1272

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1273  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1328



>emb|CDK13342.1| HECD-1, isoform d [Caenorhabditis elegans]
Length=2644

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1190  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1247

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1248  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1303

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1304  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1359



>emb|CDK13343.1| HECD-1, isoform e [Caenorhabditis elegans]
Length=2646

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1192  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1249

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1250  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1305

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1306  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1361



>emb|CDK13339.1| HECD-1, isoform a [Caenorhabditis elegans]
Length=2648

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1194  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1251

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1252  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1307

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1308  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1363



>emb|CDK13344.1| HECD-1, isoform f [Caenorhabditis elegans]
Length=2650

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1196  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1253

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1254  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1309

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1310  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1365



>ref|XP_001844071.1| E3 ubiquitin-protein ligase HECTD1 [Culex quinquefasciatus]
 gb|EDS35740.1| E3 ubiquitin-protein ligase HECTD1 [Culex quinquefasciatus]
Length=2813

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 54/158 (34%), Positives = 83/158 (53%), Gaps = 16/158 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D NG++YF GT+  + +WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1266  DFDENGIIYFIGTNGKSTEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD---SVS  1319

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW  + 
Sbjct  1320  VNCHTKD-NKKSWFAIDLGM--FIVPTAYTLRHARGYGRSALRNWMFQMSKDGVNWVTML  1376

Query  371   VHKDDQTICKPGQFASWPI-TGPNPLLPFRFFRIVMTG  261
              H DD+++ +PG   +WP+    +    FR  RI   G
Sbjct  1377  THSDDKSLAEPGSTCTWPLECSADEQQGFRHVRIHQNG  1414



>ref|NP_501120.1| Protein HECD-1 [Caenorhabditis elegans]
Length=2761

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 58/178 (33%), Positives = 87/178 (49%), Gaps = 11/178 (6%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGTS-YGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTS  549
             +++ D D NGV+Y+ GT+   A  W NP   K V +T S     F  P+ L+SR+     
Sbjct  1232  RHVSDFDENGVIYWIGTNGRAAPLWTNPATVKAVKITCSDTRQPFGKPEDLLSRD--QNP  1289

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNL  375
                   +D N  + + IDLG    ++   Y++R      R+ +R+W  QGS D   W N+
Sbjct  1290  INCHTSDDKN--AHFTIDLGL--FVVPTSYSLRHSRGYGRSALRNWMLQGSVDAKRWENV  1345

Query  374   RVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
              VH DD+ + +PG  A+W + G      FRFFRI   G  +     +  C    E+YG
Sbjct  1346  IVHTDDKGLGEPGSTATWHV-GEKGTTAFRFFRIAQNGKNSSGQTHYLSC-SGFEIYG  1401



>ref|WP_029637034.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=223

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 88/177 (50%), Gaps = 16/177 (9%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFA  543
            Y  +GD+NG+ YF GT  G   W NP  +  ++++AS   +   D   LV R  Q + F 
Sbjct  60   YASNGDTNGLAYFIGTQEGTVAWQNPH-NNGLSMSASDIAAGTIDS--LVDR--QPSEFY  114

Query  542  GPQVEDGNISSWWMIDLGYDHQLMCNYYTIR-QDGSRAFMRSWNFQGSTDGVNWTNLRVH  366
               +++      W+  +     L CNYY+IR +     ++R+W FQGS DG  W +L V 
Sbjct  115  TSSIDNS-----WVELIISSGSLKCNYYSIRNRSNVDHYLRNWKFQGSNDGSVWADLDVR  169

Query  365  KDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  195
             ++ T+  P Q+ S+PIT  N    FR  +  +   G   +     C+  +ELYG +
Sbjct  170  TNNITLSSPSQWLSFPITTTNFYTQFRLLQNGLNSAGYAYL-----CLGEIELYGTY  221



>gb|ETN62256.1| hect E3 ubiquitin ligase [Anopheles darlingi]
Length=2410

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 76/139 (55%), Gaps = 15/139 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSF  546
             D D NG++YF GT+    +WVNP     V VT+S     P+ +  D   ++SR+   +  
Sbjct  1220  DFDENGIIYFIGTNGKTSEWVNPAQYGLVTVTSSEGKQLPYGKLED---ILSRD---SVS  1273

