BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027D04

Length=746
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364902.1|  PREDICTED: mediator of RNA polymerase II tra...    373   1e-121   Solanum tuberosum [potatoes]
ref|XP_009781829.1|  PREDICTED: mediator of RNA polymerase II tra...    373   2e-121   Nicotiana sylvestris
ref|XP_004251571.1|  PREDICTED: mediator of RNA polymerase II tra...    369   5e-120   Solanum lycopersicum
ref|XP_009601665.1|  PREDICTED: mediator of RNA polymerase II tra...    367   4e-119   Nicotiana tomentosiformis
gb|AIU49750.1|  RNA polymerase II transcription mediator                328   4e-106   Solanum tuberosum [potatoes]
gb|AIU49760.1|  RNA polymerase II transcription mediator                324   1e-104   Solanum lycopersicum
gb|KDO80288.1|  hypothetical protein CISIN_1g006207mg                   325   2e-104   Citrus sinensis [apfelsine]
ref|XP_004300164.1|  PREDICTED: mediator of RNA polymerase II tra...    328   2e-104   Fragaria vesca subsp. vesca
ref|XP_002285089.1|  PREDICTED: mediator of RNA polymerase II tra...    327   5e-104   Vitis vinifera
gb|KDP32381.1|  hypothetical protein JCGZ_13306                         327   6e-104   Jatropha curcas
ref|XP_007013393.1|  RNA polymerase II transcription mediators is...    323   1e-103   Theobroma cacao [chocolate]
ref|XP_006475818.1|  PREDICTED: mediator of RNA polymerase II tra...    325   2e-103   Citrus sinensis [apfelsine]
ref|XP_006450970.1|  hypothetical protein CICLE_v10007689mg             324   8e-103   Citrus clementina [clementine]
ref|XP_008242750.1|  PREDICTED: mediator of RNA polymerase II tra...    323   1e-102   Prunus mume [ume]
ref|XP_007013390.1|  RNA polymerase II transcription mediators is...    323   2e-102   
emb|CDP10383.1|  unnamed protein product                                323   2e-102   Coffea canephora [robusta coffee]
ref|XP_010049981.1|  PREDICTED: mediator of RNA polymerase II tra...    323   3e-102   Eucalyptus grandis [rose gum]
ref|XP_007204608.1|  hypothetical protein PRUPE_ppa002594mg             322   4e-102   Prunus persica
gb|ABK92467.1|  unknown                                                 312   1e-101   Populus trichocarpa [western balsam poplar]
ref|XP_011094122.1|  PREDICTED: mediator of RNA polymerase II tra...    320   2e-101   Sesamum indicum [beniseed]
ref|XP_010093735.1|  hypothetical protein L484_006289                   318   4e-100   
ref|XP_010254371.1|  PREDICTED: mediator of RNA polymerase II tra...    316   1e-99    Nelumbo nucifera [Indian lotus]
ref|XP_006374395.1|  hypothetical protein POPTR_0015s06780g             313   1e-98    
gb|KJB54063.1|  hypothetical protein B456_009G019100                    310   4e-98    Gossypium raimondii
ref|XP_009368825.1|  PREDICTED: mediator of RNA polymerase II tra...    311   5e-98    Pyrus x bretschneideri [bai li]
ref|XP_008337314.1|  PREDICTED: mediator of RNA polymerase II tra...    311   5e-98    
ref|XP_011007274.1|  PREDICTED: mediator of RNA polymerase II tra...    311   1e-97    Populus euphratica
ref|XP_003525658.1|  PREDICTED: mediator of RNA polymerase II tra...    311   1e-97    Glycine max [soybeans]
gb|KJB54064.1|  hypothetical protein B456_009G019100                    309   1e-97    Gossypium raimondii
ref|XP_007154971.1|  hypothetical protein PHAVU_003G161800g             310   2e-97    Phaseolus vulgaris [French bean]
gb|KJB54062.1|  hypothetical protein B456_009G019100                    309   3e-97    Gossypium raimondii
gb|KJB54060.1|  hypothetical protein B456_009G019100                    310   4e-97    Gossypium raimondii
gb|KEH32115.1|  RNA polymerase II transcription mediators protein       304   3e-96    Medicago truncatula
gb|KJB07726.1|  hypothetical protein B456_001G041100                    301   3e-95    Gossypium raimondii
gb|KJB07727.1|  hypothetical protein B456_001G041100                    302   3e-95    Gossypium raimondii
gb|AES91489.2|  RNA polymerase II transcription mediators protein       303   7e-95    Medicago truncatula
gb|AIU49742.1|  RNA polymerase II transcription mediator                298   2e-94    Chimonanthus praecox [wintersweet]
gb|AIU49735.1|  RNA polymerase II transcription mediator                298   2e-94    Eucalyptus grandis [rose gum]
gb|KHG17744.1|  mediator of rna polymerase ii transcription subun...    302   2e-94    Gossypium arboreum [tree cotton]
gb|AIU49763.1|  RNA polymerase II transcription mediator                298   2e-94    Vitis vinifera
gb|KJB07721.1|  hypothetical protein B456_001G041100                    302   3e-94    Gossypium raimondii
gb|AIU49752.1|  RNA polymerase II transcription mediator                297   5e-94    Prunus persica
gb|AIU49734.1|  RNA polymerase II transcription mediator                297   5e-94    Citrus sinensis [apfelsine]
gb|AIU49730.1|  RNA polymerase II transcription mediator                296   2e-93    Citrus clementina [clementine]
gb|AIU49732.1|  RNA polymerase II transcription mediator                291   2e-93    Carica papaya [mamon]
gb|AIU49727.1|  RNA polymerase II transcription mediator                295   3e-93    Theobroma cacao [chocolate]
gb|AIU49738.1|  RNA polymerase II transcription mediator                292   4e-93    Buxus sinica
ref|XP_004508515.1|  PREDICTED: mediator of RNA polymerase II tra...    298   1e-92    
gb|AIU49767.1|  RNA polymerase II transcription mediator                294   1e-92    Platanus x hispanica [London plane tree]
ref|XP_003549778.1|  PREDICTED: mediator of RNA polymerase II tra...    297   2e-92    Glycine max [soybeans]
ref|XP_003609292.1|  hypothetical protein MTR_4g114100                  301   2e-92    
gb|KJB07723.1|  hypothetical protein B456_001G041100                    297   3e-92    Gossypium raimondii
gb|AIU49729.1|  RNA polymerase II transcription mediator                289   9e-91    Sarcandra glabra
gb|AIU49766.1|  RNA polymerase II transcription mediator                286   1e-89    Cinnamomum camphora
ref|XP_007013392.1|  RNA polymerase II transcription mediators is...    286   1e-89    
gb|AIU49751.1|  RNA polymerase II transcription mediator                284   6e-89    Populus trichocarpa [western balsam poplar]
gb|AIU49731.1|  RNA polymerase II transcription mediator                284   6e-89    Gossypium raimondii
ref|XP_004141551.1|  PREDICTED: mediator of RNA polymerase II tra...    288   7e-89    Cucumis sativus [cucumbers]
gb|AIU49748.1|  RNA polymerase II transcription mediator                283   1e-88    Manihot esculenta [manioc]
ref|XP_008459609.1|  PREDICTED: mediator of RNA polymerase II tra...    286   2e-88    Cucumis melo [Oriental melon]
gb|AIU49740.1|  RNA polymerase II transcription mediator                282   4e-88    Chloranthus japonicus
ref|XP_010688034.1|  PREDICTED: mediator of RNA polymerase II tra...    285   5e-88    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU49723.1|  RNA polymerase II transcription mediator                277   2e-86    Magnolia denudata [haku-mokuren]
gb|EYU29301.1|  hypothetical protein MIMGU_mgv1a002570mg                281   3e-86    Erythranthe guttata [common monkey flower]
gb|AIU49754.1|  RNA polymerase II transcription mediator                276   6e-86    Phaseolus vulgaris [French bean]
gb|AIU49746.1|  RNA polymerase II transcription mediator                274   6e-85    Medicago truncatula
gb|AIU49736.1|  RNA polymerase II transcription mediator                273   8e-85    Glycine max [soybeans]
ref|XP_008809755.1|  PREDICTED: mediator of RNA polymerase II tra...    274   1e-84    
gb|AIU49743.1|  RNA polymerase II transcription mediator                265   3e-84    Pandanus utilis
gb|AIU49749.1|  RNA polymerase II transcription mediator                271   7e-84    Erythranthe guttata [common monkey flower]
gb|AIU49719.1|  RNA polymerase II transcription mediator                271   8e-84    Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_010910117.1|  PREDICTED: mediator of RNA polymerase II tra...    275   1e-83    Elaeis guineensis
ref|XP_008809751.1|  PREDICTED: mediator of RNA polymerase II tra...    275   1e-83    Phoenix dactylifera
gb|AIU49737.1|  RNA polymerase II transcription mediator                267   3e-82    Illicium henryi
ref|XP_010520586.1|  PREDICTED: mediator of RNA polymerase II tra...    266   2e-80    Tarenaya hassleriana [spider flower]
ref|XP_010520585.1|  PREDICTED: mediator of RNA polymerase II tra...    266   2e-80    Tarenaya hassleriana [spider flower]
gb|AIU49772.1|  RNA polymerase II transcription mediator                260   3e-80    Trachycarpus fortunei
gb|KFK26261.1|  hypothetical protein AALP_AA8G224100                    264   6e-80    Arabis alpina [alpine rockcress]
gb|AIU49728.1|  RNA polymerase II transcription mediator                259   2e-79    Acorus calamus [flagroot]
ref|XP_010420857.1|  PREDICTED: mediator of RNA polymerase II tra...    259   6e-79    
gb|AIU49764.1|  RNA polymerase II transcription mediator                252   8e-79    Lactuca sativa [cultivated lettuce]
ref|XP_009131782.1|  PREDICTED: mediator of RNA polymerase II tra...    261   1e-78    Brassica rapa
ref|XP_010493125.1|  PREDICTED: mediator of RNA polymerase II tra...    260   2e-78    Camelina sativa [gold-of-pleasure]
ref|NP_197517.3|  RNA polymerase II transcription mediator              260   3e-78    Arabidopsis thaliana [mouse-ear cress]
emb|CDX88852.1|  BnaA03g07970D                                          259   4e-78    
ref|XP_010420856.1|  PREDICTED: mediator of RNA polymerase II tra...    259   8e-78    Camelina sativa [gold-of-pleasure]
ref|XP_006400585.1|  hypothetical protein EUTSA_v10012923mg             258   9e-78    Eutrema salsugineum [saltwater cress]
ref|XP_006286416.1|  hypothetical protein CARUB_v10002972mg             258   2e-77    Capsella rubella
emb|CDX70919.1|  BnaC03g10030D                                          258   2e-77    
ref|XP_010454320.1|  PREDICTED: mediator of RNA polymerase II tra...    258   2e-77    Camelina sativa [gold-of-pleasure]
gb|AIU49758.1|  RNA polymerase II transcription mediator                253   4e-77    Yucca filamentosa [Adam's-needle]
gb|AFW79767.1|  hypothetical protein ZEAMMB73_523859                    246   7e-77    
ref|XP_006842865.1|  hypothetical protein AMTR_s00081p00160620          256   7e-77    Amborella trichopoda
gb|AIU49769.1|  RNA polymerase II transcription mediator                252   1e-76    Houttuynia cordata [chameleon-plant]
gb|AIU49771.1|  RNA polymerase II transcription mediator                243   1e-76    Alisma plantago-aquatica
ref|XP_008354374.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    254   2e-76    
ref|XP_002873986.1|  hypothetical protein ARALYDRAFT_351112             252   2e-75    
gb|AIU49725.1|  RNA polymerase II transcription mediator                242   4e-75    Pinellia ternata
gb|AIU49721.1|  RNA polymerase II transcription mediator                247   1e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008654792.1|  PREDICTED: uncharacterized protein LOC100279...    248   1e-74    Zea mays [maize]
gb|EPS70468.1|  hypothetical protein M569_04289                         248   3e-74    Genlisea aurea
gb|AIU49762.1|  RNA polymerase II transcription mediator                244   1e-73    Schrenkiella parvula
gb|AIU49733.1|  RNA polymerase II transcription mediator                244   1e-73    Capsella rubella
gb|AIU49745.1|  RNA polymerase II transcription mediator                244   2e-73    Aristolochia tagala
ref|NP_001145828.1|  uncharacterized protein LOC100279335               247   2e-73    Zea mays [maize]
ref|XP_006664786.1|  PREDICTED: mediator of RNA polymerase II tra...    245   3e-73    
ref|XP_004967947.1|  PREDICTED: mediator of RNA polymerase II tra...    246   4e-73    Setaria italica
gb|EEE53678.1|  hypothetical protein OsJ_37013                          246   7e-73    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067381.1|  Os12g0638600                                       245   1e-72    
gb|AIU49747.1|  RNA polymerase II transcription mediator                241   4e-72    Canna indica [canna]
ref|XP_003569428.1|  PREDICTED: mediator of RNA polymerase II tra...    243   7e-72    
ref|XP_002457523.1|  hypothetical protein SORBIDRAFT_03g008700          242   3e-71    Sorghum bicolor [broomcorn]
gb|AIU49720.1|  RNA polymerase II transcription mediator                238   3e-71    Arabidopsis lyrata [lyrate rockcress]
gb|AIU49741.1|  RNA polymerase II transcription mediator                238   4e-71    Ceratophyllum demersum [hornwort]
gb|AIU49759.1|  RNA polymerase II transcription mediator                237   1e-70    Setaria italica
gb|AIU49770.1|  RNA polymerase II transcription mediator                236   1e-70    Zea mays [maize]
gb|AIU49757.1|  RNA polymerase II transcription mediator                235   3e-70    Dioscorea oppositifolia
gb|AIU49726.1|  RNA polymerase II transcription mediator                235   4e-70    Brachypodium distachyon [annual false brome]
gb|AIU49761.1|  RNA polymerase II transcription mediator                233   2e-69    Sorghum bicolor [broomcorn]
gb|AIU49773.1|  RNA polymerase II transcription mediator                229   6e-69    Cabomba caroliniana
ref|XP_008679946.1|  PREDICTED: mediator of RNA polymerase II tra...    233   7e-69    
gb|KJB07724.1|  hypothetical protein B456_001G041100                    234   7e-69    Gossypium raimondii
ref|NP_001288373.1|  mediator of RNA polymerase II transcription ...    232   8e-68    Zea mays [maize]
dbj|BAK07358.1|  predicted protein                                      228   1e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS61166.1|  hypothetical protein TRIUR3_03686                       230   1e-67    Triticum urartu
ref|XP_010232920.1|  PREDICTED: serine/threonine-protein kinase ATM     239   1e-67    
gb|AIU49744.1|  RNA polymerase II transcription mediator                227   4e-67    Asparagus officinalis
ref|XP_009389497.1|  PREDICTED: mediator of RNA polymerase II tra...    230   8e-67    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT09196.1|  hypothetical protein F775_08586                         228   3e-66    
gb|AIU49753.1|  RNA polymerase II transcription mediator                225   4e-66    Panicum virgatum
gb|AIU49739.1|  RNA polymerase II transcription mediator                224   6e-66    Iris japonica
gb|AIU49724.1|  RNA polymerase II transcription mediator                218   2e-63    Musa acuminata [banana]
gb|AIU49768.1|  RNA polymerase II transcription mediator                214   3e-62    Ginkgo biloba [ginkgo]
gb|AIU49722.1|  RNA polymerase II transcription mediator                213   5e-62    Lilium brownii [Hong Kong lily]
dbj|BAK08012.1|  predicted protein                                      214   2e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93746.1|  predicted protein                                      213   3e-61    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20869.1|  hypothetical protein F775_22791                         211   2e-60    
ref|XP_002524467.1|  hypothetical protein RCOM_0221540                  202   1e-58    Ricinus communis
gb|KCW82816.1|  hypothetical protein EUGRSUZ_C04186                     192   2e-53    Eucalyptus grandis [rose gum]
gb|AIU49756.1|  RNA polymerase II transcription mediator                183   4e-52    Ricinus communis
gb|KJB07725.1|  hypothetical protein B456_001G041100                    183   4e-50    Gossypium raimondii
gb|KJB07722.1|  hypothetical protein B456_001G041100                    183   7e-50    Gossypium raimondii
ref|XP_007013395.1|  RNA polymerase II transcription mediators is...    149   9e-38    
gb|AIU49755.1|  RNA polymerase II transcription mediator                129   3e-34    Artemisia annua [sweet Annie]
gb|KHN46923.1|  hypothetical protein glysoja_031223                     119   2e-27    Glycine soja [wild soybean]
ref|XP_002980116.1|  hypothetical protein SELMODRAFT_419660             112   2e-24    
ref|XP_002991906.1|  hypothetical protein SELMODRAFT_430185             112   3e-24    
gb|ACF79783.1|  unknown                                               76.3    3e-14    Zea mays [maize]
ref|XP_001782525.1|  predicted protein                                79.3    2e-13    



>ref|XP_006364902.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Solanum tuberosum]
Length=663

 Score =   373 bits (957),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 178/224 (79%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGPNLL HFC+SLAHRIFSNKVLAELE LVSR PYV+LISHPTWHSRTSSWTL M VP+
Sbjct  423  KDGPNLLGHFCVSLAHRIFSNKVLAELESLVSRIPYVQLISHPTWHSRTSSWTLSMDVPE  482

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SIL+AG+  H+S   KNVK  FRTKV V DDCIS+EGEGAPNVVGLFKGK + TC +NRY
Sbjct  483  SILHAGSLSHSSDYVKNVKFHFRTKVMVRDDCISLEGEGAPNVVGLFKGKPDSTCPMNRY  542

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            DCDL+DLP +LLQQVASQVIRWL EEALMVGIKANRDFLSL FELEQGET+ LVAH+DP+
Sbjct  543  DCDLSDLPMVLLQQVASQVIRWLHEEALMVGIKANRDFLSLSFELEQGETLSLVAHVDPE  602

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            D  GCISWWLVM DG+S+ENKLK+D+++GESE RKFLGYLSL V
Sbjct  603  DIQGCISWWLVMGDGFSEENKLKMDVNSGESETRKFLGYLSLEV  646



>ref|XP_009781829.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Nicotiana sylvestris]
Length=671

 Score =   373 bits (957),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 199/225 (88%), Gaps = 0/225 (0%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            TKDGPNLL HFC+SLAHRIFSNKVLAELE LVSR PYV+LISHP+WHSR SSWTL MKVP
Sbjct  430  TKDGPNLLGHFCVSLAHRIFSNKVLAELESLVSRIPYVQLISHPSWHSRRSSWTLSMKVP  489

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
             SIL+AG+  H+S   KNVKS FRTKV V DDCIS+EGEGAPNVVGLFKGK ++TC +NR
Sbjct  490  DSILHAGSLSHSSDYVKNVKSHFRTKVMVRDDCISLEGEGAPNVVGLFKGKPDITCPMNR  549

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            YDCDL+DLP ILLQQVASQVIRWL EEALMVGIKANRDFLSL FELEQGET+ LVAH+DP
Sbjct  550  YDCDLSDLPMILLQQVASQVIRWLHEEALMVGIKANRDFLSLSFELEQGETLCLVAHVDP  609

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +D  GCISWWLVM+D +S+E+KL +DI+NGESE RKFLGYLSL V
Sbjct  610  EDLQGCISWWLVMDDEFSEESKLNMDINNGESETRKFLGYLSLEV  654



>ref|XP_004251571.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Solanum lycopersicum]
Length=663

 Score =   369 bits (946),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 197/224 (88%), Gaps = 0/224 (0%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGPNLL HFC+SLAHRIFSNKVLAELE LVSR PYV+LISHPTWHSRTSSWTL M VP+
Sbjct  423  KDGPNLLGHFCVSLAHRIFSNKVLAELESLVSRVPYVQLISHPTWHSRTSSWTLSMDVPE  482

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SIL+AG+  H+S   KNVK  FRTKV V DDCIS+EGEGAPN+VGLFKGK +  C +NRY
Sbjct  483  SILHAGSLSHSSDYVKNVKFHFRTKVMVRDDCISLEGEGAPNIVGLFKGKPDSICPMNRY  542

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            DCDL+DLP +LLQQVASQVIRWL EEALMVGIKANRDFLSL FELEQGET+ LVAH+DP+
Sbjct  543  DCDLSDLPMVLLQQVASQVIRWLHEEALMVGIKANRDFLSLSFELEQGETLSLVAHVDPE  602

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            D  GCISWWLVM DG+S+ENKL++D+++GESE RKFLGYLSL V
Sbjct  603  DIQGCISWWLVMGDGFSEENKLQMDVNSGESETRKFLGYLSLEV  646



>ref|XP_009601665.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Nicotiana tomentosiformis]
Length=668

 Score =   367 bits (941),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/225 (79%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            TKDGPNLL HFC+SLAHRIFSNKVLAELE LVSR PYV+LISHP+WHSR SSWTL M VP
Sbjct  427  TKDGPNLLGHFCVSLAHRIFSNKVLAELESLVSRIPYVQLISHPSWHSRRSSWTLSMIVP  486

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
             SIL+AG+  H+S   KNVKS FRTKV V DDCIS+EGEGAPN+VGLFKGK + TC +NR
Sbjct  487  DSILHAGSLSHSSDYVKNVKSHFRTKVMVRDDCISLEGEGAPNLVGLFKGKPDSTCPMNR  546

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            YDCDL+DLP ILLQQVASQVIRWL EEALMVGIKANRDFLSL FELEQGET+ LVAH+DP
Sbjct  547  YDCDLSDLPMILLQQVASQVIRWLHEEALMVGIKANRDFLSLSFELEQGETLCLVAHVDP  606

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +D  GCISWWLVM DG+ +E+KL +DI+NGESE RKFLGYLSL V
Sbjct  607  EDLQGCISWWLVMNDGFCEESKLNMDINNGESETRKFLGYLSLEV  651



>gb|AIU49750.1| RNA polymerase II transcription mediator, partial [Solanum tuberosum]
Length=516

 Score =   328 bits (842),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 180/222 (81%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            GPNLL HFC+SLAHRIFSNKVLAELE LVSR PYV+LISHPTWHSRTSSWTL M VP+SI
Sbjct  304  GPNLLGHFCVSLAHRIFSNKVLAELESLVSRIPYVQLISHPTWHSRTSSWTLSMDVPESI  363

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+AG            K  FRTKV V DDCIS+EGEGAPNVVGLFKGK + TC +NRYDC
Sbjct  364  LHAG------------KFHFRTKVMVRDDCISLEGEGAPNVVGLFKGKPDSTCPMNRYDC  411

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL+DLP +LLQQVASQVIRWL EEALMVGIKANRDFLSL FELEQGET+ LVAH+DP+D 
Sbjct  412  DLSDLPMVLLQQVASQVIRWLHEEALMVGIKANRDFLSLSFELEQGETLSLVAHVDPEDI  471

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLVM DG  +ENKLK+D        RKFLGYLSL V
Sbjct  472  QGCISWWLVMGDG--EENKLKMD--------RKFLGYLSLEV  503



>gb|AIU49760.1| RNA polymerase II transcription mediator, partial [Solanum lycopersicum]
Length=516

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 179/222 (81%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            GPNLL HFC+SLAHRIFSNKVLAELE LVSR PYV+LISHPTWHSRTSSWTL M VP+SI
Sbjct  304  GPNLLGHFCVSLAHRIFSNKVLAELESLVSRVPYVQLISHPTWHSRTSSWTLSMDVPESI  363