Query  545   AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLR  372
                  +D N  SW+ IDLG    ++   YT+R  +   R+ +R+W FQ S DGVNW  + 
Sbjct  1274  VNCHTKD-NKKSWFAIDLGM--FIIPTAYTLRHARGYGRSALRNWLFQMSKDGVNWVTML  1330

Query  371   VHKDDQTICKPGQFASWPI  315
              H DD+++ +PG   +WPI
Sbjct  1331  THSDDKSLAEPGSTCTWPI  1349



>ref|XP_004909451.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2562

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864091.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2563

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004909448.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004909449.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
 gb|EHB18581.1| E3 ubiquitin-protein ligase HECTD1 [Heterocephalus glaber]
Length=2609

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007429074.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Python 
bivittatus]
Length=2523

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 60/179 (34%), Positives = 93/179 (52%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004909450.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2607

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864090.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2608

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864088.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004864089.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
Length=2610

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007063755.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Chelonia mydas]
Length=2577

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WPI  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPIDPP  1203



>ref|XP_009004155.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Callithrix 
jacchus]
Length=2331

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWTGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>gb|EMP32200.1| E3 ubiquitin-protein ligase HECTD1 [Chelonia mydas]
Length=2610

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1110  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1164

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1165  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1220

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WPI  P
Sbjct  1221  YTHVDDCSLNEPGSTATWPIDPP  1243



>ref|XP_007429075.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Python 
bivittatus]
Length=2509

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 60/179 (34%), Positives = 93/179 (52%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_009004153.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Callithrix 
jacchus]
Length=2563

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWTGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_007429073.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Python 
bivittatus]
Length=2570

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 60/179 (34%), Positives = 93/179 (52%), Gaps = 18/179 (10%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
               H DD ++ +PG  A+WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>gb|ETN98493.1| E3 ubiquitin-protein ligase HECTD1, partial [Reticulomyxa filosa]
Length=213

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 77/161 (48%), Gaps = 12/161 (7%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            +Y  D D NG+ YF GT+ G  QW NPV  + V V ASS  S       L  R       
Sbjct  60   KYTQDMDFNGLFYFLGTNGGERQWTNPVDLRLVNVDASSLMSDSAPLSALCGRA------  113

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLR  372
            +   V   +  SW  IDL  D ++  ++YT+R   S     +R W  +GS DGV W  LR
Sbjct  114  SVRCVTKPHQKSWMSIDLK-DIKMRLSHYTLRHYNSWDTEALRFWVLEGSDDGVAWIPLR  172

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTD  249
             H DD+ + K G   +WPI        F  FR+ MTG  ++
Sbjct  173  QHADDKALRKSGMTHTWPIETSQ---YFSRFRLFMTGRNSN  210



>gb|ETO19266.1| E3 ubiquitin-protein ligase HECTD1, partial [Reticulomyxa filosa]
Length=537

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 83/177 (47%), Gaps = 14/177 (8%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            +Y  D D NG+ YF GT+ G  QW NPV  + V V ASS  S       L  R       
Sbjct  55   KYGHDLDYNGLFYFLGTNGGERQWSNPVDLELVVVEASSLMSDSVPLSALCGRA------  108

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLR  372
            +   V   +  SW  I+L  D ++   +YT+R   S     +R W  +GS DG+ W  LR
Sbjct  109  SVRCVTKPHQKSWMSINLK-DIKIKLTHYTLRHYNSWDTEALRFWVLEGSDDGIAWIPLR  167

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
             H DD+ + K G   +WP+        F  FR+ MTG  ++  N W      +ELYG
Sbjct  168  QHNDDKALRKAGMTHTWPVETSQ---YFSRFRLFMTGRNSN--NHWYLACSGIELYG  219



>ref|XP_005196337.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bos 
taurus]
Length=1507

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_009004154.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Callithrix 
jacchus]
Length=2549

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWTGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010631867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fukomys 
damarensis]
Length=2331

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_002753836.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
 ref|XP_009004149.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
 ref|XP_009004150.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
 ref|XP_009004151.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
Length=2610

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWTGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_003792055.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Otolemur garnettii]
Length=2538

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NGV+Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGVIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010631866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Fukomys 
damarensis]
Length=2563

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_008162333.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chrysemys 
picta bellii]
Length=2523

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPVDPP  1203



>ref|XP_005196336.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bos 
taurus]
Length=1739