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+AG            K  FRTKV V DDCIS+EGEGAPN+VGLFKGK +  C +NRYDC
Sbjct  364  LHAG------------KFHFRTKVMVRDDCISLEGEGAPNIVGLFKGKPDSICPMNRYDC  411

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL+DLP +LLQQVASQVIRWL EEALMVGIKANRDFLSL FELEQGET+ LVAH+DP+D 
Sbjct  412  DLSDLPMVLLQQVASQVIRWLHEEALMVGIKANRDFLSLSFELEQGETLSLVAHVDPEDI  471

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLVM DG  +ENKL++D        RKFLGYLSL V
Sbjct  472  QGCISWWLVMGDG--EENKLQMD--------RKFLGYLSLEV  503



>gb|KDO80288.1| hypothetical protein CISIN_1g006207mg [Citrus sinensis]
Length=546

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            TKDG  LL HFC+SLAHRIFSNKV  ELE  V   PY+ L+SHPTWHSRTSSWT+ +KVP
Sbjct  308  TKDGSGLLGHFCLSLAHRIFSNKVHVELENAVCGVPYLHLVSHPTWHSRTSSWTVFLKVP  367

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            QSIL+A +    S   +  KS FRT V V DDCI VEGEG PNVVGLFKG+SE   S+N+
Sbjct  368  QSILHAESN---SRTAETAKSHFRTNVVVNDDCIHVEGEGTPNVVGLFKGRSEDMSSMNK  424

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            YDCDLADLP I+LQQVASQVIRWL EEALMVGIKANRDFLSL FEL+QGETV LVAH+DP
Sbjct  425  YDCDLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLSLSFELDQGETVSLVAHVDP  484

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +D  GCISWWLVMEDG++ E KL +DIS+  S+ +KFLG+LSL V
Sbjct  485  EDMRGCISWWLVMEDGFAAERKLSIDISDDASDYKKFLGHLSLDV  529



>ref|XP_004300164.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Fragaria vesca subsp. vesca]
Length=655

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 187/227 (82%), Gaps = 2/227 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K+G  LL HFCMSLAHRIFSNKVL ELE +V   PY++L SHPTWHSRTSSWTL++K+P
Sbjct  412  AKEGSGLLGHFCMSLAHRIFSNKVLMELENVVRGVPYMQLTSHPTWHSRTSSWTLVVKIP  471

Query  566  QSILNAGN-EIHASYLDKNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            QSIL+A    +  S+  K+V KSQF TKV V DDCI+++GEGAPNVVGLFKG S+  CS+
Sbjct  472  QSILHACQIRVSDSHHTKHVTKSQFHTKVVVTDDCINIDGEGAPNVVGLFKGTSQEVCSM  531

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            NRYDCDLADL  I+LQQVASQVIRWL EEALMVG+KAN DFL L FELEQGET+ LVAH+
Sbjct  532  NRYDCDLADLSVIILQQVASQVIRWLHEEALMVGLKANWDFLCLSFELEQGETLSLVAHV  591

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  GCISWWLVMEDG+ +E KL +DIS+G SE RKFLG+LSL V
Sbjct  592  DPEDTEGCISWWLVMEDGFVEERKLNIDISDGASESRKFLGHLSLEV  638



>ref|XP_002285089.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Vitis vinifera]
 emb|CAN63500.1| hypothetical protein VITISV_011675 [Vitis vinifera]
 emb|CBI28174.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   327 bits (839),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 184/228 (81%), Gaps = 3/228 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             KDG  LL HFCMSLAHRIFS+KVL ELE LVSR PY+ L+SHPTWHSRTSSWTLLMKVP
Sbjct  415  AKDGFGLLGHFCMSLAHRIFSSKVLMELENLVSRVPYLHLLSHPTWHSRTSSWTLLMKVP  474

Query  566  QSILNAGNEIHASYLD--KNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCS  396
            +S  + G +   S +   KN+ K+ FRTKV + DDCI+VEG+GAPNVVGLFKG SE  CS
Sbjct  475  ESSFHPGCQTRTSDIHNVKNIIKTHFRTKVVINDDCINVEGDGAPNVVGLFKGSSEDVCS  534

Query  395  INRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAH  216
            +NRYDCDLAD+P ILLQQVASQVIRWL EEAL VGIKANRDFL L FE++QGE + LVAH
Sbjct  535  MNRYDCDLADIPVILLQQVASQVIRWLHEEALKVGIKANRDFLCLSFEMDQGEMLSLVAH  594

Query  215  IDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ++P DP GCISWWLVM+DG+S++ K   D  +G SE RKFLG+LSL V
Sbjct  595  VNPDDPQGCISWWLVMDDGFSEDLKFHTDAPDGGSEYRKFLGHLSLEV  642



>gb|KDP32381.1| hypothetical protein JCGZ_13306 [Jatropha curcas]
Length=664

 Score =   327 bits (838),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 186/227 (82%), Gaps = 4/227 (2%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDG  LL HFCM++AHRIFSNKVL ELE ++ + PY+ LISHPTWHSRTSSWT+ MKVPQ
Sbjct  421  KDGSGLLGHFCMTVAHRIFSNKVLMELENVICKVPYLHLISHPTWHSRTSSWTIFMKVPQ  480

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A +    S    +  ++K++FRTKV V DD I+VE EGAPNVVGLFKG S+ TCS+
Sbjct  481  SILHASSHSQTSDMKSMKSDIKTEFRTKVVVNDDSINVEAEGAPNVVGLFKGSSDDTCSM  540

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+YDCDLADLPAI+LQQVASQVIRWL EEAL VGIKANRDFLSL FEL+QGE + +VAH+
Sbjct  541  NKYDCDLADLPAIILQQVASQVIRWLHEEALTVGIKANRDFLSLSFELDQGEVLSMVAHV  600

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  GCISWWLVMEDG++ E KL +DI++  SE RKFLGYL L V
Sbjct  601  DPEDVEGCISWWLVMEDGFA-EKKLHMDIADDASECRKFLGYLPLDV  646



>ref|XP_007013393.1| RNA polymerase II transcription mediators isoform 4 [Theobroma 
cacao]
 gb|EOY31012.1| RNA polymerase II transcription mediators isoform 4 [Theobroma 
cacao]
Length=556

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 185/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            K G  LL HF +SLAHRIFSN+VL +LE +V R PY+ L++HPTWHSRTSSWT+ MKVPQ
Sbjct  312  KVGSGLLGHFSLSLAHRIFSNRVLMKLENVVCRVPYLHLMTHPTWHSRTSSWTIFMKVPQ  371

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+  ++   S    +   +KSQFRTKV V DD I+VEGEGAPNVVGLFK  SE  CS+
Sbjct  372  SILHVESQSQKSDFQNMKDAIKSQFRTKVVVNDDRINVEGEGAPNVVGLFKRSSEDICSV  431

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+YDCDLADLP I+LQQVASQVIRWL EEALMVGIK NRDFL L FELEQGETV LVAH+
Sbjct  432  NKYDCDLADLPVIILQQVASQVIRWLHEEALMVGIKTNRDFLCLTFELEQGETVSLVAHV  491

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  GCISWWLVMEDG++++ KL++D+S+G SE RKFLG+LSL V
Sbjct  492  DPEDIQGCISWWLVMEDGFAEDWKLQMDMSDGASEYRKFLGHLSLDV  538



>ref|XP_006475818.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Citrus sinensis]
 gb|KDO80287.1| hypothetical protein CISIN_1g006207mg [Citrus sinensis]
Length=657

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            TKDG  LL HFC+SLAHRIFSNKV  ELE  V   PY+ L+SHPTWHSRTSSWT+ +KVP
Sbjct  419  TKDGSGLLGHFCLSLAHRIFSNKVHVELENAVCGVPYLHLVSHPTWHSRTSSWTVFLKVP  478

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            QSIL+A +    S   +  KS FRT V V DDCI VEGEG PNVVGLFKG+SE   S+N+
Sbjct  479  QSILHAESN---SRTAETAKSHFRTNVVVNDDCIHVEGEGTPNVVGLFKGRSEDMSSMNK  535

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            YDCDLADLP I+LQQVASQVIRWL EEALMVGIKANRDFLSL FEL+QGETV LVAH+DP
Sbjct  536  YDCDLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLSLSFELDQGETVSLVAHVDP  595

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +D  GCISWWLVMEDG++ E KL +DIS+  S+ +KFLG+LSL V
Sbjct  596  EDMRGCISWWLVMEDGFAAERKLSIDISDDASDYKKFLGHLSLDV  640



>ref|XP_006450970.1| hypothetical protein CICLE_v10007689mg [Citrus clementina]
 gb|ESR64210.1| hypothetical protein CICLE_v10007689mg [Citrus clementina]
Length=657

 Score =   324 bits (831),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 181/225 (80%), Gaps = 3/225 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            TKDG  LL HFC+SLAHRIFSNKV  ELE  V   PY+ L+SHPTWHSRTSSWT+ +KVP
Sbjct  419  TKDGSGLLGHFCLSLAHRIFSNKVRVELENAVCGVPYLHLVSHPTWHSRTSSWTVFLKVP  478

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            QSIL+A +    S   +  KS FRT V V DDCI VEGEG PNVVGLF+G+SE   S+N+
Sbjct  479  QSILHAESN---SRTAETAKSHFRTNVVVNDDCIHVEGEGTPNVVGLFEGRSEDMSSMNK  535

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            YDCDLADLP I+LQQVASQVIRWL EEALMVGIKANRDFLSL FEL+QGETV LVAH+DP
Sbjct  536  YDCDLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLSLSFELDQGETVSLVAHVDP  595

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +D  GCISWWLVMEDG++ E KL +DIS+  S+ +KFLG+LSL V
Sbjct  596  EDMRGCISWWLVMEDGFAAERKLSIDISDDASDYKKFLGHLSLDV  640



>ref|XP_008242750.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Prunus mume]
Length=654

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 182/227 (80%), Gaps = 2/227 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K+GP LL HFCMSLAHRIFSNKVL ELE +V   PY++L+SHPTWHSRTSSW L +K+P
Sbjct  411  AKEGPGLLGHFCMSLAHRIFSNKVLKELENVVKGVPYLQLLSHPTWHSRTSSWMLFVKIP  470

Query  566  QSILNAGNEIHAS--YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            +SIL+A     +   ++    KSQF TKV V DDCI+VEGEGAPNVVGLFKG SE  CS+
Sbjct  471  ESILHACQTRTSDMRHMRNITKSQFHTKVVVTDDCINVEGEGAPNVVGLFKGNSEEICSM  530

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            NRYDCDLADLP I+LQQVASQVIRWL EEALMVGIKANRDFL L FEL+ GET+ LVAH+
Sbjct  531  NRYDCDLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLCLSFELDLGETLSLVAHV  590

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  GCISWWLV++ G+ +E  L +D S+G SE RKFLG+LSL V
Sbjct  591  DPEDGEGCISWWLVIDGGFVEERNLSMDASDGASESRKFLGHLSLEV  637



>ref|XP_007013390.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
 ref|XP_007013391.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
 gb|EOY31009.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
 gb|EOY31010.1| RNA polymerase II transcription mediators isoform 1 [Theobroma 
cacao]
Length=663

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 185/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            K G  LL HF +SLAHRIFSN+VL +LE +V R PY+ L++HPTWHSRTSSWT+ MKVPQ
Sbjct  419  KVGSGLLGHFSLSLAHRIFSNRVLMKLENVVCRVPYLHLMTHPTWHSRTSSWTIFMKVPQ  478

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+  ++   S    +   +KSQFRTKV V DD I+VEGEGAPNVVGLFK  SE  CS+
Sbjct  479  SILHVESQSQKSDFQNMKDAIKSQFRTKVVVNDDRINVEGEGAPNVVGLFKRSSEDICSV  538

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+YDCDLADLP I+LQQVASQVIRWL EEALMVGIK NRDFL L FELEQGETV LVAH+
Sbjct  539  NKYDCDLADLPVIILQQVASQVIRWLHEEALMVGIKTNRDFLCLTFELEQGETVSLVAHV  598

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  GCISWWLVMEDG++++ KL++D+S+G SE RKFLG+LSL V
Sbjct  599  DPEDIQGCISWWLVMEDGFAEDWKLQMDMSDGASEYRKFLGHLSLDV  645



>emb|CDP10383.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 184/227 (81%), Gaps = 2/227 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             KD  NLL HFC+SLAHRIFS +VL ELE LV   PYV L+SHPTWHSRTSSWTL + +P
Sbjct  421  AKDSFNLLGHFCLSLAHRIFSIRVLTELENLVRGIPYVHLMSHPTWHSRTSSWTLSINIP  480

Query  566  QSILNAGNEIHASYLD--KNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            Q I  AGN+   S L   K++KSQ+ TKV V DDCI+VEGEGAP VVGLFKGKSE    +
Sbjct  481  QPISLAGNQAQVSALTHIKSLKSQYWTKVLVNDDCITVEGEGAPKVVGLFKGKSETISPM  540

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            NRY+C+LADLP ILLQQVASQVI WL +EAL VGIKANRDFLSL FEL+QGE + LV+HI
Sbjct  541  NRYNCELADLPLILLQQVASQVISWLHDEALTVGIKANRDFLSLSFELDQGELLSLVSHI  600

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  GCISWWLVMEDG+++E+KL++DISN ESE RKFLG+LSL V
Sbjct  601  DPEDAEGCISWWLVMEDGFTEEHKLRMDISNSESETRKFLGHLSLDV  647



>ref|XP_010049981.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Eucalyptus grandis]
 gb|KCW82815.1| hypothetical protein EUGRSUZ_C04186 [Eucalyptus grandis]
Length=651

 Score =   323 bits (827),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 181/223 (81%), Gaps = 1/223 (0%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K G  LL HFCMSLAHRIFSNKVL EL+ +V R PY+ L+S P WHSRTSSWTL MKVP
Sbjct  410  AKAGSGLLGHFCMSLAHRIFSNKVLMELDNVVCRVPYLHLMSQPCWHSRTSSWTLYMKVP  469

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            +SIL+A  +   +   K++K+QFRTK+ V DDCI VEGEGAPNVVGLFKG +E   SINR
Sbjct  470  ESILHACCQKDVNKA-KHIKTQFRTKIVVTDDCIKVEGEGAPNVVGLFKGTAEDISSINR  528

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            YDCDLADLP I+LQQVASQVIRWL EEALMVGIKA RDFL L FELEQGE +GL+A +DP
Sbjct  529  YDCDLADLPVIILQQVASQVIRWLHEEALMVGIKATRDFLCLSFELEQGEMLGLLAQVDP  588

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            +DP GCISWWLVM+DG+SDE KL++D S+  +E RK LG+LSL
Sbjct  589  EDPCGCISWWLVMDDGFSDERKLQMDYSDNGNEYRKSLGHLSL  631



>ref|XP_007204608.1| hypothetical protein PRUPE_ppa002594mg [Prunus persica]
 gb|EMJ05807.1| hypothetical protein PRUPE_ppa002594mg [Prunus persica]
Length=654

 Score =   322 bits (826),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 181/227 (80%), Gaps = 2/227 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K+GP LL HFCMSLAHRIFSNKVL ELE +V   PY++L+SHPTWHSRTSSW L +K+P
Sbjct  411  AKEGPGLLGHFCMSLAHRIFSNKVLKELENVVKGVPYLQLLSHPTWHSRTSSWMLFVKIP  470

Query  566  QSILNAGNEIHAS--YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            +SIL+A     +   ++    KSQF TKV V DDCI+VEGEGAPNVVGLFKG SE  C +
Sbjct  471  ESILHACQTRTSDMRHMRNITKSQFHTKVVVTDDCINVEGEGAPNVVGLFKGNSEEICLM  530

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            NRYDCDLADLP I+LQQVASQVIRWL EEALMVGIKANRDFL L FEL+ GET+ LVAH+
Sbjct  531  NRYDCDLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLCLSFELDLGETLSLVAHV  590

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  GCISWWLV+  G+ +E KL +D S+G SE RKFLG+LSL V
Sbjct  591  DPEDGEGCISWWLVINGGFVEERKLSMDASDGASESRKFLGHLSLEV  637



>gb|ABK92467.1| unknown [Populus trichocarpa]
Length=366

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 181/228 (79%), Gaps = 3/228 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
              DG  LLSHFC+SL+HRI SNKVL ELE +V R PY+ LISHPTWHSR+S+WT+ MK+P
Sbjct  122  ANDGSGLLSHFCLSLSHRIISNKVLMELENVVCRVPYLHLISHPTWHSRSSAWTIFMKIP  181

Query  566  QSILNAGNEIHASYLD--KNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCS  396
             SIL+A ++     +   KNV KS+F TKV V+DDCI++E EGAPNVVGLFK  S+  CS
Sbjct  182  PSILHASSQTRTPDIQNMKNVVKSEFWTKVVVHDDCINIEAEGAPNVVGLFKDSSDDKCS  241

Query  395  INRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAH  216
             N+YDC+L DLP I+LQQVASQVIRWL EEAL VGIKANRDFL L FELEQGE + LVAH
Sbjct  242  TNKYDCNLDDLPVIILQQVASQVIRWLHEEALAVGIKANRDFLCLSFELEQGEILNLVAH  301

Query  215  IDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +DP+D  GCISWWL MEDG+++E KL ++I++G SE RKFLGYL L V
Sbjct  302  VDPEDTQGCISWWLTMEDGFAEEKKLHMNIADGASEYRKFLGYLPLDV  349



>ref|XP_011094122.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Sesamum indicum]
Length=662

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 184/226 (81%), Gaps = 2/226 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            K+  N+L HFCMSLAHRIFSNKVL+ LE LV RTPYV L+SHPTWHSRTSSWTL +K+PQ
Sbjct  423  KENSNILGHFCMSLAHRIFSNKVLSVLENLVYRTPYVHLVSHPTWHSRTSSWTLSVKIPQ  482

Query  563  SILNAGNEIH--ASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            SIL+AG++I    +   KN++SQF T+V V DD I VEGEGAPNVVGLF+G+ +   SIN
Sbjct  483  SILHAGSQIPIPTAAAVKNIRSQFWTRVLVIDDSIRVEGEGAPNVVGLFRGRPDTVSSIN  542

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             YDCDL DLP ILLQQVASQ+I+WL EEAL VGIKANRDFLSL FEL+QGE V LVAH+D
Sbjct  543  GYDCDLVDLPIILLQQVASQIIQWLHEEALTVGIKANRDFLSLAFELDQGEIVRLVAHVD  602

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P+D  GCISWWL ++DG  +E+KL  D+S+ ESE RKFLGYLSL V
Sbjct  603  PEDTKGCISWWLTVDDGLVEEHKLHPDMSDVESESRKFLGYLSLEV  648



>ref|XP_010093735.1| hypothetical protein L484_006289 [Morus notabilis]
 gb|EXB54541.1| hypothetical protein L484_006289 [Morus notabilis]
Length=701

 Score =   318 bits (815),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 186/227 (82%), Gaps = 6/227 (3%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K+GP+LL HFC+SLAHRIFS KVL  LE LVS   Y++L+SHPTW+SRTSSWT+ MK+P
Sbjct  414  AKEGPSLLGHFCLSLAHRIFSKKVLVVLENLVSGVSYLQLLSHPTWNSRTSSWTIFMKIP  473

Query  566  QSILNAGN----EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTC  399
            QSIL+ G+    ++H  ++    KSQFRTKV + DD ISVEGEGAPNVVGLFKG ++   
Sbjct  474  QSILHGGSHQTSDLH--HMKSTTKSQFRTKVVIKDDFISVEGEGAPNVVGLFKGSAQEVS  531

Query  398  SINRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVA  219
            S+NRY+C+L DLP I+LQQVA Q++RWL EEALMVGIK NRDFLSL FELEQGET+ L+A
Sbjct  532  SMNRYECNLEDLPVIILQQVAGQIVRWLHEEALMVGIKVNRDFLSLSFELEQGETLTLLA  591

Query  218  HIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            H+DP+D  GCISWWLVMEDG+++E KL +D+S+G SE R+FLG+LSL
Sbjct  592  HVDPEDAQGCISWWLVMEDGFTEEGKLHMDLSDGVSEYRRFLGHLSL  638



>ref|XP_010254371.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Nelumbo nucifera]
Length=667

 Score =   316 bits (810),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 179/220 (81%), Gaps = 3/220 (1%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM+LAHRIF+NKVLAELE L SR  Y+ L+SHPTWHSRTSSW+L MKVPQSIL+A
Sbjct  425  LLGHFCMTLAHRIFANKVLAELEILASRVSYLHLLSHPTWHSRTSSWSLSMKVPQSILHA  484

Query  548  GNEIHASYLDKN---VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            G+    S +      V+SQF TKV V DDCI++EGEGAPNVVGLFKG +E  CS+N YDC
Sbjct  485  GHRTRPSDMRSTKSAVRSQFITKVVVNDDCINIEGEGAPNVVGLFKGSAEDICSMNSYDC  544

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            +L DLP ILLQQVASQV+RWL EEAL+VG+KA+RDFL L FEL+QGET+GLVAH+DP+D 
Sbjct  545  NLPDLPVILLQQVASQVVRWLHEEALLVGMKASRDFLCLSFELDQGETLGLVAHVDPEDI  604

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVM+DG  +E KL  D S+  S+ R+FLG+LSL
Sbjct  605  QGCISWWLVMDDGLMEEGKLHTDFSSDASDTRRFLGHLSL  644



>ref|XP_006374395.1| hypothetical protein POPTR_0015s06780g [Populus trichocarpa]
 gb|ERP52192.1| hypothetical protein POPTR_0015s06780g [Populus trichocarpa]
Length=667

 Score =   313 bits (803),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 181/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            DG  LLSHFC+SL+HRI SNKVL ELE +V R PY+ LISHPTWHSR+S+WT+ MK+P S
Sbjct  425  DGSGLLSHFCLSLSHRIISNKVLMELENVVCRVPYLHLISHPTWHSRSSAWTIFMKIPPS  484

Query  560  ILNAGNEIHASYLD--KNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL+A ++     +   KNV KS+F TKV V+DDCI++E EGAPNVVGLFK  S+  CS N
Sbjct  485  ILHASSQTRTPDIQNMKNVVKSEFWTKVVVHDDCINIEAEGAPNVVGLFKDSSDDKCSTN  544

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +YDC+L DLP I+LQQVASQVIRWL EEAL VGIKANRDFL L FELEQGE + LVAH+D
Sbjct  545  KYDCNLDDLPVIILQQVASQVIRWLHEEALAVGIKANRDFLCLSFELEQGEILNLVAHVD  604

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P+D  GCISWWL MEDG+++E KL ++I++G SE RKFLGYL L V
Sbjct  605  PEDTQGCISWWLTMEDGFAEEKKLHMNIADGASEYRKFLGYLPLDV  650



>gb|KJB54063.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=581

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 183/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFS++VL ELE +V R PY+ L++HPTWHSR SSWT+ MKVPQ
Sbjct  337  KDGPGLLGHFCLSLAHRIFSSRVLIELENVVCRVPYLHLMTHPTWHSRKSSWTIFMKVPQ  396

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   +KSQF TKV + DD I+VEGEGAPNVVGLFK  SE  CS+
Sbjct  397  SILHAESQSPRSDFQNIKDVIKSQFHTKVVLSDDRINVEGEGAPNVVGLFKRSSEDICSV  456

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+YDCDLADLP ILLQQVASQVIRWL  EALMVGIK NR FLSL F+LEQGE+V LVAH+
Sbjct  457  NKYDCDLADLPVILLQQVASQVIRWLHGEALMVGIKTNRYFLSLAFDLEQGESVSLVAHV  516