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_009004152.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Callithrix 
jacchus]
Length=2608

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWTGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010333269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Saimiri 
boliviensis boliviensis]
Length=2331

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDTP  1203



>ref|XP_010333268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Saimiri 
boliviensis boliviensis]
Length=2563

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDTP  1203



>ref|XP_009909049.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Picoides pubescens]
Length=2570

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WPI  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPIDPP  1203



>ref|XP_010631864.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fukomys 
damarensis]
 gb|KFO29273.1| E3 ubiquitin-protein ligase HECTD1 [Fukomys damarensis]
Length=2610

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004755203.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Mustela 
putorius furo]
Length=2331

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006056669.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bubalus 
bubalis]
Length=2502

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005695270.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Capra 
hircus]
Length=2502

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010961314.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Camelus 
bactrianus]
Length=2553

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004755201.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Mustela 
putorius furo]
Length=2563

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010631865.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Fukomys 
damarensis]
Length=2608

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006116433.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Pelodiscus 
sinensis]
Length=2523

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPVDPP  1203



>ref|XP_005285367.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chrysemys 
picta bellii]
Length=2509

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPVDPP  1203



>ref|XP_011222356.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Ailuropoda 
melanoleuca]
Length=2331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010845303.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bison 
bison bison]
Length=2331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010372961.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Rhinopithecus 
roxellana]
Length=2331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006056670.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bubalus 
bubalis]
Length=2331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_007098141.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Panthera 
tigris altaica]
Length=2331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005377022.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chinchilla 
lanigera]
Length=2331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006085912.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
lucifugus]
Length=2563

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005881054.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Myotis 
brandtii]
Length=2563

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005285366.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Chrysemys 
picta bellii]
Length=2570

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHTNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPVDPP  1203



>ref|XP_010961316.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Camelus 
bactrianus]
Length=2321

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005881051.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
brandtii]
 ref|XP_006085914.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Myotis 
lucifugus]
Length=2331

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004055105.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Gorilla gorilla 
gorilla]
Length=2520

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1012  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1066

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1067  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1122

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1123  YTHVDDCSLNEPGSTATWPLDPP  1145



>ref|XP_011222354.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ailuropoda 
melanoleuca]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010845301.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bison 
bison bison]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_008972942.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
paniscus]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006056667.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bubalus 
bubalis]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005267560.2| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Homo 
sapiens]
 ref|XP_007984589.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chlorocebus 
sabaeus]
 ref|XP_009247279.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pongo 
abelii]
 ref|XP_009425896.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
troglodytes]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005377019.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chinchilla 
lanigera]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004801249.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Mustela putorius 
furo]
Length=2566

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006056668.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bubalus 
bubalis]
Length=2561

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006085913.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Myotis 
lucifugus]
Length=2561

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005881050.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Myotis 
brandtii]
Length=2561

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005695269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Capra 
hircus]
Length=2561

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005377020.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chinchilla 
lanigera]
Length=2561

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_011374706.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pteropus 
vampyrus]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010586873.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Loxodonta 
africana]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010372959.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Rhinopithecus 
roxellana]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_007098140.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Panthera 
tigris altaica]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005695268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Capra 
hircus]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005222130.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Bos 
taurus]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004467983.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 3 [Dasypus 
novemcinctus]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005222132.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X10 [Bos 
taurus]
Length=2331

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>gb|ETO36723.1| hypothetical protein RFI_00341, partial [Reticulomyxa filosa]
Length=779

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 59/177 (33%), Positives = 90/177 (51%), Gaps = 16/177 (9%)
 Frame = -2

Query  722  YICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDP-KVLVSRNFQGTSF  546
            Y  D D NG+L++  T  G  +W NP LS  VA+ ASS   + +DP   LV R+   T  
Sbjct  591  YDQDFDDNGILWYLATRGGQKEWENPALSDEVALAASS-LVKDSDPLHFLVGRD---TVR  646

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLR  372
               + ED   ++W  +D   D  +  +YYT+R   S     +R+W  Q S DGV+W  ++
Sbjct  647  LVTKAED---NAWMQVDFK-DKLIQPSYYTLRHYSSWDTECLRNWILQASNDGVHWVTVK  702