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  G ISWWLVMEDG++++ KL+++I +G  E RKFLG+L+L V
Sbjct  517  DPEDIQGGISWWLVMEDGFAEDWKLQMEIYDGTPEYRKFLGHLNLDV  563



>ref|XP_009368825.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Pyrus x bretschneideri]
Length=655

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 179/228 (79%), Gaps = 4/228 (2%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K+G  LL HFC+SLAHRIFSNKVL ELE +V   PY++L+SHPTWHSRTSSW L +K+P
Sbjct  412  AKEGSGLLGHFCLSLAHRIFSNKVLKELENVVKGVPYLQLLSHPTWHSRTSSWMLSVKIP  471

Query  566  QSILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCS  396
            QSIL+A  +  AS   ++    KSQF TKV V DDCI+VEGEGAPNVVGLF   SE  CS
Sbjct  472  QSILHAC-QTRASDMRHMRNVAKSQFHTKVVVTDDCINVEGEGAPNVVGLFNENSEEICS  530

Query  395  INRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAH  216
            +NRYDCDLADLP I+LQQVA QVIRWL EEAL VGIKA RDFL L FEL+QGET+ LVAH
Sbjct  531  MNRYDCDLADLPVIILQQVAGQVIRWLHEEALTVGIKAKRDFLCLSFELDQGETLSLVAH  590

Query  215  IDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +DP+D  GCISWWLV++ G+ +E KL +D S+  SE RKFLG+LSL V
Sbjct  591  VDPEDSEGCISWWLVIDGGFIEERKLSIDASDAASETRKFLGHLSLEV  638



>ref|XP_008337314.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Malus domestica]
Length=655

 Score =   311 bits (798),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/228 (67%), Positives = 179/228 (79%), Gaps = 4/228 (2%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K+G  LL HFC+SLAHRIFSNKVL ELE +V   PY++L+SHPTWHSRTSSW L +K+P
Sbjct  412  AKEGSGLLGHFCLSLAHRIFSNKVLKELENVVKGIPYLQLLSHPTWHSRTSSWMLSVKIP  471

Query  566  QSILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCS  396
            QSIL+A  +  AS   ++    KSQF TKV V DDCI+VEGEGAPNVVGLF   SE  CS
Sbjct  472  QSILHAC-QTRASDMRHMRNVAKSQFHTKVVVTDDCINVEGEGAPNVVGLFNENSEEICS  530

Query  395  INRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAH  216
            +NRYDCDLADLP I+LQQVA QVIRWL EEAL VGIKA RDFL L FEL+QGET+ LVAH
Sbjct  531  MNRYDCDLADLPVIILQQVAGQVIRWLHEEALTVGIKAKRDFLCLSFELDQGETLSLVAH  590

Query  215  IDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +DP+D  GCISWWLV++ G+ +E KL +D S+  SE RKFLG+LSL V
Sbjct  591  VDPEDSEGCISWWLVIDGGFIEERKLSIDASDAASETRKFLGHLSLEV  638



>ref|XP_011007274.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Populus euphratica]
 ref|XP_011007275.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Populus euphratica]
 ref|XP_011007276.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Populus euphratica]
Length=667

 Score =   311 bits (797),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 181/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            DG  LLSHFC+SL+HRI SNKVL ELE +V R PY+ LISHPTWHSR+S+WT+ MK+P S
Sbjct  425  DGSGLLSHFCLSLSHRIISNKVLMELENVVCRVPYLHLISHPTWHSRSSAWTIFMKIPPS  484

Query  560  ILNAGNEIHASYLD--KNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL+A ++     +   KNV KS+F TK+ V+DDCI++E EGAPNVVGLFK  S+  CS N
Sbjct  485  ILHASSQARTPDIQNMKNVVKSEFWTKIVVHDDCINIEAEGAPNVVGLFKDSSDDICSTN  544

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +YDC+L DLP I+LQQVASQVIRWL EEAL VGIKANRDFL L FEL+QGE + LVAH+D
Sbjct  545  KYDCNLDDLPVIILQQVASQVIRWLHEEALAVGIKANRDFLCLSFELDQGEILNLVAHVD  604

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P+D  GCISWWL MEDG+++E KL ++I++G SE RKFLGYL L V
Sbjct  605  PEDTQGCISWWLTMEDGFAEEKKLHMNIADGASEYRKFLGYLPLDV  650



>ref|XP_003525658.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Glycine max]
 ref|XP_006579749.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Glycine max]
 gb|KHN27409.1| hypothetical protein glysoja_022118 [Glycine soja]
Length=659

 Score =   311 bits (796),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             KDG +LL HF  SLAHRIFS KVLAELE +V + PY++LIS+PTWHSR SSWTL M+VP
Sbjct  416  AKDGSSLLGHFFKSLAHRIFSTKVLAELENVVCKVPYIQLISNPTWHSRASSWTLYMEVP  475

Query  566  QSILNAGNEIHASYLDKN-VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            QSIL       + Y +KN VK QF TKV V DDCI+V+ EG+PNV GLFKGK E T SIN
Sbjct  476  QSILRGSQTKTSDYYEKNAVKRQFWTKVVVNDDCINVKAEGSPNVAGLFKGKIEETHSIN  535

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +Y+C+LADLP I+LQQVASQ+I WL +EA+MVGIKANRDFL L  ELEQGET+GLVA +D
Sbjct  536  KYNCNLADLPVIILQQVASQIINWLYQEAMMVGIKANRDFLCLSLELEQGETLGLVASVD  595

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            P+D  GCISWWLVMED +++E KL + I++G SE RKFLG+LSL
Sbjct  596  PEDSEGCISWWLVMEDSFAEEQKLHMSITDGASEYRKFLGHLSL  639



>gb|KJB54064.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=604

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 183/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFS++VL ELE +V R PY+ L++HPTWHSR SSWT+ MKVPQ
Sbjct  360  KDGPGLLGHFCLSLAHRIFSSRVLIELENVVCRVPYLHLMTHPTWHSRKSSWTIFMKVPQ  419

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   +KSQF TKV + DD I+VEGEGAPNVVGLFK  SE  CS+
Sbjct  420  SILHAESQSPRSDFQNIKDVIKSQFHTKVVLSDDRINVEGEGAPNVVGLFKRSSEDICSV  479

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+YDCDLADLP ILLQQVASQVIRWL  EALMVGIK NR FLSL F+LEQGE+V LVAH+
Sbjct  480  NKYDCDLADLPVILLQQVASQVIRWLHGEALMVGIKTNRYFLSLAFDLEQGESVSLVAHV  539

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  G ISWWLVMEDG++++ KL+++I +G  E RKFLG+L+L V
Sbjct  540  DPEDIQGGISWWLVMEDGFAEDWKLQMEIYDGTPEYRKFLGHLNLDV  586



>ref|XP_007154971.1| hypothetical protein PHAVU_003G161800g [Phaseolus vulgaris]
 gb|ESW26965.1| hypothetical protein PHAVU_003G161800g [Phaseolus vulgaris]
Length=663

 Score =   310 bits (795),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = -1

Query  746  TKDG-PNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKV  570
            TKDG  NLL HF MSL+HRIFS KVLAELE +VS+ PY++LIS+PTWHSR SSWTL M+V
Sbjct  419  TKDGGSNLLGHFFMSLSHRIFSTKVLAELENVVSKVPYLQLISNPTWHSRASSWTLYMEV  478

Query  569  PQSILNAGNEIHASYLDKN-VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            PQSIL       + Y +KN VK QF  K  V D+CI+V+ EG+PNV GLFKGK E T SI
Sbjct  479  PQSILRGSQIKTSDYFEKNAVKRQFWIKAVVNDNCINVKAEGSPNVAGLFKGKIEETHSI  538

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+Y+C+LADLP I+LQQVASQ+I WL +EALMVGIKANRDFL L FELEQGET+GLVA +
Sbjct  539  NKYNCNLADLPVIILQQVASQIINWLYQEALMVGIKANRDFLCLSFELEQGETLGLVASV  598

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            DP+D  GCISWWLVMED +++E KL ++I++G SE RKFLG+LSL
Sbjct  599  DPEDSEGCISWWLVMEDSFAEEQKLHMNITDGASEYRKFLGHLSL  643



>gb|KJB54062.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=633

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 183/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFS++VL ELE +V R PY+ L++HPTWHSR SSWT+ MKVPQ
Sbjct  389  KDGPGLLGHFCLSLAHRIFSSRVLIELENVVCRVPYLHLMTHPTWHSRKSSWTIFMKVPQ  448

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   +KSQF TKV + DD I+VEGEGAPNVVGLFK  SE  CS+
Sbjct  449  SILHAESQSPRSDFQNIKDVIKSQFHTKVVLSDDRINVEGEGAPNVVGLFKRSSEDICSV  508

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+YDCDLADLP ILLQQVASQVIRWL  EALMVGIK NR FLSL F+LEQGE+V LVAH+
Sbjct  509  NKYDCDLADLPVILLQQVASQVIRWLHGEALMVGIKTNRYFLSLAFDLEQGESVSLVAHV  568

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  G ISWWLVMEDG++++ KL+++I +G  E RKFLG+L+L V
Sbjct  569  DPEDIQGGISWWLVMEDGFAEDWKLQMEIYDGTPEYRKFLGHLNLDV  615



>gb|KJB54060.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
 gb|KJB54061.1| hypothetical protein B456_009G019100 [Gossypium raimondii]
Length=671

 Score =   310 bits (793),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/227 (67%), Positives = 183/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFS++VL ELE +V R PY+ L++HPTWHSR SSWT+ MKVPQ
Sbjct  427  KDGPGLLGHFCLSLAHRIFSSRVLIELENVVCRVPYLHLMTHPTWHSRKSSWTIFMKVPQ  486

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   +KSQF TKV + DD I+VEGEGAPNVVGLFK  SE  CS+
Sbjct  487  SILHAESQSPRSDFQNIKDVIKSQFHTKVVLSDDRINVEGEGAPNVVGLFKRSSEDICSV  546

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+YDCDLADLP ILLQQVASQVIRWL  EALMVGIK NR FLSL F+LEQGE+V LVAH+
Sbjct  547  NKYDCDLADLPVILLQQVASQVIRWLHGEALMVGIKTNRYFLSLAFDLEQGESVSLVAHV  606

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP+D  G ISWWLVMEDG++++ KL+++I +G  E RKFLG+L+L V
Sbjct  607  DPEDIQGGISWWLVMEDGFAEDWKLQMEIYDGTPEYRKFLGHLNLDV  653



>gb|KEH32115.1| RNA polymerase II transcription mediators protein [Medicago truncatula]
Length=552

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 179/224 (80%), Gaps = 2/224 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             KDG  LLSHF MSLAHRIFS K+LAELE +V + PY++LIS+PTWHSR SSWTL M+VP
Sbjct  309  AKDGSYLLSHFFMSLAHRIFSTKILAELENVVFKVPYLQLISNPTWHSRGSSWTLFMEVP  368

Query  566  QSILNAGNEIHASYLDKN-VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
             SIL  G ++  S  + N +K QF TKV V DDCISV+ EG+PNV GLFKGKSE T SIN
Sbjct  369  PSILR-GCQVKTSDFENNAIKRQFWTKVVVIDDCISVKAEGSPNVSGLFKGKSEDTHSIN  427

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +YDC+LADLP I+LQQVASQ+I WL  EALMVGIKANRDFL L FELEQGET+GLVA++D
Sbjct  428  KYDCNLADLPVIILQQVASQIINWLYHEALMVGIKANRDFLCLSFELEQGETLGLVANVD  487

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            PKD  GCISW LVMED +++  KL  ++++G SE RKFLG LSL
Sbjct  488  PKDSDGCISWSLVMEDSFAEVQKLHTNLTDGASEYRKFLGPLSL  531



>gb|KJB07726.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=553

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 180/227 (79%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE +V R PY+ L++HPTWHS+TSSWT+ +KVPQ
Sbjct  309  KDGPGLLGHFCLSLAHRIFSNRVLVELENVVCRVPYLHLMTHPTWHSQTSSWTIFLKVPQ  368

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEG+GAPNVV LFK  SE   S+
Sbjct  369  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGDGAPNVVSLFKRSSENISSV  428

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+Y+CDLADLP I+L Q ASQVI WL EEALMVGIK NRDFL L FELEQG+TV LVAH+
Sbjct  429  NKYECDLADLPVIILLQAASQVICWLHEEALMVGIKTNRDFLCLTFELEQGDTVSLVAHV  488

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +P+D  G I+WWLVMEDG  D+ KL++D+ +G SE RKFLG+L+L V
Sbjct  489  NPEDIKGGIAWWLVMEDGSPDDWKLQMDMYDGASEYRKFLGHLTLDV  535



>gb|KJB07727.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=565

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 180/227 (79%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE +V R PY+ L++HPTWHS+TSSWT+ +KVPQ
Sbjct  321  KDGPGLLGHFCLSLAHRIFSNRVLVELENVVCRVPYLHLMTHPTWHSQTSSWTIFLKVPQ  380

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEG+GAPNVV LFK  SE   S+
Sbjct  381  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGDGAPNVVSLFKRSSENISSV  440

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+Y+CDLADLP I+L Q ASQVI WL EEALMVGIK NRDFL L FELEQG+TV LVAH+
Sbjct  441  NKYECDLADLPVIILLQAASQVICWLHEEALMVGIKTNRDFLCLTFELEQGDTVSLVAHV  500

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +P+D  G I+WWLVMEDG  D+ KL++D+ +G SE RKFLG+L+L V
Sbjct  501  NPEDIKGGIAWWLVMEDGSPDDWKLQMDMYDGASEYRKFLGHLTLDV  547



>gb|AES91489.2| RNA polymerase II transcription mediators protein [Medicago truncatula]
Length=660

 Score =   303 bits (777),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 179/224 (80%), Gaps = 2/224 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             KDG  LLSHF MSLAHRIFS K+LAELE +V + PY++LIS+PTWHSR SSWTL M+VP
Sbjct  417  AKDGSYLLSHFFMSLAHRIFSTKILAELENVVFKVPYLQLISNPTWHSRGSSWTLFMEVP  476

Query  566  QSILNAGNEIHASYLDKN-VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
             SIL  G ++  S  + N +K QF TKV V DDCISV+ EG+PNV GLFKGKSE T SIN
Sbjct  477  PSILR-GCQVKTSDFENNAIKRQFWTKVVVIDDCISVKAEGSPNVSGLFKGKSEDTHSIN  535

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +YDC+LADLP I+LQQVASQ+I WL  EALMVGIKANRDFL L FELEQGET+GLVA++D
Sbjct  536  KYDCNLADLPVIILQQVASQIINWLYHEALMVGIKANRDFLCLSFELEQGETLGLVANVD  595

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            PKD  GCISW LVMED +++  KL  ++++G SE RKFLG LSL
Sbjct  596  PKDSDGCISWSLVMEDSFAEVQKLHTNLTDGASEYRKFLGPLSL  639



>gb|AIU49742.1| RNA polymerase II transcription mediator, partial [Chimonanthus 
praecox]
Length=517

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 173/222 (78%), Gaps = 22/222 (10%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            + G  LL HFCM+LAHRIFSNKVLAELE +VS  PY+ L+SHPTWHSRTSSW+L +KVP+
Sbjct  303  EKGFGLLGHFCMTLAHRIFSNKVLAELEKMVSGVPYLHLLSHPTWHSRTSSWSLFVKVPE  362

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SI++AG            +SQFRTKV V D+CISV GEG PNVVG FKG S   CS+N +
Sbjct  363  SIIHAG------------RSQFRTKVVVTDECISVSGEGVPNVVGFFKGSSVDVCSMNHF  410

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            DCDLADLP ILLQQVASQ+IRWL EEAL+VG+KA RDF+SL FELE+G+T+GLVAH+DP 
Sbjct  411  DCDLADLPVILLQQVASQIIRWLHEEALIVGMKATRDFISLSFELERGDTLGLVAHVDPH  470

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            DP GCISWWLVM+DG  +E KL +D        RKFLG+LSL
Sbjct  471  DPYGCISWWLVMDDG--EEGKLHMD--------RKFLGHLSL  502



>gb|AIU49735.1| RNA polymerase II transcription mediator, partial [Eucalyptus 
grandis]
Length=517

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 169/220 (77%), Gaps = 22/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCMSLAHRIFSNKVL EL+ +V R PY+ L+S P WHSRTSSWTL MKVP+SI
Sbjct  305  GSGLLGHFCMSLAHRIFSNKVLMELDNVVCRVPYLHLMSQPCWHSRTSSWTLYMKVPESI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+A             K+QFRTK+ V DDCI VEGEGAPNVVGLFKG +E   SINRYDC
Sbjct  365  LHA------------CKTQFRTKIVVTDDCIKVEGEGAPNVVGLFKGTAEDISSINRYDC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP I+LQQVASQVIRWL EEALMVGIKA RDFL L FELEQGE +GL+A +DP+DP
Sbjct  413  DLADLPVIILQQVASQVIRWLHEEALMVGIKATRDFLCLSFELEQGEMLGLLAQVDPEDP  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVM+DG  DE KL++D        RK LG+LSL
Sbjct  473  CGCISWWLVMDDG--DERKLQMD--------RKSLGHLSL  502



>gb|KHG17744.1| mediator of rna polymerase ii transcription subunit 17 [Gossypium 
arboreum]
Length=664

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 180/227 (79%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE +V R PY+ L++HPTWHS+ SSWT+ +KVPQ
Sbjct  420  KDGPGLLGHFCLSLAHRIFSNRVLVELENVVCRVPYLHLMTHPTWHSQASSWTIFLKVPQ  479

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEGEGAPNVV LFK  SE   S+
Sbjct  480  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGEGAPNVVSLFKRSSENISSV  539

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+Y+CDLADLP I+L Q ASQVI WL EEALMVGIK NRDFL L FELEQG+TV LVAH+
Sbjct  540  NKYECDLADLPVIILLQAASQVICWLHEEALMVGIKTNRDFLCLTFELEQGDTVSLVAHV  599

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +P+D  G I+WWLVMEDG +D+ KL++D+ +G SE RKFLG+L+L V
Sbjct  600  NPEDIKGGIAWWLVMEDGSTDDWKLQMDMYDGASEYRKFLGHLTLDV  646



>gb|AIU49763.1| RNA polymerase II transcription mediator, partial [Vitis vinifera]
Length=516

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 170/222 (77%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCMSLAHRIFS+KVL ELE LVSR PY+ L+SHPTWHSRTSSWTLLMKVP+S 
Sbjct  304  GFGLLGHFCMSLAHRIFSSKVLMELENLVSRVPYLHLLSHPTWHSRTSSWTLLMKVPESS  363

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
             + G            K+ FRTKV + DDCI+VEG+GAPNVVGLFKG SE  CS+NRYDC
Sbjct  364  FHPG------------KTHFRTKVVINDDCINVEGDGAPNVVGLFKGSSEDVCSMNRYDC  411

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLAD+P ILLQQVASQVIRWL EEAL VGIKANRDFL L FE++QGE + LVAH++P DP
Sbjct  412  DLADIPVILLQQVASQVIRWLHEEALKVGIKANRDFLCLSFEMDQGEMLSLVAHVNPDDP  471

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLVM+DG  ++ K   D        RKFLG+LSL V
Sbjct  472  QGCISWWLVMDDG--EDLKFHTD--------RKFLGHLSLEV  503



>gb|KJB07721.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=663

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 180/227 (79%), Gaps = 3/227 (1%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE +V R PY+ L++HPTWHS+TSSWT+ +KVPQ
Sbjct  419  KDGPGLLGHFCLSLAHRIFSNRVLVELENVVCRVPYLHLMTHPTWHSQTSSWTIFLKVPQ  478

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEG+GAPNVV LFK  SE   S+
Sbjct  479  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGDGAPNVVSLFKRSSENISSV  538

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+Y+CDLADLP I+L Q ASQVI WL EEALMVGIK NRDFL L FELEQG+TV LVAH+
Sbjct  539  NKYECDLADLPVIILLQAASQVICWLHEEALMVGIKTNRDFLCLTFELEQGDTVSLVAHV  598

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +P+D  G I+WWLVMEDG  D+ KL++D+ +G SE RKFLG+L+L V
Sbjct  599  NPEDIKGGIAWWLVMEDGSPDDWKLQMDMYDGASEYRKFLGHLTLDV  645



>gb|AIU49752.1| RNA polymerase II transcription mediator, partial [Prunus persica]
Length=515

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 170/222 (77%), Gaps = 23/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            GP LL HFCMSLAHRIFSNKVL ELE +V   PY++L+SHPTWHSRTSSW L +K+P+SI
Sbjct  304  GPGLLGHFCMSLAHRIFSNKVLKELENVVKGVPYLQLLSHPTWHSRTSSWMLFVKIPESI  363

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+A             KSQF TKV V DDCI+VEGEGAPNVVGLFKG SE  C +NRYDC
Sbjct  364  LHA-------------KSQFHTKVVVTDDCINVEGEGAPNVVGLFKGNSEEICLMNRYDC  410

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP I+LQQVASQVIRWL EEALMVGIKANRDFL L FEL+ GET+ LVAH+DP+D 
Sbjct  411  DLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLCLSFELDLGETLSLVAHVDPEDG  470

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLV+  G  +E KL +D        RKFLG+LSL V
Sbjct  471  EGCISWWLVINGG--EERKLSMD--------RKFLGHLSLEV  502



>gb|AIU49734.1| RNA polymerase II transcription mediator, partial [Citrus sinensis]
Length=516

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 168/222 (76%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFC+SLAHRIFSNKV  ELE  V   PY+ L+SHPTWHSRTSSWT+ +KVPQSI
Sbjct  304  GSGLLGHFCLSLAHRIFSNKVHVELENAVCGVPYLHLVSHPTWHSRTSSWTVFLKVPQSI  363

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+A             KS FRT V V DDCI VEGEG PNVVGLFKG+SE   S+N+YDC
Sbjct  364  LHAE------------KSHFRTNVVVNDDCIHVEGEGTPNVVGLFKGRSEDMSSMNKYDC  411

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP I+LQQVASQVIRWL EEALMVGIKANRDFLSL FEL+QGETV LVAH+DP+D 
Sbjct  412  DLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLSLSFELDQGETVSLVAHVDPEDM  471

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLVMEDG   E KL +D        +KFLG+LSL V
Sbjct  472  RGCISWWLVMEDGA--ERKLSID--------KKFLGHLSLDV  503



>gb|AIU49730.1| RNA polymerase II transcription mediator, partial [Citrus clementina]
Length=516

 Score =   296 bits (757),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 168/222 (76%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFC+SLAHRIFSNKV  ELE  V   PY+ L+SHPTWHSRTSSWT+ +KVPQSI
Sbjct  304  GSGLLGHFCLSLAHRIFSNKVRVELENAVCGVPYLHLVSHPTWHSRTSSWTVFLKVPQSI  363

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+A             KS FRT V V DDCI VEGEG PNVVGLF+G+SE   S+N+YDC
Sbjct  364  LHAE------------KSHFRTNVVVNDDCIHVEGEGTPNVVGLFEGRSEDMSSMNKYDC  411

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP I+LQQVASQVIRWL EEALMVGIKANRDFLSL FEL+QGETV LVAH+DP+D 
Sbjct  412  DLADLPVIILQQVASQVIRWLHEEALMVGIKANRDFLSLSFELDQGETVSLVAHVDPEDM  471

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLVMEDG   E KL +D        +KFLG+LSL V
Sbjct  472  RGCISWWLVMEDGA--ERKLSID--------KKFLGHLSLDV  503



>gb|AIU49732.1| RNA polymerase II transcription mediator, partial [Carica papaya]
Length=376

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 167/219 (76%), Gaps = 22/219 (10%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SLAHRIFSN+VL ELE +V +  Y+ LISHPTWHSR SSWTL MKVPQSIL+A
Sbjct  171  LLGHFCLSLAHRIFSNRVLVELENVVCKVSYLHLISHPTWHSRKSSWTLFMKVPQSILHA  230

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
                         KSQFRTKV V DD I+VEGE APN+V LFKG S+  CS+N+YDCDLA
Sbjct  231  S------------KSQFRTKVVVNDDSINVEGECAPNIVRLFKGNSDDLCSVNKYDCDLA  278

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP ++LQQVASQVIRWL EEALMVGIKAN DFLSL FELEQGETV LVAH+DP+D  GC
Sbjct  279  DLPVMILQQVASQVIRWLHEEALMVGIKANCDFLSLSFELEQGETVSLVAHVDPEDVQGC  338

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISWWLVMEDG  +E KL  D        RKFLG LSL V
Sbjct  339  ISWWLVMEDG--EEGKLTTD--------RKFLGPLSLDV  367



>gb|AIU49727.1| RNA polymerase II transcription mediator, partial [Theobroma 
cacao]
Length=517

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 171/222 (77%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HF +SLAHRIFSN+VL +LE +V R PY+ L++HPTWHSRTSSWT+ MKVPQSI
Sbjct  305  GSGLLGHFSLSLAHRIFSNRVLMKLENVVCRVPYLHLMTHPTWHSRTSSWTIFMKVPQSI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+              KSQFRTKV V DD I+VEGEGAPNVVGLFK  SE  CS+N+YDC
Sbjct  365  LHVE------------KSQFRTKVVVNDDRINVEGEGAPNVVGLFKRSSEDICSVNKYDC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP I+LQQVASQVIRWL EEALMVGIK NRDFL L FELEQGETV LVAH+DP+D 
Sbjct  413  DLADLPVIILQQVASQVIRWLHEEALMVGIKTNRDFLCLTFELEQGETVSLVAHVDPEDI  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLVMEDG  ++ KL++D        RKFLG+LSL V
Sbjct  473  QGCISWWLVMEDG--EDWKLQMD--------RKFLGHLSLDV  504



>gb|AIU49738.1| RNA polymerase II transcription mediator, partial [Buxus sinica]
Length=415

 Score =   292 bits (747),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 171/220 (78%), Gaps = 22/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFC+SLAHRIFSNKVLAELE LV R PY+ LISHPTW+SR SSW+L +KVPQSI
Sbjct  204  GFGLLGHFCLSLAHRIFSNKVLAELEKLVGRVPYLHLISHPTWNSRKSSWSLSVKVPQSI  263

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+AG            +SQF+TKV V DD ISVEGEGAPNV+ LF+G SE TCSIN YDC
Sbjct  264  LHAG------------RSQFQTKVVVSDDRISVEGEGAPNVISLFRGSSENTCSINSYDC  311

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL DLP ILLQQVASQVIRWL EEALMVGIKA+ DFL L F LEQG+T+GLVAH+DP+D 
Sbjct  312  DLPDLPVILLQQVASQVIRWLHEEALMVGIKASLDFLCLSFNLEQGDTLGLVAHVDPEDT  371

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVM +G  DE +L+++        RKFLG+LSL
Sbjct  372  QGCISWWLVMMEG--DEARLRLE--------RKFLGHLSL  401



>ref|XP_004508515.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Cicer arietinum]
 ref|XP_004508516.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Cicer arietinum]
 ref|XP_004508517.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X3 [Cicer arietinum]
 ref|XP_004508518.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X4 [Cicer arietinum]
Length=658

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 178/224 (79%), Gaps = 1/224 (0%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             KDG +LL HF MSLAHRIFS+K+LAELE +V + PY++LIS+PTWHSR SSWTL M+VP
Sbjct  416  AKDGSSLLGHFFMSLAHRIFSSKILAELENVVFKVPYLQLISNPTWHSRGSSWTLFMEVP  475

Query  566  QSILNAGNEIHASYLDKN-VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
             SIL+      + Y +KN +K QF  KV V DD I+V+ EG+PNV GLFKGKSE T SIN
Sbjct  476  PSILHGCQIKTSDYCEKNSIKRQFWIKVVVIDDRINVKAEGSPNVAGLFKGKSEDTHSIN  535

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +YDC+LADLP I+LQQVASQ+I WL  EALMVGIKANRDFL L FELEQGET+GLVA++D
Sbjct  536  KYDCNLADLPVIILQQVASQIINWLYHEALMVGIKANRDFLCLSFELEQGETLGLVANVD  595

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            P+D  GCISW LVMED +++  KL  +I+NG SE RKFLG LSL
Sbjct  596  PEDTDGCISWSLVMEDSFAEVQKLHKNITNGASEYRKFLGPLSL  639



>gb|AIU49767.1| RNA polymerase II transcription mediator, partial [Platanus x 
acerifolia]
Length=517

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 171/220 (78%), Gaps = 22/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCM+LAHRIFSNKVLAELE L SR PY+ L+S PTWHSRTSSW+L MKVPQSI
Sbjct  305  GFGLLGHFCMTLAHRIFSNKVLAELEILASRVPYLHLLSLPTWHSRTSSWSLSMKVPQSI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+ G            +SQF+TKV V DD ISVEGEGAPNVVGLFKG SE  CS+N Y C
Sbjct  365  LHTG------------RSQFQTKVVVNDDRISVEGEGAPNVVGLFKGSSEDICSMNSYGC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            +L DLP ILLQQVASQV+RWL EEALM+GIKA+RDFL L FEL+QG+T+GLVAH+DP+D 
Sbjct  413  NLPDLPVILLQQVASQVVRWLHEEALMLGIKASRDFLCLSFELDQGDTLGLVAHVDPEDT  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVMEDG  +E KL+ D        R+FLG+LSL
Sbjct  473  HGCISWWLVMEDG--EEGKLQTD--------RRFLGHLSL  502



>ref|XP_003549778.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Glycine max]
 ref|XP_006600757.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Glycine max]
 gb|KHN15120.1| hypothetical protein glysoja_011738 [Glycine soja]
Length=660

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 176/224 (79%), Gaps = 1/224 (0%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             +DG +LL HF  SLAHRIFS KVLAELE +V + PY++LIS+PTW+SR SSWTL M+VP
Sbjct  417  ARDGSSLLGHFFKSLAHRIFSTKVLAELENVVCKVPYLQLISNPTWNSRASSWTLYMEVP  476

Query  566  QSILNAGNEIHASYLDKNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            QSIL       + Y +KN  K QF TKV V DDCI+V+ EG+PNV GLFKGK E T SIN
Sbjct  477  QSILRGSQTKTSDYYEKNAAKRQFWTKVVVNDDCINVKAEGSPNVAGLFKGKIEETHSIN  536

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +Y+C+LADLP I+LQQVASQ+I WL +EA+MVGIK NRDFL L  EL+QGET+GLVA +D
Sbjct  537  KYNCNLADLPVIILQQVASQIINWLYQEAMMVGIKVNRDFLCLSLELKQGETLGLVASVD  596

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            P+D   CISWWLVMED +++E KL + I++G SE RKFLG+LSL
Sbjct  597  PEDSEECISWWLVMEDSFAEEQKLHMSITDGASEYRKFLGHLSL  640



>ref|XP_003609292.1| hypothetical protein MTR_4g114100 [Medicago truncatula]
Length=856

 Score =   301 bits (772),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 179/224 (80%), Gaps = 2/224 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             KDG  LLSHF MSLAHRIFS K+LAELE +V + PY++LIS+PTWHSR SSWTL M+VP
Sbjct  417  AKDGSYLLSHFFMSLAHRIFSTKILAELENVVFKVPYLQLISNPTWHSRGSSWTLFMEVP  476

Query  566  QSILNAGNEIHASYLDKN-VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
             SIL  G ++  S  + N +K QF TKV V DDCISV+ EG+PNV GLFKGKSE T SIN
Sbjct  477  PSILR-GCQVKTSDFENNAIKRQFWTKVVVIDDCISVKAEGSPNVSGLFKGKSEDTHSIN  535

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +YDC+LADLP I+LQQVASQ+I WL  EALMVGIKANRDFL L FELEQGET+GLVA++D
Sbjct  536  KYDCNLADLPVIILQQVASQIINWLYHEALMVGIKANRDFLCLSFELEQGETLGLVANVD  595

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            PKD  GCISW LVMED +++  KL  ++++G SE RKFLG LSL
Sbjct  596  PKDSDGCISWSLVMEDSFAEVQKLHTNLTDGASEYRKFLGPLSL  639



>gb|KJB07723.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=662

 Score =   297 bits (760),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/227 (66%), Positives = 179/227 (79%), Gaps = 4/227 (2%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE  V R PY+ L++HPTWHS+TSSWT+ +KVPQ
Sbjct  419  KDGPGLLGHFCLSLAHRIFSNRVLVELEN-VCRVPYLHLMTHPTWHSQTSSWTIFLKVPQ  477

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEG+GAPNVV LFK  SE   S+
Sbjct  478  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGDGAPNVVSLFKRSSENISSV  537

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+Y+CDLADLP I+L Q ASQVI WL EEALMVGIK NRDFL L FELEQG+TV LVAH+
Sbjct  538  NKYECDLADLPVIILLQAASQVICWLHEEALMVGIKTNRDFLCLTFELEQGDTVSLVAHV  597

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +P+D  G I+WWLVMEDG  D+ KL++D+ +G SE RKFLG+L+L V
Sbjct  598  NPEDIKGGIAWWLVMEDGSPDDWKLQMDMYDGASEYRKFLGHLTLDV  644



>gb|AIU49729.1| RNA polymerase II transcription mediator, partial [Sarcandra 
glabra]
Length=519

 Score =   289 bits (739),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 170/220 (77%), Gaps = 21/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCM+LAHRIFSNKVLAELE LV+R PY+ L+SHPTWHSRTSSW+L MKVPQSI
Sbjct  306  GSGLLGHFCMTLAHRIFSNKVLAELENLVNRIPYLHLLSHPTWHSRTSSWSLFMKVPQSI  365

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+ G            +SQF TKV V D+CI+V GEG+PNVV +F+G S   C IN YDC
Sbjct  366  LHTG------------RSQFHTKVVVNDECINVGGEGSPNVVSVFRGSSVDDCLINCYDC  413

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLAD+P ILLQQVASQVIRWL EEAL+VG+KA+RDFL L FELEQG+T+GLVAH+DP D 
Sbjct  414  DLADIPVILLQQVASQVIRWLHEEALVVGMKASRDFLCLSFELEQGDTLGLVAHVDPDDV  473

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWW+VMEDG  +E K+        S+ R+FLG+LSL
Sbjct  474  QGCISWWMVMEDG--EEGKV-------HSDNRRFLGHLSL  504



>gb|AIU49766.1| RNA polymerase II transcription mediator, partial [Cinnamomum 
camphora]
Length=517

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 170/220 (77%), Gaps = 22/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  L+ HFCM+LAHRIFSNKVLAELE LVS  PY+ L+SHPTWHSRTSSW+L +KVP+SI
Sbjct  305  GSGLVGHFCMTLAHRIFSNKVLAELEKLVSGVPYLHLLSHPTWHSRTSSWSLSVKVPESI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            ++AG            +SQF TKV V D+CISV GEGAPNVVG F+G S     +N YDC
Sbjct  365  IHAG------------RSQFLTKVVVNDECISVSGEGAPNVVGFFRGVSMDVSPMNCYDC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLPAILLQQVASQVIRWL EEAL+VG+KA RDF+SL FEL+QG+T+GLVAH+DP D 
Sbjct  413  DLADLPAILLQQVASQVIRWLHEEALVVGMKATRDFISLSFELDQGDTLGLVAHVDPVDA  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVMEDG  +E KL ++        R+FLG+LSL
Sbjct  473  RGCISWWLVMEDG--EEGKLNMN--------RRFLGHLSL  502



>ref|XP_007013392.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
 ref|XP_007013394.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
 gb|EOY31011.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
 gb|EOY31013.1| RNA polymerase II transcription mediators isoform 3 [Theobroma 
cacao]
Length=527

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/197 (70%), Positives = 162/197 (82%), Gaps = 3/197 (2%)
 Frame = -1

Query  653  VSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNAGNEIHAS---YLDKNVKSQFRTKVS  483
            V R PY+ L++HPTWHSRTSSWT+ MKVPQSIL+  ++   S    +   +KSQFRTKV 
Sbjct  313  VCRVPYLHLMTHPTWHSRTSSWTIFMKVPQSILHVESQSQKSDFQNMKDAIKSQFRTKVV  372

Query  482  VYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLADLPAILLQQVASQVIRWLREEA  303
            V DD I+VEGEGAPNVVGLFK  SE  CS+N+YDCDLADLP I+LQQVASQVIRWL EEA
Sbjct  373  VNDDRINVEGEGAPNVVGLFKRSSEDICSVNKYDCDLADLPVIILQQVASQVIRWLHEEA  432

Query  302  LMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGCISWWLVMEDGYSDENKLKVDIS  123
            LMVGIK NRDFL L FELEQGETV LVAH+DP+D  GCISWWLVMEDG++++ KL++D+S
Sbjct  433  LMVGIKTNRDFLCLTFELEQGETVSLVAHVDPEDIQGCISWWLVMEDGFAEDWKLQMDMS  492

Query  122  NGESERRKFLGYLSLGV  72
            +G SE RKFLG+LSL V
Sbjct  493  DGASEYRKFLGHLSLDV  509



>gb|AIU49751.1| RNA polymerase II transcription mediator, partial [Populus trichocarpa]
Length=517

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 166/222 (75%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LLSHFC+SL+HRI SNKVL ELE +V R PY+ LISHPTWHSR+S+WT+ MK+P SI
Sbjct  305  GSGLLSHFCLSLSHRIISNKVLMELENVVCRVPYLHLISHPTWHSRSSAWTIFMKIPPSI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+A             KS+F TKV V+DDCI++E EGAPNVVGLFK  S+  CS N+YDC
Sbjct  365  LHAS------------KSEFWTKVVVHDDCINIEAEGAPNVVGLFKDSSDDKCSTNKYDC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            +L DLP I+LQQVASQVIRWL EEAL VGIKANRDFL L FELEQGE + LVAH+DP+D 
Sbjct  413  NLDDLPVIILQQVASQVIRWLHEEALAVGIKANRDFLCLSFELEQGEILNLVAHVDPEDT  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWL MEDG  +E KL ++        RKFLGYL L V
Sbjct  473  QGCISWWLTMEDG--EEKKLHMN--------RKFLGYLPLDV  504



>gb|AIU49731.1| RNA polymerase II transcription mediator, partial [Gossypium 
raimondii]
Length=517

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 170/222 (77%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            GP LL HFC+SLAHRIFS++VL ELE +V R PY+ L++HPTWHSR SSWT+ MKVPQSI
Sbjct  305  GPGLLGHFCLSLAHRIFSSRVLIELENVVCRVPYLHLMTHPTWHSRKSSWTIFMKVPQSI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+A             KSQF TKV + DD I+VEGEGAPNVVGLFK  SE  CS+N+YDC
Sbjct  365  LHAE------------KSQFHTKVVLSDDRINVEGEGAPNVVGLFKRSSEDICSVNKYDC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP ILLQQVASQVIRWL  EALMVGIK NR FLSL F+LEQGE+V LVAH+DP+D 
Sbjct  413  DLADLPVILLQQVASQVIRWLHGEALMVGIKTNRYFLSLAFDLEQGESVSLVAHVDPEDI  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             G ISWWLVMEDG  ++ KL+++        RKFLG+L+L V
Sbjct  473  QGGISWWLVMEDG--EDWKLQME--------RKFLGHLNLDV  504



>ref|XP_004141551.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Cucumis sativus]
 ref|XP_004156208.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Cucumis sativus]
 gb|KGN52676.1| hypothetical protein Csa_5G650410 [Cucumis sativus]
Length=662

 Score =   288 bits (737),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 175/230 (76%), Gaps = 6/230 (3%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            + DG  LL HFC+SLAHR+F+N VL ELE +V + P+++LISHPTW+SR SSWT  M+VP
Sbjct  415  SNDGSGLLGHFCLSLAHRMFANNVLMELENVVWKVPFLQLISHPTWNSRKSSWTFFMEVP  474

Query  566  QSILNAGNEIHA----SYLDKNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVT  402
             SIL+  N I A     Y   NV K+QF TKV V DDCI++EGEGAPNVVGLF G S+  
Sbjct  475  WSILHP-NSIKARTSDGYQMNNVTKTQFLTKVVVNDDCITIEGEGAPNVVGLFNGNSKDI  533

Query  401  CSINRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLV  222
             S NRY CDLADLP I+L QVASQ+I WL EEAL+ GIKANRDFLSL FELEQGET+ LV
Sbjct  534  YSTNRYSCDLADLPVIILLQVASQIILWLHEEALIWGIKANRDFLSLSFELEQGETLRLV  593

Query  221  AHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            AH+DP+DP GC+SWWLVM+DG  ++ KL  + S+   E RKFLG+LSL V
Sbjct  594  AHVDPEDPQGCLSWWLVMDDGLMEDRKLNFETSDVVPEYRKFLGHLSLEV  643



>gb|AIU49748.1| RNA polymerase II transcription mediator, partial [Manihot esculenta]
Length=517

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 166/222 (75%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCMS+AHRIFSN+ L ELE +V + PY+ L+SHPTW+SR SSWT+LMKVPQSI
Sbjct  305  GSGLLGHFCMSVAHRIFSNRALMELENVVCKVPYLHLVSHPTWNSRISSWTVLMKVPQSI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
                  IHAS      K++FRTK+ V D  I+VE EGAPNVV LFKG S+  CSIN+YDC
Sbjct  365  ------IHAS------KTEFRTKIVVNDGRINVEAEGAPNVVSLFKGSSDDICSINKYDC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL DLP I+LQQVASQVIRWL EEALMVGIKANRDFL L  ELEQGE + LVAH+D +D 
Sbjct  413  DLVDLPVIILQQVASQVIRWLHEEALMVGIKANRDFLCLSLELEQGEVLSLVAHVDAEDA  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLVMEDG  +E KL +D        RKFLGYL L V
Sbjct  473  EGCISWWLVMEDG--EEKKLHMD--------RKFLGYLPLDV  504



>ref|XP_008459609.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Cucumis melo]
Length=662

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 174/230 (76%), Gaps = 6/230 (3%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            + DG  LL HFC+SLAHR+F+N VL ELE +V + P+++LISHPTW+SR SSWT  M+VP
Sbjct  415  SNDGSGLLGHFCLSLAHRMFANNVLMELENVVWKVPFLQLISHPTWNSRKSSWTFFMEVP  474

Query  566  QSILNAGNEIHA----SYLDKNV-KSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVT  402
            +SIL+  N I A    SY   NV K+QF TKV V DDCI++EGEGAPNVVGLF G S+  
Sbjct  475  RSILHP-NSIQARTSDSYQMNNVTKTQFLTKVVVNDDCITIEGEGAPNVVGLFNGNSKDI  533

Query  401  CSINRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLV  222
               NRY CDLADLP I+L QVASQ+I WL EEAL  GIKANRDFLSL FELEQGET+ LV
Sbjct  534  YLTNRYSCDLADLPVIILLQVASQIILWLHEEALTWGIKANRDFLSLSFELEQGETLRLV  593

Query  221  AHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            AH+DP+DP GC+SWWLVM+DG  ++ KL  + S+   E RKFLG LSL V
Sbjct  594  AHVDPEDPQGCLSWWLVMDDGLMEDRKLNFETSDVVPEYRKFLGNLSLEV  643



>gb|AIU49740.1| RNA polymerase II transcription mediator, partial [Chloranthus 
japonicus]
Length=520

 Score =   282 bits (721),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 166/217 (76%), Gaps = 21/217 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCM+LAHRIFSNKVLAELE LVSR PY+ L+SHPTWHSRTSSW+L MKVPQSI
Sbjct  307  GSGLLGHFCMTLAHRIFSNKVLAELENLVSRVPYLHLLSHPTWHSRTSSWSLFMKVPQSI  366

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L++G            +SQF TKV V D+CI+V GEG+PNVV +F+  S   C IN YDC
Sbjct  367  LHSG------------RSQFHTKVVVNDECINVGGEGSPNVVSVFRDSSVDDCLINCYDC  414

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP ILLQQVASQVIRWL EEAL+VG+KA+RDFL L FELEQG+T+GLVAH+DP D 
Sbjct  415  DLADLPVILLQQVASQVIRWLHEEALVVGMKASRDFLCLSFELEQGDTLGLVAHVDPDDV  474

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGY  87
             GCISW++VMEDG  +E K+  D        R+FLG+
Sbjct  475  QGCISWYMVMEDG--EEGKVHTD-------NRRFLGH  502



>ref|XP_010688034.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Beta vulgaris subsp. vulgaris]
Length=652

 Score =   285 bits (730),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 172/223 (77%), Gaps = 2/223 (1%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   L++HFC+SLAHR FSNKVL ELE LV++ PY++LIS PTWHSRTSSW L +KVP+ 
Sbjct  410  DAAGLVNHFCLSLAHRDFSNKVLTELENLVTKIPYLQLISQPTWHSRTSSWALSVKVPEV  469

Query  560  ILNAGNEIHASYLD--KNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            + NA  +   S  D  K+ K  F+T+V V DDCI++EG GAPNVVGLFKG  +   S NR
Sbjct  470  VFNAQCQAWRSDEDQIKDNKLLFQTRVVVKDDCINIEGGGAPNVVGLFKGNPDAMGSKNR  529

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            ++CDL DLP +LL Q+ASQ+I WL EEALMVGIK NRDFL L  ELEQGE + LVAH+DP
Sbjct  530  FNCDLVDLPMVLLLQIASQIISWLHEEALMVGIKTNRDFLCLSLELEQGEKLSLVAHVDP  589

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            +D +GCISWWL++EDG ++E+ L+ D+ +GES  R+FLG+LSL
Sbjct  590  EDELGCISWWLMVEDGSTEEHTLQADLPDGESPSRRFLGHLSL  632



>gb|AIU49723.1| RNA polymerase II transcription mediator, partial [Magnolia denudata]
Length=516

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 167/223 (75%), Gaps = 23/223 (10%)
 Frame = -1

Query  746  TKDGP-NLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKV  570
             KDG   LL HF M+LAHRIFS KV+AELE LVS  PY+ L+SHPTWHSRTSSW+L MKV
Sbjct  300  AKDGGLGLLGHFSMTLAHRIFSKKVMAELENLVSGVPYLHLLSHPTWHSRTSSWSLFMKV  359

Query  569  PQSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            P+SIL+AG            KSQF TKV V D+ IS+ GEGAPNVVGLF+G S  TC +N
Sbjct  360  PESILHAG------------KSQFHTKVVVNDESISISGEGAPNVVGLFRGGSTDTCLMN  407

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
            +YDCDLADLP ILLQQVASQVIRWL +EAL+VG+KA+RDFL L F+LEQG+ + LVAH+D
Sbjct  408  QYDCDLADLPVILLQQVASQVIRWLHKEALIVGMKASRDFLGLCFQLEQGDMLSLVAHVD  467

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLS  81
            P +  GCISWWLVMEDG  ++ K   D        ++FLGYLS
Sbjct  468  PNNSRGCISWWLVMEDG--EDGKHHTD--------KRFLGYLS  500