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
             H+DDQ + + G   +WP+ G      +R +RI  TG  +++     C    +E YG
Sbjct  703  KHEDDQGLNEKGASHTWPVQGRG---AYRIWRIKQTGLNSNKHKYLAC--SGIEFYG  754


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 74/173 (43%), Gaps = 21/173 (12%)
 Frame = -2

Query  707  DSNGVLYFAGTSYGAHQWVNPVLSKRVAVTA--SSPFSRFTDPKVLVSRNFQGTSFAGPQ  534
            D NG+LYF GT  G   + NP     + + +  S P   F   KV+      G S     
Sbjct  387  DENGILYFFGTRGGTKTYENPGTLGMIIINSADSEPVDAFIGRKVVRCVTKPGAS-----  441

Query  533  VEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKD  360
                    W+ +D   D  +  ++YT+R   S     +R+W  +GS DG  W  LR H +
Sbjct  442  -------CWFSVDF-VDKYIKPSHYTLRHYVSWDTECLRNWVIEGSLDGEKWLVLRQHNN  493

Query  359  DQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
            DQ +   GQ  +W +        FR FRI  TGP  +  N +       E+YG
Sbjct  494  DQGLNARGQAFTWALHDYG--CAFRRFRIKQTGPNNN--NHYFLACSGFEVYG  542



>ref|XP_010333267.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Saimiri 
boliviensis boliviensis]
Length=2608

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDTP  1203



>ref|XP_003924275.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010333266.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDTP  1203



>ref|XP_007984591.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chlorocebus 
sabaeus]
 ref|XP_009425898.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Pan 
troglodytes]
Length=2331

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005196334.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
 ref|XP_877459.4| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
Length=1786

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_003288046.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
 gb|EGC35433.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
Length=602

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 93/177 (53%), Gaps = 14/177 (8%)
 Frame = -2

Query  725  QYICDGDSNGVLYFAGTSYGAHQWVNPVLSKRVAVTASSPFSRFTDPKVLVSRNFQGTSF  546
            +Y  D D  G++++  T     +W NP L+ ++ +T+SS         V ++ N    +F
Sbjct  428  EYQYDFDYKGIIFWISTDGNKEKWSNPHLTSKIKITSSSVDKGNLHDIVEITPN----AF  483

Query  545  AGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLR  372
                V     +SW MID+G +  ++ +YYTIR   S     +R+W+FQGST+G  WT L+
Sbjct  484  WTKDVP----ASWVMIDVGPNRSVVPHYYTIRHGLSFKSDSLRTWDFQGSTNGEQWTVLK  539

Query  371  VHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  201
             H +D ++       SWPITG      +R+FRI+ TG  ++  N     I  +E+YG
Sbjct  540  RHTNDLSLNFKYATHSWPITGCET--AYRYFRILQTGKNSNNRN--FLVIGGIEIYG  592



>ref|XP_006116431.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pelodiscus 
sinensis]
Length=2529

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR  + ++
Sbjct  1076  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSA  1130

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1131  LNCHTNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1186

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1187  YTHVDDCSLNEPGSTATWPVDPP  1209



>ref|XP_008267702.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Oryctolagus 
cuniculus]
Length=2331

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005196335.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bos 
taurus]
Length=1784

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_007113428.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Physeter 
catodon]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>gb|ELK17058.1| E3 ubiquitin-protein ligase HECTD1 [Pteropus alecto]
Length=2489

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1033  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1087

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1088  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1143

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1144  YTHVDDCSLNEPGSTATWPLDPP  1166



>ref|XP_008267700.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Oryctolagus 
cuniculus]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_007660814.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ornithorhynchus 
anatinus]
Length=2563

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006766087.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Myotis davidii]
Length=2598

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_008972943.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pan 
paniscus]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_011374705.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Pteropus 
vampyrus]
Length=2608

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004467982.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 2 [Dasypus 
novemcinctus]
Length=2608