>gb|EYU29301.1| hypothetical protein MIMGU_mgv1a002570mg [Erythranthe guttata]
Length=657

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 169/224 (75%), Gaps = 5/224 (2%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KD  N+L HFCMS+AHRIFSNKVL+ LE L        L   P   SRTSSWTL MK+PQ
Sbjct  421  KDNSNILGHFCMSIAHRIFSNKVLSLLENL---DALCTLDFSPDLDSRTSSWTLSMKIPQ  477

Query  563  SILNAGNEIHASY--LDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            SIL+AG +I  S     K V+SQF TKV V DD ISVEGEGAP+VVGLFKGK++   SIN
Sbjct  478  SILHAGRQIQTSGGGTIKTVRSQFWTKVVVIDDSISVEGEGAPSVVGLFKGKADGVSSIN  537

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             YD DLADLP ILLQQVASQ+I+WL EE+L VGIKA RDFLSL FELEQGE V LVAH+D
Sbjct  538  GYDSDLADLPIILLQQVASQIIQWLHEESLTVGIKATRDFLSLAFELEQGEIVRLVAHVD  597

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            P+D  GCISWWL +++G+ +E+KL    SN ESE RKFLGYLSL
Sbjct  598  PEDTQGCISWWLTIDNGFIEEHKLHSYTSNFESETRKFLGYLSL  641



>gb|AIU49754.1| RNA polymerase II transcription mediator, partial [Phaseolus 
vulgaris]
Length=515

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 167/222 (75%), Gaps = 23/222 (10%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            + G NLL HF MSL+HRIFS KVLAELE +VS+ PY++LIS+PTWHSR SSWTL M+VPQ
Sbjct  302  EKGSNLLGHFFMSLSHRIFSTKVLAELENVVSKVPYLQLISNPTWHSRASSWTLYMEVPQ  361

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SIL               K QF  K  V D+CI+V+ EG+PNV GLFKGK E T SIN+Y
Sbjct  362  SILRG-------------KRQFWIKAVVNDNCINVKAEGSPNVAGLFKGKIEETHSINKY  408

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            +C+LADLP I+LQQVASQ+I WL +EALMVGIKANRDFL L FELEQGET+GLVA +DP+
Sbjct  409  NCNLADLPVIILQQVASQIINWLYQEALMVGIKANRDFLCLSFELEQGETLGLVASVDPE  468

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            D  GCISWWLVMED  S+E KL ++        RKFLG+LSL
Sbjct  469  DSEGCISWWLVMED--SEEQKLHMN--------RKFLGHLSL  500



>gb|AIU49746.1| RNA polymerase II transcription mediator, partial [Medicago truncatula]
Length=515

 Score =   274 bits (700),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 165/223 (74%), Gaps = 23/223 (10%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            ++ G  LLSHF MSLAHRIFS K+LAELE +V + PY++LIS+PTWHSR SSWTL M+VP
Sbjct  301  SEKGSYLLSHFFMSLAHRIFSTKILAELENVVFKVPYLQLISNPTWHSRGSSWTLFMEVP  360

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
             SIL               K QF TKV V DDCISV+ EG+PNV GLFKGKSE T SIN+
Sbjct  361  PSILRG-------------KRQFWTKVVVIDDCISVKAEGSPNVSGLFKGKSEDTHSINK  407

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            YDC+LADLP I+LQQVASQ+I WL  EALMVGIKANRDFL L FELEQGET+GLVA++DP
Sbjct  408  YDCNLADLPVIILQQVASQIINWLYHEALMVGIKANRDFLCLSFELEQGETLGLVANVDP  467

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            KD  GCISW LVMED  S+  KL  +        RKFLG LSL
Sbjct  468  KDSDGCISWSLVMED--SEVQKLHTN--------RKFLGPLSL  500



>gb|AIU49736.1| RNA polymerase II transcription mediator, partial [Glycine max]
Length=515

 Score =   273 bits (699),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 164/220 (75%), Gaps = 23/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G +LL HF  SLAHRIFS KVLAELE +V + PY++LIS+PTWHSR SSWTL M+VPQSI
Sbjct  304  GSSLLGHFFKSLAHRIFSTKVLAELENVVCKVPYIQLISNPTWHSRASSWTLYMEVPQSI  363

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L               K QF TKV V DDCI+V+ EG+PNV GLFKGK E T SIN+Y+C
Sbjct  364  LRG-------------KRQFWTKVVVNDDCINVKAEGSPNVAGLFKGKIEETHSINKYNC  410

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            +LADLP I+LQQVASQ+I WL +EA+MVGIKANRDFL L  ELEQGET+GLVA +DP+D 
Sbjct  411  NLADLPVIILQQVASQIINWLYQEAMMVGIKANRDFLCLSLELEQGETLGLVASVDPEDS  470

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVMED  S+E KL +         RKFLG+LSL
Sbjct  471  EGCISWWLVMED--SEEQKLHMS--------RKFLGHLSL  500



>ref|XP_008809755.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X2 [Phoenix dactylifera]
Length=556

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 170/223 (76%), Gaps = 5/223 (2%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   +L HFCM++AHRIFSNKVL+ELE LV+  PY++L+SHPTWHSRTSSW+L +KVPQS
Sbjct  317  DSCGVLGHFCMTVAHRIFSNKVLSELESLVNGVPYIQLLSHPTWHSRTSSWSLSLKVPQS  376

Query  560  ILNAGNEIHAS--YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            +  A     +   YL   ++SQF TKV V DD I+V GEGAP+++  F+G S    S+N 
Sbjct  377  VHAARRSKISDDHYLKHGMRSQFHTKVVVKDDQINVSGEGAPSIICSFRGSSSDVFSMNC  436

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            Y CDL DLP ILLQQVASQVIRWL EEAL+VG+KA+RDFL L+F+L+ G+T+GLVAH+DP
Sbjct  437  YGCDLEDLPMILLQQVASQVIRWLHEEALVVGMKASRDFLCLYFDLDHGDTLGLVAHVDP  496

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             D  GCISWW+VM+DG ++  KL      GESE R+FLG+LSL
Sbjct  497  DDINGCISWWVVMDDGSAEGKKL---TDYGESEGRRFLGHLSL  536



>gb|AIU49743.1| RNA polymerase II transcription mediator, partial [Pandanus utilis]
Length=306

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 163/220 (74%), Gaps = 23/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCM+++HRIFS+KVL+ LECLV R PY+ L+SHPTW+SRTSSW+LL+KVPQSI
Sbjct  95   GHGLLGHFCMTISHRIFSSKVLSVLECLVDRVPYLHLLSHPTWYSRTSSWSLLLKVPQSI  154

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L++G            + QF TKV V DD ISV GEGAPN++G F+G S   C++N Y C
Sbjct  155  LHSG------------RLQFHTKVLVNDDQISVSGEGAPNIIGSFRGSSMDICTMNSYGC  202

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL DLP ILLQQVASQVI WL EEAL VG+K N+DFL ++FEL+QG+ +GLVAH+DP D 
Sbjct  203  DLEDLPMILLQQVASQVICWLHEEALEVGMKVNKDFLCMYFELDQGDALGLVAHVDPDDM  262

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWW+VM++G   E KL        S  R+FLG+LSL
Sbjct  263  QGCISWWVVMDNG---EEKL--------SANRRFLGHLSL  291



>gb|AIU49749.1| RNA polymerase II transcription mediator, partial [Erythranthe 
guttata]
Length=512

 Score =   271 bits (693),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 165/218 (76%), Gaps = 26/218 (12%)
 Frame = -1

Query  731  NLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILN  552
            N+L HFCMS+AHRIFSNKVL+ LE L   TPYV LISHPTW SRTSSWTL MK+PQSIL+
Sbjct  306  NILGHFCMSIAHRIFSNKVLSLLENL---TPYVRLISHPTW-SRTSSWTLSMKIPQSILH  361

Query  551  AGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            AG            +SQF TKV V DD ISVEGEGAP+VVGLFKGK++   SIN YD DL
Sbjct  362  AG------------RSQFWTKVVVIDDSISVEGEGAPSVVGLFKGKADGVSSINGYDSDL  409

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP ILLQQVASQ+I+WL EE+L VGIKA RDFLSL FELEQGE V LVAH+DP+D  G
Sbjct  410  ADLPIILLQQVASQIIQWLHEESLTVGIKATRDFLSLAFELEQGEIVRLVAHVDPEDTQG  469

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            CISWWL +++G  +E+KL           RKFLGYLSL
Sbjct  470  CISWWLTIDNG--EEHKLH--------SYRKFLGYLSL  497



>gb|AIU49719.1| RNA polymerase II transcription mediator, partial [Aquilegia 
coerulea]
Length=514

 Score =   271 bits (692),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 167/220 (76%), Gaps = 22/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G +LL HFCM+LAHRIFS+KVLA+LE L ++  Y+ L+S P WHSRTSSW+LLMKVP+SI
Sbjct  302  GYDLLGHFCMTLAHRIFSSKVLAQLENLANKVSYLHLLSRPRWHSRTSSWSLLMKVPESI  361

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L+AG            KSQF TKV+V DDC+++EGEG+PNVV LFK  SE  CS+N YD 
Sbjct  362  LHAG------------KSQFETKVTVIDDCVNIEGEGSPNVVSLFKNGSEEMCSLNSYDY  409

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP ILLQQVASQVIRWL EEAL+VG+K++RDFLSL FELEQG+ + LVA +DP + 
Sbjct  410  DLADLPFILLQQVASQVIRWLHEEALLVGMKSSRDFLSLSFELEQGDRLCLVARVDPSNR  469

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVM DG  +E +L + +        KFLGYLSL
Sbjct  470  EGCISWWLVMADG--EEGRLHIGM--------KFLGYLSL  499



>ref|XP_010910117.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Elaeis guineensis]
Length=675

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 173/220 (79%), Gaps = 6/220 (3%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            +L HFCM++AHRIFSNKVL+ELE LV+  PY++L+SHPTWHSRTSSW+L +K PQS+L+A
Sbjct  439  VLGHFCMTVAHRIFSNKVLSELESLVNGVPYLQLLSHPTWHSRTSSWSLSLKFPQSVLHA  498

Query  548  G--NEIHASY-LDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            G  ++I  ++ L   ++SQF TKV V DD I+V GEGAP+++  F+G S+  CS+N + C
Sbjct  499  GRCSKILDNHNLKHGMRSQFHTKVVVKDDQINVSGEGAPSIICSFRGSSDDVCSLNSFGC  558

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL DLP ILLQQVASQVIRWL EEAL+VG+KA+RDFL L+F L+ G+T+GLVAH+DP D 
Sbjct  559  DLEDLPMILLQQVASQVIRWLHEEALVVGMKASRDFLCLYFGLDHGDTLGLVAHVDPDDI  618

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWW+VM+DG  +   L      GESE R+FLG+LSL
Sbjct  619  NGCISWWVVMDDGLVEGKNL---TEYGESESRRFLGHLSL  655



>ref|XP_008809751.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X1 [Phoenix dactylifera]
Length=671

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 170/223 (76%), Gaps = 5/223 (2%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   +L HFCM++AHRIFSNKVL+ELE LV+  PY++L+SHPTWHSRTSSW+L +KVPQS
Sbjct  432  DSCGVLGHFCMTVAHRIFSNKVLSELESLVNGVPYIQLLSHPTWHSRTSSWSLSLKVPQS  491

Query  560  ILNAGNEIHAS--YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            +  A     +   YL   ++SQF TKV V DD I+V GEGAP+++  F+G S    S+N 
Sbjct  492  VHAARRSKISDDHYLKHGMRSQFHTKVVVKDDQINVSGEGAPSIICSFRGSSSDVFSMNC  551

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            Y CDL DLP ILLQQVASQVIRWL EEAL+VG+KA+RDFL L+F+L+ G+T+GLVAH+DP
Sbjct  552  YGCDLEDLPMILLQQVASQVIRWLHEEALVVGMKASRDFLCLYFDLDHGDTLGLVAHVDP  611

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             D  GCISWW+VM+DG ++  KL      GESE R+FLG+LSL
Sbjct  612  DDINGCISWWVVMDDGSAEGKKL---TDYGESEGRRFLGHLSL  651



>gb|AIU49737.1| RNA polymerase II transcription mediator, partial [Illicium henryi]
Length=516

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 22/222 (10%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            + G  LLSHFCM+LAHRIFS KVLAELE LV+R PY+ L+SHPTWHSRTSSW+L  KVP 
Sbjct  302  EKGFGLLSHFCMTLAHRIFSYKVLAELENLVARVPYLHLLSHPTWHSRTSSWSLTAKVPL  361

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SIL+ G            +SQF TKV V D+CIS+ GEGAPNVVGLF+G S   CS+N Y
Sbjct  362  SILHGG------------RSQFHTKVVVNDECISIGGEGAPNVVGLFRGNSMDVCSVNCY  409

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            DCDLADL  +LLQQVASQV+ WL EEAL+VG+K +RDFL L FELEQG+ + LVA +DP+
Sbjct  410  DCDLADLSVVLLQQVASQVVHWLHEEALIVGMKVSRDFLGLSFELEQGDNLRLVARVDPE  469

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
               GCI+WWL++EDG  +E +L  D        ++FLG+LSL
Sbjct  470  GVHGCITWWLLLEDG--EEMQLHTD--------KRFLGHLSL  501



>ref|XP_010520586.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X2 [Tarenaya hassleriana]
Length=645

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 161/224 (72%), Gaps = 0/224 (0%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KD   LL HFC+SLAHRIFSN++L +LE +V   PY+ L SHPTW+SRTSSWT+ M VP 
Sbjct  402  KDTSGLLDHFCLSLAHRIFSNRILVQLESVVCMVPYLHLTSHPTWNSRTSSWTVFMNVPP  461

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SI+   +        +N+KSQFRTKV V D+ I++EGE APNVVGL KG S    S+N+Y
Sbjct  462  SIIPLRSSETELNGKRNIKSQFRTKVVVIDESITIEGECAPNVVGLPKGSSCNLFSMNKY  521

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            DCDLADLP  +LQQVASQ++ WL EEA  VG+ A+ DFLSL FE+ + E V LVA +DP+
Sbjct  522  DCDLADLPLTILQQVASQILCWLLEEARTVGVNASLDFLSLSFEIGEAERVSLVARVDPE  581

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP GCISWWLV E+G ++E   + D SN   E RK LGYLSL V
Sbjct  582  DPKGCISWWLVTENGAAEEKNFRPDASNETPETRKSLGYLSLDV  625



>ref|XP_010520585.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 isoform X1 [Tarenaya hassleriana]
Length=658

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 161/224 (72%), Gaps = 0/224 (0%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KD   LL HFC+SLAHRIFSN++L +LE +V   PY+ L SHPTW+SRTSSWT+ M VP 
Sbjct  415  KDTSGLLDHFCLSLAHRIFSNRILVQLESVVCMVPYLHLTSHPTWNSRTSSWTVFMNVPP  474

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SI+   +        +N+KSQFRTKV V D+ I++EGE APNVVGL KG S    S+N+Y
Sbjct  475  SIIPLRSSETELNGKRNIKSQFRTKVVVIDESITIEGECAPNVVGLPKGSSCNLFSMNKY  534

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            DCDLADLP  +LQQVASQ++ WL EEA  VG+ A+ DFLSL FE+ + E V LVA +DP+
Sbjct  535  DCDLADLPLTILQQVASQILCWLLEEARTVGVNASLDFLSLSFEIGEAERVSLVARVDPE  594

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP GCISWWLV E+G ++E   + D SN   E RK LGYLSL V
Sbjct  595  DPKGCISWWLVTENGAAEEKNFRPDASNETPETRKSLGYLSLDV  638



>gb|AIU49772.1| RNA polymerase II transcription mediator, partial [Trachycarpus 
fortunei]
Length=471

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 163/217 (75%), Gaps = 23/217 (11%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            +L HFCM++AHRIFSNKVL++LE LV+  PY++L+SHPTWHSRTSSW+L +KVPQS+L+A
Sbjct  263  VLGHFCMTVAHRIFSNKVLSDLESLVNGVPYLQLLSHPTWHSRTSSWSLSLKVPQSVLHA  322

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
            G            KSQF TKV V DD ++V GEGAP+++  F+G S    S+N Y CDL 
Sbjct  323  G------------KSQFHTKVVVKDDQVNVSGEGAPSILCSFRGSSSDVFSMNCYGCDLE  370

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP ILLQQVASQVIRWL EEAL+VG+KA+RDFL L+F+L+ G+T+GLVAH+DP D  GC
Sbjct  371  DLPMILLQQVASQVIRWLHEEALVVGMKASRDFLCLYFDLDHGDTLGLVAHVDPDDIDGC  430

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            ISWW+VM+DG           + G+   R+FLG+LSL
Sbjct  431  ISWWVVMDDG-----------AEGKKLMRRFLGHLSL  456



>gb|KFK26261.1| hypothetical protein AALP_AA8G224100 [Arabis alpina]
Length=650

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 164/224 (73%), Gaps = 8/224 (4%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            + P LL HFC+SLAHRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP S
Sbjct  412  NNPGLLDHFCLSLAHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPS  471

Query  560  ILNAGN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            I+  G+ E  +    +N+K+QFRTKV V DDCI+VE E  PNVVGL K  S    S+N+Y
Sbjct  472  IIPQGSSETQSPDGKRNLKTQFRTKVVVKDDCINVEAECTPNVVGLLKSSSCNLFSMNKY  531

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
            +CDLADLP I+LQQVASQ++ WL EEA  VG K +R+FLSL  E+ +GE V LVA ++P+
Sbjct  532  ECDLADLPVIILQQVASQIVCWLLEEARTVGTKVSREFLSLSLEIVEGERVSLVAQVNPE  591

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            D  GCISWWLVME+G ++E K       G SE RKFLG+LSL V
Sbjct  592  DAKGCISWWLVMENGCTEEKK-------GVSESRKFLGHLSLDV  628



>gb|AIU49728.1| RNA polymerase II transcription mediator, partial [Acorus calamus]
Length=514

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 161/220 (73%), Gaps = 25/220 (11%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCM+LAHRIFSNKV +ELE LVSR PYV L+SHPTWHSR+SSW+L MK+PQS+
Sbjct  305  GIGLLGHFCMTLAHRIFSNKVQSELENLVSRIPYVNLLSHPTWHSRSSSWSLSMKIPQSV  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L AG               F TKV V D+CISV G+GAPNV+G F+  S+  C+ N Y C
Sbjct  365  LRAG---------------FHTKVVVNDECISVSGDGAPNVIGSFRDSSDDACTTNSYGC  409

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            ++ADLP ILLQQVASQV+ WL EEAL+VG+K  RDFL L FEL+ GET+GL AH+DP+D 
Sbjct  410  EVADLPVILLQQVASQVLHWLHEEALIVGMKVRRDFLHLSFELDHGETLGLAAHVDPEDD  469

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            IGCISWWLVMED  S+E +L  D        RKFLGYLSL
Sbjct  470  IGCISWWLVMED--SEEAQLHKD--------RKFLGYLSL  499



>ref|XP_010420857.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Camelina sativa]
Length=544

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 160/220 (73%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  310  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  369

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            GN E  +    +N+K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CD+
Sbjct  370  GNSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDV  429

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
             DLP ++LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  G
Sbjct  430  GDLPVMILQQVASQIVCWLLEEARTVGTKASRDFLSLALEIVEGERVSLVAQVNPEDAKG  489

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E +       G SE RK LG+LSL V
Sbjct  490  CISWWLVMENGCTEERE-------GVSESRKLLGHLSLDV  522



>gb|AIU49764.1| RNA polymerase II transcription mediator, partial [Lactuca sativa]
Length=325

 Score =   252 bits (644),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 167/220 (76%), Gaps = 22/220 (10%)
 Frame = -1

Query  731  NLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILN  552
            NLL HFCMSLAHRIFS KVL +LE L     YV L+SHPTW SRTSSWTL++ VP SIL+
Sbjct  115  NLLGHFCMSLAHRIFSYKVLTQLENLAKSVSYVSLVSHPTWTSRTSSWTLVVDVPPSILH  174

Query  551  AGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            +G            KSQF TKV V DDCI++EGEGAPNVVGLFKGK E +CSINRYDC+L
Sbjct  175  SG------------KSQFHTKVVVIDDCINIEGEGAPNVVGLFKGKCENSCSINRYDCNL  222

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADL  ILLQQVASQ+IRWL EEAL VG+KA+RDFLSL FE+EQGE VG+VAH+DP+D  G
Sbjct  223  ADLHVILLQQVASQIIRWLHEEALSVGMKASRDFLSLCFEVEQGEVVGVVAHVDPEDGEG  282

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             ISWWLV+ +G  +E K+       E E+R +LG+LSL V
Sbjct  283  GISWWLVVGNG--EEYKV-------EREKR-YLGHLSLDV  312



>ref|XP_009131782.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Brassica rapa]
Length=645

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 164/225 (73%), Gaps = 8/225 (4%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            ++   LL HFC+SLAHRIFS +VL +LE +V + PY+ LISHPTW+SRTSSWT+LM VP 
Sbjct  407  ENNSGLLDHFCLSLAHRIFSARVLVQLESVVCKVPYLHLISHPTWNSRTSSWTVLMTVPP  466

Query  563  SILNAGN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            SI+  GN E  +    +N+K+QFRTKV V DDCIS+E E  PNVVGL K  S    S+N+
Sbjct  467  SIIPQGNSESQSPDGKRNLKTQFRTKVVVKDDCISIEAECTPNVVGLLKSTSCNLFSMNK  526

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            Y+CDLADLP I+LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LV  ++P
Sbjct  527  YECDLADLPVIILQQVASQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVGQVNP  586

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +D  GCISWWLVME+G ++E K       G SE RK LG+LSL V
Sbjct  587  EDVKGCISWWLVMENGCTEERK-------GVSESRKSLGHLSLDV  624



>ref|XP_010493125.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Camelina sativa]
Length=653

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  419  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  478

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            GN E  +    +N+K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CD+
Sbjct  479  GNSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDV  538

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP ++LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  G
Sbjct  539  ADLPVMILQQVASQIVCWLLEEARTVGTKASRDFLSLALEIVEGERVSLVAQVNPEDAKG  598

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E +       G SE RK LG+LSL V
Sbjct  599  CISWWLVMENGCTEERE-------GVSESRKLLGHLSLDV  631



>ref|NP_197517.3| RNA polymerase II transcription mediator [Arabidopsis thaliana]
 sp|F4K460.1|MED17_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
17 [Arabidopsis thaliana]
 gb|AED92808.1| RNA polymerase II transcription mediator [Arabidopsis thaliana]
Length=653

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 162/220 (74%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  419  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  478

Query  548  G-NEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            G +E  +    +N+K+QFRTKV V DDCISVE E  PNVVGL K  S    SIN+Y+CD+
Sbjct  479  GRSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSINKYECDV  538

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP ++LQQVASQ++ WL EEA  VG KA+R+FLSL  E+ +GE V LVAH++P+D  G
Sbjct  539  ADLPVMILQQVASQIVCWLLEEARTVGTKASREFLSLSLEIVEGERVSLVAHVNPEDAKG  598

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E +       G SE RK LG+LSL V
Sbjct  599  CISWWLVMENGCTEERE-------GVSESRKLLGHLSLDV  631



>emb|CDX88852.1| BnaA03g07970D [Brassica napus]
Length=644

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 162/220 (74%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SLAHRIFS +VL +LE +V + PY+ LISHPTW+SRTSSWT+LM VP SI+  
Sbjct  412  LLDHFCLSLAHRIFSARVLVQLESVVCKVPYLHLISHPTWNSRTSSWTVLMTVPPSIIPQ  471

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            G+ E  +    +N+K+QFRTKV V DDCIS+E E  PNVVGL K  S    S+N+Y+CDL
Sbjct  472  GSSESQSPDGKRNLKTQFRTKVVVKDDCISIEAECTPNVVGLLKSTSCNLFSMNKYECDL  531

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP I+LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LV  ++P+D  G
Sbjct  532  ADLPVIILQQVASQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVGQVNPEDAKG  591

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E K       G SE RK LG+LSL V
Sbjct  592  CISWWLVMENGCTEERK-------GVSESRKSLGHLSLDV  624



>ref|XP_010420856.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Camelina sativa]
Length=653

 Score =   259 bits (661),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 160/220 (73%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  419  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  478

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            GN E  +    +N+K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CD+
Sbjct  479  GNSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDV  538

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
             DLP ++LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  G
Sbjct  539  GDLPVMILQQVASQIVCWLLEEARTVGTKASRDFLSLALEIVEGERVSLVAQVNPEDAKG  598

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E +       G SE RK LG+LSL V
Sbjct  599  CISWWLVMENGCTEERE-------GVSESRKLLGHLSLDV  631



>ref|XP_006400585.1| hypothetical protein EUTSA_v10012923mg [Eutrema salsugineum]
 gb|ESQ42038.1| hypothetical protein EUTSA_v10012923mg [Eutrema salsugineum]
Length=650

 Score =   258 bits (660),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SLAHRIFS +V+ +LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  416  LLDHFCLSLAHRIFSTRVVVQLESVVCKVPYLHLISHPTWNSRTSSWTVCMTVPPSIIPQ  475

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            G+ E  +    +N+K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CDL
Sbjct  476  GSSETQSLDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDL  535

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP I+LQQV SQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  G
Sbjct  536  ADLPVIILQQVTSQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVAQVNPEDAKG  595

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E K       G SE RK LG+LSL V
Sbjct  596  CISWWLVMENGCTEERK-------GVSESRKLLGHLSLDV  628



>ref|XP_006286416.1| hypothetical protein CARUB_v10002972mg [Capsella rubella]
 gb|EOA19314.1| hypothetical protein CARUB_v10002972mg [Capsella rubella]
Length=651

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 161/220 (73%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  419  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  478

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            G+ E  +    +N+K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CD+
Sbjct  479  GSSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDV  538

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP I+LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  G
Sbjct  539  ADLPVIILQQVASQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVAQVNPEDTKG  598

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E +       G SE RK LG+LSL V
Sbjct  599  CISWWLVMENGCTEERE-------GVSESRKSLGHLSLDV  631



>emb|CDX70919.1| BnaC03g10030D [Brassica napus]
Length=644

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 162/221 (73%), Gaps = 10/221 (5%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SLAHRIFS +VL +LE +V + PY+ LISHPTW+SRTSSWT+LM VP SI+  
Sbjct  412  LLDHFCLSLAHRIFSARVLVQLESVVCKVPYLHLISHPTWNSRTSSWTVLMTVPPSIIPQ  471

Query  548  GNEIHASYLD--KNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCD  375
            G    +  LD  +N+K+QFRT+V V DDCIS+E E  PNVVGL K  S    S+N+Y+CD
Sbjct  472  GRS-ESQSLDGKRNIKTQFRTRVVVKDDCISIEAECTPNVVGLLKSTSCNLFSMNKYECD  530

Query  374  LADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPI  195
            LADLP I+LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LV  ++P+D  
Sbjct  531  LADLPVIILQQVASQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVGQVNPEDVK  590

Query  194  GCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            GCISWWLVME+G ++E K       G SE RK LG+LSL V
Sbjct  591  GCISWWLVMENGCTEERK-------GVSESRKSLGHLSLDV  624



>ref|XP_010454320.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Camelina sativa]
Length=653

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 160/220 (73%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SR SSWT+ M VP SI+  
Sbjct  419  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRASSWTVFMTVPPSIIPQ  478

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            GN E  +    +N+K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CD+
Sbjct  479  GNSETQSPDGKRNLKTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDV  538

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP ++LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  G
Sbjct  539  ADLPVMILQQVASQIVCWLLEEARTVGTKASRDFLSLALEIVEGERVSLVAQVNPEDVKG  598

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E +       G SE RK LG+LSL V
Sbjct  599  CISWWLVMENGCTEERE-------GVSESRKLLGHLSLDV  631



>gb|AIU49758.1| RNA polymerase II transcription mediator, partial [Yucca filamentosa]
Length=517

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 160/222 (72%), Gaps = 22/222 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G +LL HFC+++AHRIFS KVL ELE LV R  Y+ L+SHPTW+SRTSSW++ +KVPQSI
Sbjct  305  GGSLLGHFCLTIAHRIFSKKVLLELETLVGRVSYLHLLSHPTWNSRTSSWSVSLKVPQSI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L++G            +SQF TKV V DD ISV  EGAP+++G F+G +   CSIN Y C
Sbjct  365  LHSG------------RSQFHTKVLVNDDQISVSAEGAPSIIGSFEGNATNICSINCYGC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL DLP  LLQQVASQVI WL EEAL+VG+KA+RDFLSL F ++QGET+GLVAH+DP D 
Sbjct  413  DLEDLPMTLLQQVASQVILWLHEEALVVGMKASRDFLSLKFSMDQGETLGLVAHLDPHDA  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISWWLV++ G  DE  L        S  + FLG+LSL V
Sbjct  473  QGCISWWLVVDHG--DEAPL--------SAEKIFLGHLSLEV  504



>gb|AFW79767.1| hypothetical protein ZEAMMB73_523859 [Zea mays]
Length=300

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 158/226 (70%), Gaps = 6/226 (3%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   LLSHFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ 
Sbjct  57   DDCGLLSHFCMTVAHRIFSNKVHLELESVVSRVPYLHLRSLPTWHSRTSSWSLCLKVPQP  116

Query  560  ILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL  G     S    L    +SQF TKV + D  IS+ GEG+P++VG   GK   +  IN
Sbjct  117  ILATGRVTKPSDYHELKYKSRSQFSTKVILKDGQISLMGEGSPSIVGSLTGKPSDSRLIN  176

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y+CDL DLP +LLQQVASQVI WL +EA+++G+   RDFL L+F+L QGET+GL+AH+D
Sbjct  177  SYNCDLEDLPMMLLQQVASQVIHWLHDEAMILGMNVTRDFLCLYFDLGQGETLGLLAHVD  236

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P D  GCISW+L +E    +    K+   + ESE+R+FLGYLSL V
Sbjct  237  PDDTYGCISWYLTVEHPMEEG---KMSAGSPESEKRRFLGYLSLEV  279



>ref|XP_006842865.1| hypothetical protein AMTR_s00081p00160620 [Amborella trichopoda]
 gb|ERN04540.1| hypothetical protein AMTR_s00081p00160620 [Amborella trichopoda]
Length=668

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 164/223 (74%), Gaps = 5/223 (2%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            DG   L HFC+SL+HRIFS+KVL +LE L +R PYV L+SHPTW+SR S+W+L MKVPQS
Sbjct  429  DGFGFLGHFCVSLSHRIFSHKVLVDLENLAARVPYVHLLSHPTWNSRISAWSLYMKVPQS  488

Query  560  ILNAGNEIHASY-LDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            I++ G     ++ L+K ++SQF TKV V D+ I +EGE AP+VVGLF+  S    SI+ Y
Sbjct  489  IMHLGKTKPETFDLEKGIRSQFYTKVVVNDESICIEGEAAPSVVGLFRSDSVEVRSISGY  548

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
             C L DL  +LLQQVASQV+ W+ EEAL+VG+K  RDFLSLWFE+EQG+ +GLVA ID  
Sbjct  549  HCGLEDLTPMLLQQVASQVVHWIHEEALIVGMKVTRDFLSLWFEVEQGDRLGLVARIDQD  608

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISN-GESERRKFLGYLSL  78
            DP  CI WWLV+ED   + +    D+SN G SE +KFLG+LSL
Sbjct  609  DPHCCIGWWLVLEDARMEGHP---DLSNGGSSESKKFLGHLSL  648



>gb|AIU49769.1| RNA polymerase II transcription mediator, partial [Houttuynia 
cordata]
Length=518

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 161/221 (73%), Gaps = 23/221 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G +LL HFCM+LAHR+FS KVL +LE LVS  PY+ L+SHPTWHSRTSSW+L M VPQS 
Sbjct  305  GYSLLGHFCMTLAHRVFSRKVLIKLENLVSGIPYLHLLSHPTWHSRTSSWSLSMTVPQST  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEV-TCSINRYD  381
            ++A             +SQF TKV V D+ I+V GEGAPNVVGLFKG  +V   S+N YD
Sbjct  365  IHAR------------RSQFYTKVVVRDESINVSGEGAPNVVGLFKGGEQVDVASMNSYD  412

Query  380  CDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKD  201
            C+L DLP +LLQQVASQV+ WL EE+ +VG+KA RDFL+L FEL+QG+ + LVAH+DP D
Sbjct  413  CNLEDLPVMLLQQVASQVVCWLHEESQIVGMKATRDFLALSFELDQGDMLSLVAHVDPDD  472

Query  200  PIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
              GCISWWLVME+  S+E++         S  RKFLG+L+L
Sbjct  473  AQGCISWWLVMEN--SEESRY--------SSERKFLGHLTL  503



>gb|AIU49771.1| RNA polymerase II transcription mediator, partial [Alisma plantago-aquatica]
Length=238

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 148/220 (67%), Gaps = 22/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            GP LLSHFC+++AHRIFS KVL+ LE L    PY+ L+SHPTWHSRTSSW+L MKVP   
Sbjct  26   GPGLLSHFCLTIAHRIFSGKVLSVLENLAGGVPYLHLLSHPTWHSRTSSWSLSMKVPNLA  85

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L +G            + QF TKV V D+CISV GEGA NV+G F G +      N + C
Sbjct  86   LLSG------------RQQFHTKVVVRDECISVIGEGAANVIGSFGGSAMDIRPPNSFGC  133

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DLADLP ILLQQ A QVIRWL EEAL+VG+KA RDFL L+F+LE+G  +GL AH+DP   
Sbjct  134  DLADLPMILLQQAAGQVIRWLHEEALLVGVKATRDFLCLYFDLEEGNKIGLAAHVDPSGA  193

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            +GCISWWLVM+DG  DE   +          RKFLG L L
Sbjct  194  LGCISWWLVMDDG--DEGVSRA--------HRKFLGNLLL  223



>ref|XP_008354374.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 17-like [Malus domestica]
Length=647

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 162/232 (70%), Gaps = 12/232 (5%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K+G  LL HFCMSLAHRIFS K L E+E +V   PY++L S PTW SR+SSW L +K+P
Sbjct  404  AKEGSRLLGHFCMSLAHRIFSIKXLTEMENVVKGAPYLQLXSQPTWXSRSSSWMLSVKIP  463

Query  566  QSILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCS  396
             SI +A  +  AS   ++    KSQF TKV V DDCI+VEGEGAPN+VGLF G  E  CS
Sbjct  464  XSIRHAC-QTQASDMRHVGNVAKSQFHTKVVVTDDCINVEGEGAPNMVGLFNGNXEEICS  522

Query  395  INRYDCDLADLPAILLQQVA----SQVIRWLREEALMVGIKANRDFLSLWFELEQGETVG  228
             NRY+C+L DLP I+LQQV+      V +W    +  VGIKANRDFL L  EL+QGET+ 
Sbjct  523  XNRYNCNLXDLPVIILQQVSLIXXXXVYKW----SSAVGIKANRDFLCLSXELDQGETLS  578

Query  227  LVAHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             VAH++P+D  GCISWWLV++ G+ +E KL  D S+  SE RKFLG+LSL V
Sbjct  579  XVAHVBPEDXXGCISWWLVIDGGFIEERKLSXDTSDAASETRKFLGHLSLEV  630



>ref|XP_002873986.1| hypothetical protein ARALYDRAFT_351112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50245.1| hypothetical protein ARALYDRAFT_351112 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 159/220 (72%), Gaps = 8/220 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  419  LLDHFCLSLTHRIFSNRVLEHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  478

Query  548  GN-EIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            G+ E  +    +N+K QFRTKV V D+CISVE E  PNVVGL K  S    ++N+Y+C +
Sbjct  479  GSSETQSPDGKRNLKMQFRTKVVVKDECISVEAECTPNVVGLLKSSSCNLFAMNKYECGV  538

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADLP I+LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  G
Sbjct  539  ADLPVIILQQVASQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVAQVNPEDAKG  598

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISWWLVME+G ++E +       G SE RK LG+LSL V
Sbjct  599  CISWWLVMENGSTEERE-------GVSESRKLLGHLSLDV  631



>gb|AIU49725.1| RNA polymerase II transcription mediator, partial [Pinellia ternata]
Length=304

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 153/220 (70%), Gaps = 23/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCM++AHR+FS KVL  LE LV   PY+ L+SHPTWHSRTSSW+L +KVP S 
Sbjct  93   GLGLLGHFCMTIAHRVFSKKVLVNLENLVEGVPYLHLLSHPTWHSRTSSWSLTVKVPSS-  151

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
                  IH+S      K QF T V V D+CIS+  EG P+++  F   +  T S+N Y C
Sbjct  152  -----TIHSS------KQQFHTSVVVNDECISISAEGTPSIISTFNRNAMDTSSLNCYSC  200

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            D+ADLP I+LQQ+A+QVI WL ++AL+VGIKA+ DFLSL+ EL QGE +GL+AHIDP+D 
Sbjct  201  DIADLPVIILQQIAAQVIHWLYDQALIVGIKASMDFLSLYLELGQGEKLGLLAHIDPEDV  260

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVM+DG   E+K+           R+FLGYLSL
Sbjct  261  NGCISWWLVMDDGL--EHKV---------HSRRFLGYLSL  289



>gb|AIU49721.1| RNA polymerase II transcription mediator, partial [Arabidopsis 
thaliana]
Length=512

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 151/219 (69%), Gaps = 27/219 (12%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  308  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  367

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
            G            K+QFRTKV V DDCISVE E  PNVVGL K  S    SIN+Y+CD+A
Sbjct  368  G------------KTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSINKYECDVA  415

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP ++LQQVASQ++ WL EEA  VG KA+R+FLSL  E+ +GE V LVAH++P+D  GC
Sbjct  416  DLPVMILQQVASQIVCWLLEEARTVGTKASREFLSLSLEIVEGERVSLVAHVNPEDAKGC  475

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISWWLVME+G                ERRK LG+LSL V
Sbjct  476  ISWWLVMENG---------------EERRKLLGHLSLDV  499



>ref|XP_008654792.1| PREDICTED: uncharacterized protein LOC100279335 isoform X1 [Zea 
mays]
Length=539

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 158/226 (70%), Gaps = 6/226 (3%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   LLSHFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ 
Sbjct  296  DDCGLLSHFCMTVAHRIFSNKVHLELESVVSRVPYLHLRSLPTWHSRTSSWSLCLKVPQP  355

Query  560  ILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL  G     S    L    +SQF TKV + D  IS+ GEG+P++VG   GK   +  IN
Sbjct  356  ILATGRVTKPSDYHELKYKSRSQFSTKVILKDGQISLMGEGSPSIVGSLTGKPSDSRLIN  415

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y+CDL DLP +LLQQVASQVI WL +EA+++G+   RDFL L+F+L QGET+GL+AH+D
Sbjct  416  SYNCDLEDLPMMLLQQVASQVIHWLHDEAMILGMNVTRDFLCLYFDLGQGETLGLLAHVD  475

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P D  GCISW+L +E    +    K+   + ESE+R+FLGYLSL V
Sbjct  476  PDDTYGCISWYLTVEHPMEEG---KMSAGSPESEKRRFLGYLSLEV  518



>gb|EPS70468.1| hypothetical protein M569_04289, partial [Genlisea aurea]
Length=582

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 159/221 (72%), Gaps = 14/221 (6%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            +L HFC +LAHRIFSNKVLA LE LV RTPYV+LI+ PTWHSRTSSWT+ MK+P+SIL++
Sbjct  360  ILDHFCKALAHRIFSNKVLAVLENLVHRTPYVDLITKPTWHSRTSSWTISMKLPRSILDS  419

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVT--CSINRYDCD  375
            G++       KNV+S+F TKV+V DD I VEGEGAP+VVGLFKG+SE     + + YDCD
Sbjct  420  GSQTPIG--SKNVRSKFWTKVTVIDDSIRVEGEGAPSVVGLFKGRSESVSGTTTDGYDCD  477

Query  374  LADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPI  195
            L  LP I+L QV  Q+I WL EEAL+VG+K  RDFLSL FELE GETV LV H+DP+D  
Sbjct  478  LVKLPIIILLQVGGQIIEWLYEEALIVGLKVKRDFLSLRFELEGGETVRLVGHVDPEDAE  537

Query  194  GCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             C+SWWL++            D  +G    +KFLGYL L V
Sbjct  538  SCLSWWLMV-------GDDDDDGPHGS---KKFLGYLPLHV  568



>gb|AIU49762.1| RNA polymerase II transcription mediator, partial [Schrenkiella 
parvula]
Length=512

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 150/219 (68%), Gaps = 26/219 (12%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SLAHRIFS +V+ +LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  307  LLDHFCLSLAHRIFSTRVVVQLESVVCKVPYLHLISHPTWNSRTSSWTVCMTVPPSIIPQ  366

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
            G            K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CDLA
Sbjct  367  G------------KTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDLA  414

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP I+LQQV SQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  GC
Sbjct  415  DLPVIILQQVTSQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVAQVNPEDAKGC  474

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISWWLVME              NGE  +RK LG+LSL V
Sbjct  475  ISWWLVME--------------NGEERKRKLLGHLSLDV  499



>gb|AIU49733.1| RNA polymerase II transcription mediator, partial [Capsella rubella]
Length=512

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 150/219 (68%), Gaps = 27/219 (12%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  308  LLDHFCLSLTHRIFSNRVLVHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  367

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
            G            K+QFRTKV V DDCISVE E  PNVVGL K  S    S+N+Y+CD+A
Sbjct  368  G------------KTQFRTKVVVKDDCISVEAECTPNVVGLLKSSSCNLFSMNKYECDVA  415

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP I+LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  GC
Sbjct  416  DLPVIILQQVASQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVAQVNPEDTKGC  475

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISWWLVME+G                ERRK LG+LSL V
Sbjct  476  ISWWLVMENG---------------EERRKSLGHLSLDV  499



>gb|AIU49745.1| RNA polymerase II transcription mediator, partial [Aristolochia 
tagala]
Length=518

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 162/221 (73%), Gaps = 23/221 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G  LL HFCM+LAHR+FS+KVL ELE LV   PY+ L+SHPTW+SR+SSW+L MKVPQSI
Sbjct  305  GCGLLGHFCMTLAHRLFSHKVLIELENLVHGVPYLHLLSHPTWNSRSSSWSLSMKVPQSI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFK-GKSEVTCSINRYD  381
            ++AG            +SQF TKV V D+CISV GEGAPNVVGLFK G S   CS+N Y 
Sbjct  365  IHAG------------RSQFFTKVVVTDECISVSGEGAPNVVGLFKSGGSADVCSMNSYT  412

Query  380  CDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKD  201
            C+L +L  ILLQQVASQVIRWL EEAL++G+KA+ DFL L FEL+Q +T+ LVAH+DP D
Sbjct  413  CNLENLSLILLQQVASQVIRWLHEEALIIGMKASIDFLGLTFELDQCDTLSLVAHVDPDD  472

Query  200  PIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
              GCISWWLVMEDG  +E+K   D        R+FLG LSL
Sbjct  473  ARGCISWWLVMEDG--EESKFSSD--------RRFLGSLSL  503



>ref|NP_001145828.1| uncharacterized protein LOC100279335 [Zea mays]
 gb|ACF86486.1| unknown [Zea mays]
 gb|ACL52667.1| unknown [Zea mays]
 gb|AFW79766.1| hypothetical protein ZEAMMB73_523859 [Zea mays]
Length=661

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 158/226 (70%), Gaps = 6/226 (3%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   LLSHFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ 
Sbjct  418  DDCGLLSHFCMTVAHRIFSNKVHLELESVVSRVPYLHLRSLPTWHSRTSSWSLCLKVPQP  477

Query  560  ILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL  G     S    L    +SQF TKV + D  IS+ GEG+P++VG   GK   +  IN
Sbjct  478  ILATGRVTKPSDYHELKYKSRSQFSTKVILKDGQISLMGEGSPSIVGSLTGKPSDSRLIN  537

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y+CDL DLP +LLQQVASQVI WL +EA+++G+   RDFL L+F+L QGET+GL+AH+D
Sbjct  538  SYNCDLEDLPMMLLQQVASQVIHWLHDEAMILGMNVTRDFLCLYFDLGQGETLGLLAHVD  597

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P D  GCISW+L +E    +    K+   + ESE+R+FLGYLSL V
Sbjct  598  PDDTYGCISWYLTVEHPMEEG---KMSAGSPESEKRRFLGYLSLEV  640



>ref|XP_006664786.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Oryza brachyantha]
Length=583

 Score =   245 bits (626),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 160/227 (70%), Gaps = 8/227 (4%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   LL HFCM++AHRIFSNKVL ELE +VS  PY+ L S PTWHSRTSSW+L +KVPQ 
Sbjct  343  DDYGLLGHFCMTVAHRIFSNKVLLELESVVSGVPYLHLRSLPTWHSRTSSWSLCLKVPQP  402

Query  560  ILNAGNEIHASYLDKNVK----SQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            IL A + I     +   K    SQF TKV V D  IS+ GEG+P++ G   GKS     I
Sbjct  403  IL-ATDRIAKPSDNHEPKYKSRSQFNTKVIVKDSQISLMGEGSPSIAGSLSGKSSDGHLI  461

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N Y+CDL DLP +LLQQVASQVI WL EEAL++G+   RDFL L+F+LEQGET+GLVAH+
Sbjct  462  NSYNCDLEDLPTMLLQQVASQVIHWLHEEALVLGMNVTRDFLCLYFDLEQGETLGLVAHV  521

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            DP D  GCISW+L + D  +++ K+  D  + E E+R+FLGY+SL V
Sbjct  522  DPDDAYGCISWYLTI-DHPTEDGKMSAD--SYEFEKRRFLGYVSLEV  565



>ref|XP_004967947.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like [Setaria italica]
Length=661

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 158/222 (71%), Gaps = 6/222 (3%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ IL A
Sbjct  425  LLGHFCMTVAHRIFSNKVHLELESVVSRVPYLHLCSLPTWHSRTSSWSLCLKVPQPILAA  484

Query  548  GNEIHASYLDK---NVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
                  S + +     +SQF TKV + D  IS+ GEG+P++ G   GK      IN Y+C
Sbjct  485  DRITKPSDVHEPRYKSRSQFNTKVILKDGQISLMGEGSPSIAGSLTGKPSDGRLINSYNC  544

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL DLP +LLQQVASQVI WL EEA+++G+   RDFL L+F+L+QGET+GLVAH+DP D 
Sbjct  545  DLEDLPMMLLQQVASQVIHWLHEEAMVLGMNVTRDFLCLYFDLDQGETLGLVAHVDPDDA  604

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             GCISW+L + D  ++E K+  D  N E E+R+FLGYLSL V
Sbjct  605  YGCISWYLTV-DHPTEEGKMSAD--NLELEKRRFLGYLSLEV  643