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_011374703.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pteropus 
vampyrus]
 ref|XP_011374704.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pteropus 
vampyrus]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_008708622.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Ursus maritimus]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_008565372.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Galeopterus 
variegatus]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIVYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006906925.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Pteropus alecto]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006890036.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Elephantulus edwardii]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004584798.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ochotona princeps]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004467981.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 1 [Dasypus 
novemcinctus]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004421198.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ceratotherium 
simum simum]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004017927.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ovis aries]
 ref|XP_005695267.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Capra 
hircus]
 ref|XP_005961968.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Pantholops hodgsonii]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_003408766.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Loxodonta 
africana]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>sp|Q9ULT8.3|HECD1_HUMAN RecName: Full=E3 ubiquitin-protein ligase HECTD1; AltName: Full=E3 
ligase for inhibin receptor; AltName: Full=EULIR; AltName: 
Full=HECT domain-containing protein 1 [Homo sapiens]
 gb|AAI72391.1| HECT domain containing 1 [synthetic construct]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>gb|AAP13073.1| E3 ligase for inhibin receptor [Homo sapiens]
Length=2612

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1072  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1126

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1127  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1182

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1183  YTHVDDCSLNEPGSTATWPLDPP  1205



>ref|XP_011314687.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Fopius 
arisanus]
Length=2365

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 61/183 (33%), Positives = 92/183 (50%), Gaps = 18/183 (10%)
 Frame = -2

Query  725   QYICDGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNF  561
             QY  D D NGVLY+ GT +  A +WVNP     V VT+S     P+    D   ++SR+ 
Sbjct  1122  QYQNDFDENGVLYWIGTNAKSAPEWVNPGQYGLVVVTSSDGRSLPYGHLED---ILSRDQ  1178

Query  560   QGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVN  387
                +       + +  +W+ IDLG    L+ + YT+R  +   R+ +R+W FQ S DG+N
Sbjct  1179  NALNCH----TNDDKRAWFSIDLGV--WLIPSAYTLRHARGYGRSALRNWMFQVSKDGIN  1232

Query  386   WTNLRVHKDDQTICKPGQFASWPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLE  210
             WT L  H DD ++ +PG  A+W +  P      +R  R+  TG        +   +  LE
Sbjct  1233  WTTLYTHVDDCSLNEPGSTATWTLEAPAEETQGWRHLRLQQTGKNASGQTHY-LSVSGLE  1291

Query  209   LYG  201
             +YG
Sbjct  1292  VYG  1294



>gb|ELW63202.1| E3 ubiquitin-protein ligase HECTD1 [Tupaia chinensis]
Length=2543

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_011222355.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Ailuropoda 
melanoleuca]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010845302.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bison 
bison bison]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010372960.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Rhinopithecus 
roxellana]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_007984590.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Chlorocebus 
sabaeus]
 ref|XP_009247280.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pongo 
abelii]
 ref|XP_009425897.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pan 
troglodytes]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005377021.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Chinchilla 
lanigera]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_005222131.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X9 [Bos 
taurus]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004755202.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Mustela 
putorius furo]
Length=2549

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004637178.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Octodon degus]
Length=2586

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010984469.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Camelus dromedarius]
Length=2597

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010961313.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Camelus 
bactrianus]
Length=2600

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_011222353.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Ailuropoda 
melanoleuca]
Length=2608

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004755200.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Mustela 
putorius furo]
Length=2608

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006152455.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Tupaia chinensis]
Length=2609

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_004755199.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Mustela 
putorius furo]
Length=2609

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_010372956.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Rhinopithecus 
roxellana]
 ref|XP_010372957.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Rhinopithecus 
roxellana]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_002918561.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Ailuropoda 
melanoleuca]
 gb|EFB13214.1| hypothetical protein PANDA_007038 [Ailuropoda melanoleuca]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_007516893.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Erinaceus europaeus]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006056666.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bubalus 
bubalis]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



>ref|XP_006085911.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Myotis 
lucifugus]
Length=2610

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 82/143 (57%), Gaps = 16/143 (11%)
 Frame = -2

Query  713   DGDSNGVLYFAGT-SYGAHQWVNPVLSKRVAVTASS----PFSRFTDPKVLVSRNFQGTS  549
             D D NG++Y+ GT +  A++WVNP     V VT+S     P+ R  D   ++SR+   ++
Sbjct  1070  DFDENGIIYWIGTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSA  1124

Query  548   FAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNL  375
                   +D N  +W+ IDLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L
Sbjct  1125  LNCHSNDDKN--AWFAIDLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSL  1180

Query  374   RVHKDDQTICKPGQFASWPITGP  306
               H DD ++ +PG  A+WP+  P
Sbjct  1181  YTHVDDCSLNEPGSTATWPLDPP  1203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455