>gb|EEE53678.1| hypothetical protein OsJ_37013 [Oryza sativa Japonica Group]
Length=655

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 159/226 (70%), Gaps = 6/226 (3%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   LL HFC+++AHRIFSNKVL ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ 
Sbjct  415  DDYGLLGHFCLTVAHRIFSNKVLVELESVVSRVPYLHLRSLPTWHSRTSSWSLCLKVPQP  474

Query  560  ILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL A      S    L    +SQF TKV V D  IS+ GEG+P++ G   GK      +N
Sbjct  475  ILAADRIAKPSDNHELKYKSRSQFNTKVIVKDSQISLMGEGSPSIAGSLTGKPSDGYLVN  534

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y+CDL DLP +LLQQVASQVI WL EEAL++G+   RDFL L+F+LEQGET+GLVA++D
Sbjct  535  SYNCDLEDLPTMLLQQVASQVIHWLHEEALVLGMNVTRDFLCLYFDLEQGETLGLVANVD  594

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P D  GCISW+L + D  +++ K+  D  + E E+R+FLGY+SL V
Sbjct  595  PDDTCGCISWYLTI-DHPTEDGKMSAD--SQEFEKRRFLGYVSLEV  637



>ref|NP_001067381.1| Os12g0638600 [Oryza sativa Japonica Group]
 gb|ABA99606.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30400.1| Os12g0638600 [Oryza sativa Japonica Group]
 dbj|BAG89558.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69746.1| hypothetical protein OsI_39278 [Oryza sativa Indica Group]
Length=655

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 159/226 (70%), Gaps = 6/226 (3%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   LL HFC+++AHRIFSNKVL ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ 
Sbjct  415  DDYGLLGHFCLTVAHRIFSNKVLVELESVVSRVPYLHLRSLPTWHSRTSSWSLCLKVPQP  474

Query  560  ILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL A      S    L    +SQF TKV V D  IS+ GEG+P++ G   GK      +N
Sbjct  475  ILAADRIAKPSDNHELKYKSRSQFNTKVIVKDSQISLMGEGSPSIAGSLTGKPSDGYLVN  534

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y+CDL DLP +LLQQVASQVI WL EEAL++G+   RDFL L+F+LEQGET+GLVA++D
Sbjct  535  SYNCDLEDLPTMLLQQVASQVIHWLHEEALVLGMNVTRDFLCLYFDLEQGETLGLVANVD  594

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P D  GCISW+L + D  +++ K+  D  + E E+R+FLGY+SL V
Sbjct  595  PDDTCGCISWYLTI-DHPTEDGKMSAD--SQEFEKRRFLGYVSLEV  637



>gb|AIU49747.1| RNA polymerase II transcription mediator, partial [Canna indica]
Length=516

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 158/222 (71%), Gaps = 22/222 (10%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            K+ P  LSHFC ++AHRIFS+KVLAE+ECLVS  PY++L+SHP WHSRTSSW+L +K P+
Sbjct  302  KEKPCGLSHFCKTVAHRIFSSKVLAEIECLVSGIPYIQLLSHPPWHSRTSSWSLSLKFPE  361

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            S+ ++             +SQF TKV V DD I+V G+GA   +G FKG S    S++ +
Sbjct  362  SVFHSA------------RSQFHTKVVVKDDQITVSGQGALCTLGSFKGSSADASSVSSH  409

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
             CDL DLP ++LQQ+A Q+I WL EEA++VG+KANRDFL L+ +L+QG+ +GLVAH+DP 
Sbjct  410  GCDLEDLPLVILQQIAGQIIHWLHEEAMVVGMKANRDFLCLYVDLDQGDVLGLVAHVDPD  469

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            D  GCISWWL++EDG  ++ K   D        RKFLGYLSL
Sbjct  470  DINGCISWWLILEDG--EDGKFSTD--------RKFLGYLSL  501



>ref|XP_003569428.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Brachypodium distachyon]
Length=656

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 155/226 (69%), Gaps = 6/226 (3%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D  NLL HFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L ++VPQ 
Sbjct  416  DDCNLLGHFCMTVAHRIFSNKVHLELESVVSRVPYLHLQSLPTWHSRTSSWSLCLRVPQP  475

Query  560  ILNAGNEIHASYLDK---NVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL A         D+     +SQF TKV + D  IS+ GEG+P++ G    K      IN
Sbjct  476  ILAADRVTKPLDNDEPKYKSRSQFNTKVILKDGQISLMGEGSPSIAGSLTRKPSDGYLIN  535

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y+CDL DLP +LLQQVASQVI WL EEAL++G+   RDFL L+F+L+QG+T+GLVAH+D
Sbjct  536  SYNCDLEDLPTMLLQQVASQVINWLHEEALVLGMNVTRDFLCLYFDLDQGDTLGLVAHVD  595

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P D  GCISW+L ++    D    K+   N E E+R+FLGYLSL V
Sbjct  596  PDDAYGCISWYLTIDHSAKDG---KMSTDNPEFEKRRFLGYLSLEV  638



>ref|XP_002457523.1| hypothetical protein SORBIDRAFT_03g008700 [Sorghum bicolor]
 gb|EES02643.1| hypothetical protein SORBIDRAFT_03g008700 [Sorghum bicolor]
Length=659

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 157/226 (69%), Gaps = 6/226 (3%)
 Frame = -1

Query  740  DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
            D   LLSHFCM+++HRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ 
Sbjct  419  DDCGLLSHFCMTVSHRIFSNKVHLELESVVSRVPYLHLCSLPTWHSRTSSWSLCLKVPQP  478

Query  560  ILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            IL        S    L    +SQF TKV + D  IS+ GEG+P++ G   GK      IN
Sbjct  479  ILATDRVRKPSDHHKLKYKSRSQFSTKVILKDGQISLMGEGSPSIAGSLTGKPSDGRLIN  538

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y+CDL DLP +LLQQVASQVI WL +EA+++G+   RDFL L+F+L+QGET+GLVAH+D
Sbjct  539  SYNCDLEDLPMMLLQQVASQVIHWLHDEAMVLGMNVTRDFLCLYFDLDQGETLGLVAHVD  598

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            P D  GCISW+L + D   +E K+  D  + E E+R+FLGYLSL V
Sbjct  599  PDDTYGCISWYLTV-DHPMEEGKMSAD--SPELEKRRFLGYLSLEV  641



>gb|AIU49720.1| RNA polymerase II transcription mediator, partial [Arabidopsis 
lyrata]
Length=513

 Score =   238 bits (608),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 148/219 (68%), Gaps = 27/219 (12%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFC+SL HRIFSN+VL  LE +V + PY+ LISHPTW+SRTSSWT+ M VP SI+  
Sbjct  309  LLDHFCLSLTHRIFSNRVLEHLESVVCKVPYLHLISHPTWNSRTSSWTVFMTVPPSIIPQ  368

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
            G            K QFRTKV V D+CISVE E  PNVVGL K  S    ++N+Y+C +A
Sbjct  369  G------------KMQFRTKVVVKDECISVEAECTPNVVGLLKSSSCNLFAMNKYECGVA  416

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP I+LQQVASQ++ WL EEA  VG KA+RDFLSL  E+ +GE V LVA ++P+D  GC
Sbjct  417  DLPVIILQQVASQIVCWLLEEARTVGTKASRDFLSLSLEIVEGERVSLVAQVNPEDAKGC  476

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISWWLVME+G                ERRK LG+LSL V
Sbjct  477  ISWWLVMENG---------------EERRKLLGHLSLDV  500



>gb|AIU49741.1| RNA polymerase II transcription mediator, partial [Ceratophyllum 
demersum]
 gb|AIU49765.1| RNA polymerase II transcription mediator, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=516

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 149/220 (68%), Gaps = 24/220 (11%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G + L HFCMSLAHRIFSNKVL ELE LV+R PY+ L+S PTW +RTSSW+L MKVP+S+
Sbjct  306  GYDFLGHFCMSLAHRIFSNKVLRELENLVNRVPYLHLLSLPTWQARTSSWSLSMKVPESL  365

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
                   HAS      + QF TKV V D+ I++ GEG PN+VGLF G S   C  N Y+C
Sbjct  366  -------HAS------RFQFNTKVVVNDESITIGGEGGPNIVGLFHGNSIDFCPSNSYNC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
             LADLP ILLQQVASQVI WL EEAL VG+KAN+DFL L  EL  G  +GLVAH+DP D 
Sbjct  413  GLADLPMILLQQVASQVIYWLHEEALRVGMKANKDFLCLSIELYDGSVLGLVAHVDPFDI  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             GCISWWLVM            D  +   + R+FLGYLSL
Sbjct  473  QGCISWWLVMH-----------DGDDSMDDDRRFLGYLSL  501



>gb|AIU49759.1| RNA polymerase II transcription mediator, partial [Setaria italica]
Length=517

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 151/219 (69%), Gaps = 22/219 (10%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ IL A
Sbjct  308  LLGHFCMTVAHRIFSNKVHLELESVVSRVPYLHLCSLPTWHSRTSSWSLCLKVPQPILAA  367

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
                         +SQF TKV + D  IS+ GEG+P++ G   GK      IN Y+CDL 
Sbjct  368  D------------RSQFNTKVILKDGQISLMGEGSPSIAGSLTGKPSDGRLINSYNCDLE  415

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP +LLQQVASQVI WL EEA+++G+   RDFL L+F+L+QGET+GLVAH+DP D  GC
Sbjct  416  DLPMMLLQQVASQVIHWLHEEAMVLGMNVTRDFLCLYFDLDQGETLGLVAHVDPDDAYGC  475

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISW+L ++  + +E K+  D        R+FLGYLSL V
Sbjct  476  ISWYLTVD--HPEEGKMSAD--------RRFLGYLSLEV  504



>gb|AIU49770.1| RNA polymerase II transcription mediator, partial [Zea mays]
Length=516

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 153/219 (70%), Gaps = 22/219 (10%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LLSHFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ IL  
Sbjct  307  LLSHFCMTVAHRIFSNKVHLELESVVSRVPYLHLRSLPTWHSRTSSWSLCLKVPQPILAT  366

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
            G            +SQF TKV + D  IS+ GEG+P++VG   GK   +  IN Y+CDL 
Sbjct  367  G------------RSQFSTKVILKDGQISLMGEGSPSIVGSLTGKPSDSRLINSYNCDLE  414

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP +LLQQVASQVI WL +EA+++G+   RDFL L+F+L QGET+GL+AH+DP D  GC
Sbjct  415  DLPMMLLQQVASQVIHWLHDEAMILGMNVTRDFLCLYFDLGQGETLGLLAHVDPDDTYGC  474

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISW+L +E  + +E K+        S  R+FLGYLSL V
Sbjct  475  ISWYLTVE--HPEEGKM--------SAGRRFLGYLSLEV  503



>gb|AIU49757.1| RNA polymerase II transcription mediator, partial [Dioscorea 
oppositifolia]
Length=517

 Score =   235 bits (600),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 157/224 (70%), Gaps = 23/224 (10%)
 Frame = -1

Query  746  TKD-GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKV  570
            TKD G  LL HFC +++HRIFSNKVL+ LE LV R PY+ L+SHPTW+SR SSW+L++KV
Sbjct  301  TKDRGHGLLGHFCTTISHRIFSNKVLSVLEHLVDRVPYLHLLSHPTWYSRQSSWSLILKV  360

Query  569  PQSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
            PQSIL++             + QF TKV V D+ I+V GEGAP+++  F+G S   C++N
Sbjct  361  PQSILHS------------CRLQFHTKVVVNDEQINVSGEGAPSIISSFRGSSTDICAMN  408

Query  389  RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
             Y CDL DL  ILLQQVA QVI WL EEAL VG+  ++DFL L+F L+QG+ +GLVAH+D
Sbjct  409  FYGCDLEDLAIILLQQVAGQVICWLHEEALEVGMNVHKDFLCLFFLLDQGDALGLVAHVD  468

Query  209  PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            P D  GCISWW+VM+D   +E KL  +        R+FLG+LSL
Sbjct  469  PDDVQGCISWWVVMDD--CEEGKLPTN--------RRFLGHLSL  502



>gb|AIU49726.1| RNA polymerase II transcription mediator, partial [Brachypodium 
distachyon]
Length=516

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 151/220 (69%), Gaps = 22/220 (10%)
 Frame = -1

Query  731  NLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILN  552
            NLL HFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L ++VPQ IL 
Sbjct  306  NLLGHFCMTVAHRIFSNKVHLELESVVSRVPYLHLQSLPTWHSRTSSWSLCLRVPQPILA  365

Query  551  AGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
            A             +SQF TKV + D  IS+ GEG+P++ G    K      IN Y+CDL
Sbjct  366  AD------------RSQFNTKVILKDGQISLMGEGSPSIAGSLTRKPSDGYLINSYNCDL  413

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
             DLP +LLQQVASQVI WL EEAL++G+   RDFL L+F+L+QG+T+GLVAH+DP D  G
Sbjct  414  EDLPTMLLQQVASQVINWLHEEALVLGMNVTRDFLCLYFDLDQGDTLGLVAHVDPDDAYG  473

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            CISW+L ++  +S + K+  D        R+FLGYLSL V
Sbjct  474  CISWYLTID--HSKDGKMSTD--------RRFLGYLSLEV  503



>gb|AIU49761.1| RNA polymerase II transcription mediator, partial [Sorghum bicolor]
Length=517

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 151/219 (69%), Gaps = 22/219 (10%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LLSHFCM+++HRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ IL  
Sbjct  308  LLSHFCMTVSHRIFSNKVHLELESVVSRVPYLHLCSLPTWHSRTSSWSLCLKVPQPILAT  367

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
                         +SQF TKV + D  IS+ GEG+P++ G   GK      IN Y+CDL 
Sbjct  368  D------------RSQFSTKVILKDGQISLMGEGSPSIAGSLTGKPSDGRLINSYNCDLE  415

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP +LLQQVASQVI WL +EA+++G+   RDFL L+F+L+QGET+GLVAH+DP D  GC
Sbjct  416  DLPMMLLQQVASQVIHWLHDEAMVLGMNVTRDFLCLYFDLDQGETLGLVAHVDPDDTYGC  475

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISW+L ++  + +E K+  D        R+FLGYLSL V
Sbjct  476  ISWYLTVD--HPEEGKMSAD--------RRFLGYLSLEV  504



>gb|AIU49773.1| RNA polymerase II transcription mediator, partial [Cabomba caroliniana]
Length=397

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 161/219 (74%), Gaps = 21/219 (10%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LLSHFC++LAHRIFS KVL++LE LVSR PY+ L+SHPTWHSRTS+W+L + VP++ILN 
Sbjct  186  LLSHFCLTLAHRIFSYKVLSKLEDLVSRVPYLLLVSHPTWHSRTSTWSLFLDVPETILN-  244

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKS-EVTCSINRYDCDL  372
               +HA+       S+F  KV V ++CI V GEGAPNVVGLF   S +++ +IN YDCDL
Sbjct  245  ---LHANM------SRFHNKVIVNEECIKVAGEGAPNVVGLFVSDSMKISPTINHYDCDL  295

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
             +L  ++L+Q+ASQ++ WL EEAL++G+K  RD L L FELE G+ + LVAH+DP+    
Sbjct  296  ENLSLVILEQIASQIVHWLFEEALILGLKTTRDLLRLSFELELGDKLSLVAHLDPEGEYQ  355

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLG  75
            C++WWL++E+  S++  ++V+        ++FLG+LSLG
Sbjct  356  CLTWWLLIEE--SEDVSMQVE--------KRFLGHLSLG  384



>ref|XP_008679946.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X2 [Zea mays]
Length=557

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 157/226 (69%), Gaps = 7/226 (3%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            T D   LLSHFCM+++HRIFS+KV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVP
Sbjct  314  TPDECGLLSHFCMTVSHRIFSSKVHLELESVVSRVPYLHLCSLPTWHSRTSSWSLCLKVP  373

Query  566  QSILNAGNEIHA----SYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTC  399
            Q IL A + +      S L    +SQF TKV + D  IS+ GEG+P++ G   GK     
Sbjct  374  QPIL-ATDRVRRPSDYSELKCKSRSQFGTKVILKDGQISLMGEGSPSIAGSLAGKPSDGR  432

Query  398  SINRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVA  219
             +N Y+CDL DLP +LLQQVASQVI WL +EA+++G+ A  DFL L+ +L+QGET+GLVA
Sbjct  433  LVNSYNCDLEDLPMMLLQQVASQVIHWLHDEAVVLGMNATIDFLCLYLDLDQGETLGLVA  492

Query  218  HIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLS  81
            H+DP D  GC+SW+L ++   ++E K+     + E E R+FLGYLS
Sbjct  493  HVDPDDTYGCVSWYLTLDHHPTEEGKMSA--GSPELEERRFLGYLS  536



>gb|KJB07724.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=630

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 153/227 (67%), Gaps = 36/227 (16%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE +V R PY+ L++HPTWHS+TSSWT+ +KVPQ
Sbjct  419  KDGPGLLGHFCLSLAHRIFSNRVLVELENVVCRVPYLHLMTHPTWHSQTSSWTIFLKVPQ  478

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEG+GAPNVV LFK  SE   S+
Sbjct  479  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGDGAPNVVSLFKRSSENISSV  538

Query  392  NRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI  213
            N+Y+CDLADLP I+L                                  QG+TV LVAH+
Sbjct  539  NKYECDLADLPVIILL---------------------------------QGDTVSLVAHV  565

Query  212  DPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            +P+D  G I+WWLVMEDG  D+ KL++D+ +G SE RKFLG+L+L V
Sbjct  566  NPEDIKGGIAWWLVMEDGSPDDWKLQMDMYDGASEYRKFLGHLTLDV  612



>ref|NP_001288373.1| mediator of RNA polymerase II transcription subunit 17-like [Zea 
mays]
 ref|XP_008679945.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17-like isoform X1 [Zea mays]
 gb|ACN26952.1| unknown [Zea mays]
 gb|AFW66512.1| hypothetical protein ZEAMMB73_010825 [Zea mays]
 gb|AFW66513.1| hypothetical protein ZEAMMB73_010825 [Zea mays]
Length=660

 Score =   232 bits (592),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 157/226 (69%), Gaps = 7/226 (3%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
            T D   LLSHFCM+++HRIFS+KV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVP
Sbjct  417  TPDECGLLSHFCMTVSHRIFSSKVHLELESVVSRVPYLHLCSLPTWHSRTSSWSLCLKVP  476

Query  566  QSILNAGNEIHA----SYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTC  399
            Q IL A + +      S L    +SQF TKV + D  IS+ GEG+P++ G   GK     
Sbjct  477  QPIL-ATDRVRRPSDYSELKCKSRSQFGTKVILKDGQISLMGEGSPSIAGSLAGKPSDGR  535

Query  398  SINRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVA  219
             +N Y+CDL DLP +LLQQVASQVI WL +EA+++G+ A  DFL L+ +L+QGET+GLVA
Sbjct  536  LVNSYNCDLEDLPMMLLQQVASQVIHWLHDEAVVLGMNATIDFLCLYLDLDQGETLGLVA  595

Query  218  HIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLS  81
            H+DP D  GC+SW+L ++   ++E K+     + E E R+FLGYLS
Sbjct  596  HVDPDDTYGCVSWYLTLDHHPTEEGKMSA--GSPELEERRFLGYLS  639



>dbj|BAK07358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 153/223 (69%), Gaps = 5/223 (2%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LLSHFCM++AH+ FS KV  ELE +VSR PY++L S PTWHSRTSSW+L ++VPQ IL A
Sbjct  233  LLSHFCMTVAHKTFSKKVQLELESVVSRVPYLQLRSLPTWHSRTSSWSLCLRVPQPILAA  292

Query  548  GNEIHASYLD----KNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYD  381
                  S       K+ ++QF TK+ + D  IS+ GEG+P++ G    K      IN Y+
Sbjct  293  DRPTKPSDNGEPKYKSSRTQFNTKIVLKDGQISLLGEGSPSIAGSLTRKPSDGYLINSYN  352

Query  380  CDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKD  201
            CDL DLP ++LQQVASQ+I WL EEAL++G+   RDFL L+F+LE G+T+GLVAH+DP D
Sbjct  353  CDLEDLPTMVLQQVASQIINWLHEEALVLGMSVTRDFLCLYFDLEHGDTLGLVAHVDPDD  412

Query  200  PIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
              GCISW+L ++    ++ K      +  +E+R+FLGYLSL V
Sbjct  413  EYGCISWYLTVDHPAEEDGKAPAG-DDPWAEKRRFLGYLSLEV  454



>gb|EMS61166.1| hypothetical protein TRIUR3_03686 [Triticum urartu]
Length=570

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 154/225 (68%), Gaps = 9/225 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LLSHFCM++AH+ +S KV  ELE +VSR PY++L S PTWHSRTSSW+L ++VPQ IL A
Sbjct  329  LLSHFCMTVAHKTYSKKVQLELESVVSRVPYLQLRSLPTWHSRTSSWSLCLRVPQPILAA  388

Query  548  GNEIHAS------YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
                  S      Y  K+ ++QF TK+ + D  IS+ GEG+P++ G    K      IN 
Sbjct  389  DRPTKPSDNGEPKY--KSSRTQFNTKIVLKDGQISLLGEGSPSIAGSLTRKPSDGYLINS  446

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            Y+CDL DLP ++LQQVASQ+I WL EEAL++G+   RDFL L+F+LE G+T+GLVAH+DP
Sbjct  447  YNCDLEDLPTMVLQQVASQIINWLHEEALVLGMSVTRDFLCLYFDLEHGDTLGLVAHVDP  506

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             D  GCISW+L ++    D+ K      +  +E+R+FLGYLSL V
Sbjct  507  DDEYGCISWYLTVDHPAEDDGKAPA-ADDPWAEKRRFLGYLSLEV  550



>ref|XP_010232920.1| PREDICTED: serine/threonine-protein kinase ATM [Brachypodium 
distachyon]
Length=4646

 Score =   239 bits (610),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 153/223 (69%), Gaps = 6/223 (3%)
 Frame = -1

Query  740   DGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQS  561
             D  NLL HFCM++AHRIFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L ++VPQ 
Sbjct  1407  DDCNLLGHFCMTVAHRIFSNKVHLELESVVSRVPYLHLQSLPTWHSRTSSWSLCLRVPQP  1466

Query  560   ILNAGNEIHASYLDK---NVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSIN  390
             IL A         D+     +SQF TKV + D  IS+ GEG+P++ G    K      IN
Sbjct  1467  ILAADRVTKPLDNDEPKYKSRSQFNTKVILKDGQISLMGEGSPSIAGSLTRKPSDGYLIN  1526

Query  389   RYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHID  210
              Y+CDL DLP +LLQQVASQVI WL EEAL++G+   RDFL L+F+L+QG+T+GLVAH+D
Sbjct  1527  SYNCDLEDLPTMLLQQVASQVINWLHEEALVLGMNVTRDFLCLYFDLDQGDTLGLVAHVD  1586

Query  209   PKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLS  81
             P D  GCISW+L ++    D    K+   N E E+R+FLGYL+
Sbjct  1587  PDDAYGCISWYLTIDHSAKDG---KMSTDNPEFEKRRFLGYLA  1626



>gb|AIU49744.1| RNA polymerase II transcription mediator, partial [Asparagus 
officinalis]
Length=517

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 160/224 (71%), Gaps = 22/224 (10%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            + G +LL HFC+++AHRIFS KVL++LE LV R PY+ L+SHPTW SRTSSW++ +KVPQ
Sbjct  303  EKGGSLLGHFCLTIAHRIFSKKVLSKLETLVGRVPYLHLLSHPTWSSRTSSWSVSLKVPQ  362

Query  563  SILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRY  384
            SIL++G            +S F TKV V +D ISV  EGAP+++G F+G +   CSIN Y
Sbjct  363  SILHSG------------RSHFHTKVVVNNDQISVSAEGAPSIIGSFRGNATNVCSINSY  410

Query  383  DCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPK  204
             CDL DLP  +LQQVASQVI WL EEA +VG+KA++DFLSL F L+QGET+ LVAHIDP 
Sbjct  411  GCDLEDLPMTILQQVASQVILWLHEEASVVGMKASQDFLSLKFNLDQGETLSLVAHIDPH  470

Query  203  DPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            D  GCISWWL+++ G  +E +L        S  R FLGYL+L V
Sbjct  471  DVRGCISWWLIVDHG--EEGQL--------SAERTFLGYLTLQV  504



>ref|XP_009389497.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
17 [Musa acuminata subsp. malaccensis]
Length=672

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 165/219 (75%), Gaps = 5/219 (2%)
 Frame = -1

Query  725  LSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNAG  546
            LSHFC ++AHRIFSNKVLAE+ECLVSR PY++L+SHPTWHSR+SSW+L +K P SI +AG
Sbjct  435  LSHFCKTVAHRIFSNKVLAEIECLVSRIPYLQLLSHPTWHSRSSSWSLSLKFPDSIFHAG  494

Query  545  N-EIHASYLDKN--VKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCD  375
                H +  D     +SQF TK+ V DD ++V GEGAP ++  F+G S    S++ Y CD
Sbjct  495  CLSKHPNIYDVKHLTRSQFHTKIVVKDDQVTVSGEGAPGILSSFRGISADVFSVSCYGCD  554

Query  374  LADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPI  195
            L DLP +LLQQ+A Q+I WL EEAL+VG+K +RDFL L+F+++QG+ +GLVAH+DP D  
Sbjct  555  LDDLPLVLLQQIAGQIIHWLHEEALVVGMKVSRDFLCLYFDVDQGDMLGLVAHVDPNDVD  614

Query  194  GCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            GCISWWL+MEDG +++ K   +   GE E R+FLG+LSL
Sbjct  615  GCISWWLIMEDGLTEDGKFSRE--KGEYENRRFLGHLSL  651



>gb|EMT09196.1| hypothetical protein F775_08586 [Aegilops tauschii]
Length=668

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 154/225 (68%), Gaps = 9/225 (4%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LLSHFCM++AH+ +S KV  ELE +VSR PY++L S PTWHSRTSSW+L ++VPQ IL A
Sbjct  427  LLSHFCMTVAHKTYSKKVQLELESVVSRVPYLQLRSLPTWHSRTSSWSLCLRVPQPILAA  486

Query  548  GNEIHAS------YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
                  S      Y  K+ +++F TK+ + D  IS+ GEG+P++ G    K      IN 
Sbjct  487  DRPTKPSDNGEPKY--KSSRTRFNTKIVLKDGQISLLGEGSPSIAGSLTRKPSDGYLINS  544

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDP  207
            Y+CDL DLP ++LQQVASQ+I WL EEAL++G+   RDFL L+F+LE G+T+GLVAH+DP
Sbjct  545  YNCDLEDLPTMVLQQVASQIINWLHEEALVLGMSVTRDFLCLYFDLEHGDTLGLVAHVDP  604

Query  206  KDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             D  GCISW+L ++    D+ K      +  +E+R+FLGYLSL V
Sbjct  605  DDEYGCISWYLTVDHPAEDDGKAPA-ADDPWAEKRRFLGYLSLEV  648



>gb|AIU49753.1| RNA polymerase II transcription mediator, partial [Panicum virgatum]
Length=517

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 148/219 (68%), Gaps = 22/219 (10%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM+++H+IFSNKV  ELE +VSR PY+ L S PTWHSRTSSW+L +KVPQ IL A
Sbjct  308  LLGHFCMTVSHKIFSNKVHLELESVVSRVPYLHLCSLPTWHSRTSSWSLCLKVPQPILAA  367

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
                         + QF TKV + D  IS+ GEG+P++ G   GK      IN Y+CDL 
Sbjct  368  D------------RLQFNTKVILKDGQISLMGEGSPSIAGSLTGKPSDGRLINSYNCDLE  415

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
            DLP +LLQQVASQVI WL EEA+++G+   RDFL L+F+L+QGET+ LVAH+DP D  GC
Sbjct  416  DLPTMLLQQVASQVIHWLHEEAMVLGMNVTRDFLCLYFDLDQGETLCLVAHVDPDDAYGC  475

Query  188  ISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
            ISW+L ++  + +E K+  D        R+FLG LSL V
Sbjct  476  ISWYLTVD--HPEEGKMSAD--------RRFLGSLSLEV  504



>gb|AIU49739.1| RNA polymerase II transcription mediator, partial [Iris japonica]
Length=517

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 149/220 (68%), Gaps = 22/220 (10%)
 Frame = -1

Query  737  GPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSI  558
            G +   HFCM++AHRIF  KV++ LE LV   PY+ L+SHPTWHSR SSW+L +KVPQ+I
Sbjct  305  GCSFFGHFCMTIAHRIFCRKVMSMLEVLVGGVPYLHLLSHPTWHSRISSWSLSLKVPQTI  364

Query  557  LNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
            L++             +SQF TKV V DD ISV GEG P + G  +G    + S+N Y C
Sbjct  365  LHSS------------RSQFNTKVVVNDDQISVSGEGTPGIAGSLRGDFTDSWSVNSYGC  412

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
            DL DLP ++L QVA+Q+I WL EEAL+VG+K +R FL L+F+L+QGET+GL+A++D +D 
Sbjct  413  DLVDLPMVILHQVANQIIHWLHEEALIVGMKVSRAFLCLYFDLDQGETLGLLANVDAEDV  472

Query  197  IGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             G ISWWLV +DG  +E  L        +E R FLG+LSL
Sbjct  473  EGFISWWLVFDDG--EEGNL--------AEDRIFLGHLSL  502



>gb|AIU49724.1| RNA polymerase II transcription mediator, partial [Musa acuminata]
Length=515

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 158/216 (73%), Gaps = 22/216 (10%)
 Frame = -1

Query  725  LSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNAG  546
            LSHFC ++AHRIFSNKVLAE+ECLVSR PY++L+SHPTWHSR+SSW+L +K P SI +AG
Sbjct  307  LSHFCKTVAHRIFSNKVLAEIECLVSRIPYLQLLSHPTWHSRSSSWSLSLKFPDSIFHAG  366

Query  545  NEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLAD  366
                        +SQF TK+ V DD ++V GEGAP ++  F+G S    S++ Y CDL D
Sbjct  367  ------------RSQFHTKIVVKDDQVTVSGEGAPGILSSFRGISADVFSVSCYGCDLDD  414

Query  365  LPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGCI  186
            LP +LLQQ+A Q+I WL EEAL+VG+K +RDFL L+F+++QG+ +GLVAH+DP D  GCI
Sbjct  415  LPLVLLQQIAGQIIHWLHEEALVVGMKVSRDFLCLYFDVDQGDMLGLVAHVDPNDVDGCI  474

Query  185  SWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            SWWL+MEDG  ++ K         S  R+FLG+LSL
Sbjct  475  SWWLIMEDG--EDGKF--------SRERRFLGHLSL  500



>gb|AIU49768.1| RNA polymerase II transcription mediator, partial [Ginkgo biloba]
Length=513

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 148/218 (68%), Gaps = 25/218 (11%)
 Frame = -1

Query  731  NLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILN  552
            NLL HFCM+L+HRI+  KVL+ELE +V R PY+ L SHPTWHSR S+W L + +PQ++ +
Sbjct  307  NLLRHFCMTLSHRIYCYKVLSELENMV-RVPYLHLFSHPTWHSRVSAWFLYLDIPQTVTH  365

Query  551  AGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDL  372
             G            KS F  K+ V+D+ +S+EGEG PNV GLFKG S   CSI+ Y+C L
Sbjct  366  GG------------KSHFHCKIVVHDESLSIEGEGTPNVGGLFKGSSTEVCSISEYNCGL  413

Query  371  ADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIG  192
            ADL +ILLQQVASQ+I WL  EAL+VG+K  RDFLSL F+L+  E++ LVA ID ++   
Sbjct  414  ADLTSILLQQVASQLIYWLHAEALVVGMKVKRDFLSLSFQLDNSESLALVASIDQRE--Y  471

Query  191  CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
            C++WWL++ D   D+  +K D        ++FLG L+L
Sbjct  472  CVNWWLILND--IDDGLVKPD--------KRFLGPLTL  499



>gb|AIU49722.1| RNA polymerase II transcription mediator, partial [Lilium brownii]
Length=461

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 138/197 (70%), Gaps = 15/197 (8%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM++AHR+ S+KVL+ LE LV+R PY+ L++HPTWHSR S W+L +K+PQSIL+ 
Sbjct  260  LLGHFCMTIAHRVSSSKVLSVLEQLVARVPYLHLLTHPTWHSRKSCWSLALKLPQSILHT  319

Query  548  GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLA  369
            G            + QF TKV V DD ISV GEGAP+++G F+G S  T SIN Y C L 
Sbjct  320  G------------RLQFHTKVVVDDDQISVSGEGAPSIIGSFEGGSPNT-SINSYGCVLE  366

Query  368  DLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDPIGC  189
             LP  +LQQVASQVI WL EEA ++G+KA +DFL L+F L  G+ +G VAH++P D  GC
Sbjct  367  HLPMNILQQVASQVIDWLYEEATLLGMKARKDFLGLYFTLNGGDELGFVAHVNPNDSEGC  426

Query  188  ISWWLVMEDGYSDENKL  138
            ISW  V ED   DEN+L
Sbjct  427  ISWSTVKED--DDENEL  441



>dbj|BAK08012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 154/226 (68%), Gaps = 11/226 (5%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM++AH+IFSNKV  ELE ++SR PY+ L S PTWHSRTSSW+L +++P  IL A
Sbjct  349  LLGHFCMTVAHKIFSNKVQLELESVLSRVPYLHLQSLPTWHSRTSSWSLCLRIPPPILAA  408

Query  548  ---GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
                +     Y  K+ ++QF TK+ + D  IS+ GEG+P++ G    K      IN Y+C
Sbjct  409  DKPSDNGEPKY--KSSRTQFNTKIVLKDVQISLFGEGSPSIAGSLTRKPSDGYLINNYNC  466

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETV-GLVAHIDPKD  201
            DL DLP ++LQQVASQVI WL EE  ++G+   RDFL L+F+L+ G+T+ GLVAH+DP D
Sbjct  467  DLEDLPTMVLQQVASQVINWLHEETQVLGMSVTRDFLGLYFDLDHGDTMLGLVAHVDPDD  526

Query  200  PIGCISWWLVMEDGYSDENKLKVDISNG---ESERRKFLGYLSLGV  72
              GC+SW+L + D  ++E+ +    +NG   E E+ +FLGYLSL V
Sbjct  527  AYGCVSWYLTV-DHPAEEDGM-TPAANGPWAEEEKCRFLGYLSLEV  570



>dbj|BAJ93746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 154/226 (68%), Gaps = 11/226 (5%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM++AH+IFSNKV  ELE ++SR PY+ L S PTWHSRTSSW+L +++P  IL A
Sbjct  340  LLGHFCMTVAHKIFSNKVQLELESVLSRVPYLHLQSLPTWHSRTSSWSLCLRIPPPILAA  399

Query  548  ---GNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
                +     Y  K+ ++QF TK+ + D  IS+ GEG+P++ G    K      IN Y+C
Sbjct  400  DKPSDNGEPKY--KSSRTQFNTKIVLKDVQISLFGEGSPSIAGSLTRKPSDGYLINNYNC  457

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETV-GLVAHIDPKD  201
            DL DLP ++LQQVASQVI WL EE  ++G+   RDFL L+F+L+ G+T+ GLVAH+DP D
Sbjct  458  DLEDLPTMVLQQVASQVINWLHEETQVLGMSVTRDFLGLYFDLDHGDTMLGLVAHVDPDD  517

Query  200  PIGCISWWLVMEDGYSDENKLKVDISNG---ESERRKFLGYLSLGV  72
              GC+SW+L + D  ++E+ +    +NG   E E+ +FLGYLSL V
Sbjct  518  AYGCVSWYLTV-DHPAEEDGM-TPAANGPWAEEEKCRFLGYLSLEV  561



>gb|EMT20869.1| hypothetical protein F775_22791 [Aegilops tauschii]
Length=549

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 146/231 (63%), Gaps = 14/231 (6%)
 Frame = -1

Query  728  LLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNA  549
            LL HFCM++AH+IFSNKV  ELE +VSR PY+ L S PTWHSRTSSW++ ++VPQ IL A
Sbjct  301  LLGHFCMTVAHKIFSNKVQLELESVVSRVPYLHLQSLPTWHSRTSSWSICLRVPQPILAA  360

Query  548  GNEIHAS------YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
                  S      Y  K+ ++QF TK+ + D  IS+ GEG+P++ G    K      IN 
Sbjct  361  DRLTKPSDNGEPKY--KSSRTQFNTKIVLKDGQISLLGEGSPSIAGSLTRKLSDGYLINS  418

Query  386  YDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETV------GL  225
            Y CDL DLP ++LQQVASQVI WL EEA ++G    RDFL L+F+L+ G+T       G+
Sbjct  419  YSCDLEDLPTMVLQQVASQVISWLHEEAQVLGTSVTRDFLGLYFDLDHGDTTPGETRRGV  478

Query  224  VAHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSLGV  72
             AH+DP D  GC+SW+L ++    ++ K          E+ +FLGYLSL V
Sbjct  479  GAHVDPDDAYGCVSWYLTVDQPAEEDRKALAADDPWAEEKCRFLGYLSLEV  529



>ref|XP_002524467.1| hypothetical protein RCOM_0221540 [Ricinus communis]
 gb|EEF37907.1| hypothetical protein RCOM_0221540 [Ricinus communis]
Length=407

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  458  EGEGAPNVVGLFKGKSEVTCSINRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKAN  279
            E EGAPNVVGLFKG S+  CS+N+YDCDLADLP I+LQQVASQVIRWL EEAL VGIKAN
Sbjct  261  EQEGAPNVVGLFKGSSDDVCSVNKYDCDLADLPVIILQQVASQVIRWLHEEALSVGIKAN  320

Query  278  RDFLSLWFELEQGETVGLVAHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRK  99
            RDFL L FELEQGE + LVAH+DP+D  GCISWWLVMEDG+++E KL +DI++  SE RK
Sbjct  321  RDFLCLSFELEQGEVLSLVAHVDPEDTEGCISWWLVMEDGFAEERKLHMDIADEASEYRK  380

Query  98   FLGYLSLGV  72
            FLGYL L +
Sbjct  381  FLGYLPLDI  389



>gb|KCW82816.1| hypothetical protein EUGRSUZ_C04186 [Eucalyptus grandis]
Length=554

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = -1

Query  746  TKDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVP  567
             K G  LL HFCMSLAHRIFSNKVL EL+ +V R PY+ L+S P WHSRTSSWTL MKVP
Sbjct  410  AKAGSGLLGHFCMSLAHRIFSNKVLMELDNVVCRVPYLHLMSQPCWHSRTSSWTLYMKVP  469

Query  566  QSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINR  387
            +SIL+A  +   +   K++K+QFRTK+ V DDCI VEGEGAPNVVGLFKG +E   SINR
Sbjct  470  ESILHACCQKDVNKA-KHIKTQFRTKIVVTDDCIKVEGEGAPNVVGLFKGTAEDISSINR  528

Query  386  YDCDLADLPAILLQQVA  336
            YDCDLADLP I+LQQV+
Sbjct  529  YDCDLADLPVIILQQVS  545



>gb|AIU49756.1| RNA polymerase II transcription mediator, partial [Ricinus communis]
Length=326

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 102/129 (79%), Gaps = 10/129 (8%)
 Frame = -1

Query  458  EGEGAPNVVGLFKGKSEVTCSINRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKAN  279
            E EGAPNVVGLFKG S+  CS+N+YDCDLADLP I+LQQVASQVIRWL EEAL VGIKAN
Sbjct  195  EQEGAPNVVGLFKGSSDDVCSVNKYDCDLADLPVIILQQVASQVIRWLHEEALSVGIKAN  254

Query  278  RDFLSLWFELEQGETVGLVAHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRK  99
            RDFL L FELEQGE + LVAH+DP+D  GCISWWLVMEDG  +E KL +D        RK
Sbjct  255  RDFLCLSFELEQGEVLSLVAHVDPEDTEGCISWWLVMEDG--EERKLHMD--------RK  304

Query  98   FLGYLSLGV  72
            FLGYL L +
Sbjct  305  FLGYLPLDI  313



>gb|KJB07725.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=560

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 3/139 (2%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE +V R PY+ L++HPTWHS+TSSWT+ +KVPQ
Sbjct  419  KDGPGLLGHFCLSLAHRIFSNRVLVELENVVCRVPYLHLMTHPTWHSQTSSWTIFLKVPQ  478

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEG+GAPNVV LFK  SE   S+
Sbjct  479  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGDGAPNVVSLFKRSSENISSV  538

Query  392  NRYDCDLADLPAILLQQVA  336
            N+Y+CDLADLP I+L QV 
Sbjct  539  NKYECDLADLPVIILLQVG  557



>gb|KJB07722.1| hypothetical protein B456_001G041100 [Gossypium raimondii]
Length=586

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 3/139 (2%)
 Frame = -1

Query  743  KDGPNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQ  564
            KDGP LL HFC+SLAHRIFSN+VL ELE +V R PY+ L++HPTWHS+TSSWT+ +KVPQ
Sbjct  419  KDGPGLLGHFCLSLAHRIFSNRVLVELENVVCRVPYLHLMTHPTWHSQTSSWTIFLKVPQ  478

Query  563  SILNAGNEIHAS---YLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSI  393
            SIL+A ++   S    +   VKSQFRTKV V DD I+VEG+GAPNVV LFK  SE   S+
Sbjct  479  SILHAESQSLKSDFQNMKDAVKSQFRTKVVVNDDRINVEGDGAPNVVSLFKRSSENISSV  538

Query  392  NRYDCDLADLPAILLQQVA  336
            N+Y+CDLADLP I+L QV 
Sbjct  539  NKYECDLADLPVIILLQVG  557



>ref|XP_007013395.1| RNA polymerase II transcription mediators isoform 6, partial 
[Theobroma cacao]
 gb|EOY31014.1| RNA polymerase II transcription mediators isoform 6, partial 
[Theobroma cacao]
Length=527

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 84/109 (77%), Gaps = 3/109 (3%)
 Frame = -1

Query  653  VSRTPYVELISHPTWHSRTSSWTLLMKVPQSILNAGNEIHAS---YLDKNVKSQFRTKVS  483
            V R PY+ L++HPTWHSRTSSWT+ MKVPQSIL+  ++   S    +   +KSQFRTKV 
Sbjct  408  VCRVPYLHLMTHPTWHSRTSSWTIFMKVPQSILHVESQSQKSDFQNMKDAIKSQFRTKVV  467

Query  482  VYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDCDLADLPAILLQQVA  336
            V DD I+VEGEGAPNVVGLFK  SE  CS+N+YDCDLADLP I+LQQV 
Sbjct  468  VNDDRINVEGEGAPNVVGLFKRSSEDICSVNKYDCDLADLPVIILQQVG  516



>gb|AIU49755.1| RNA polymerase II transcription mediator, partial [Artemisia 
annua]
Length=95

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 2/87 (2%)
 Frame = -1

Query  395  INRYDCDLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAH  216
            +NRY+C+LADL  ILLQQVASQ+IRWL EEAL+VGIKA+RDFLSL FE+EQGE VGLVAH
Sbjct  1    LNRYECNLADLHVILLQQVASQIIRWLHEEALIVGIKASRDFLSLSFEVEQGELVGLVAH  60

Query  215  IDPKDPIGCISWWLVMEDGYSDENKLK  135
            +DP+D  G ISWWLVM  G  DE KL+
Sbjct  61   VDPEDSEGGISWWLVM--GKGDEYKLQ  85



>gb|KHN46923.1| hypothetical protein glysoja_031223 [Glycine soja]
Length=486

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = -1

Query  341  VASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHI-DPKDPIGCISWWLVME  165
            VASQ+I  L + A++VGIKANRDFL L FELEQGET+GLVA + DP++  GCISWWLVME
Sbjct  378  VASQIINRLYQVAMVVGIKANRDFLCLSFELEQGETLGLVASVVDPENSEGCISWWLVME  437

Query  164  DGYSDENKLKVDISNGESERRKFLGYLSL  78
            D +++E KL + I++G SE RKFLG+LSL
Sbjct  438  DSFAEEQKLHMSITDGASEYRKFLGHLSL  466



>ref|XP_002980116.1| hypothetical protein SELMODRAFT_419660 [Selaginella moellendorffii]
 gb|EFJ18986.1| hypothetical protein SELMODRAFT_419660 [Selaginella moellendorffii]
Length=697

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 114/221 (52%), Gaps = 13/221 (6%)
 Frame = -1

Query  731  NLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILN  552
            NLL +F +   HR   +K+++ L+ LV + P +   SHPTW    S+W +   +P++I+N
Sbjct  380  NLLKNFSVLARHRSAGDKIVSLLDTLVLQVPQLWFRSHPTWRPFVSAWDVYFDIPEAIMN  439

Query  551  AGNEIHASY--LDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
             G   H  +  L +   + F+  + +  + +S+EG      +G      + +  +    C
Sbjct  440  GGQMKHLEWNALVRETSATFQCTLVLRQEILSIEGLDGCMPLG---ASGQESTGMKSCVC  496

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
             +++LP  LL Q+A +VI WL EEA+++G +  RDFLS+ F ++    V LVA      P
Sbjct  497  SVSELPFFLLTQIAGKVIGWLEEEAVLLGPRVKRDFLSIVFNIQNNGLVSLVAA-----P  551

Query  197  IG-CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             G CI+WWL      SD+       S   SER  FLG L L
Sbjct  552  SGYCINWWLRFYSFGSDDTAAASGASAPASER--FLGPLPL  590



>ref|XP_002991906.1| hypothetical protein SELMODRAFT_430185 [Selaginella moellendorffii]
 gb|EFJ07017.1| hypothetical protein SELMODRAFT_430185 [Selaginella moellendorffii]
Length=738

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 114/221 (52%), Gaps = 13/221 (6%)
 Frame = -1

Query  731  NLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLMKVPQSILN  552
            NLL +F +   HR   +K+++ L+ LV + P +   SHPTW    S+W +   +P++I+N
Sbjct  380  NLLKNFSVLARHRSAGDKIVSLLDTLVLQVPQLWFRSHPTWRPFVSAWDVYFDIPEAIMN  439

Query  551  AGNEIHASY--LDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCSINRYDC  378
             G   H  +  L +   + F+  + +  + +S+EG      +G      + +  +    C
Sbjct  440  GGQMKHLEWNVLVRETSATFQCTLVLRQEILSIEGLDGCMPLG---ASGQESTGMKSCVC  496

Query  377  DLADLPAILLQQVASQVIRWLREEALMVGIKANRDFLSLWFELEQGETVGLVAHIDPKDP  198
             +++LP  LL Q+A +VI WL EEA+++G +  RDFLS+ F ++    V LVA      P
Sbjct  497  SVSELPFFLLTQIAGKVIGWLEEEAVLLGPRVKRDFLSIVFNIQNNGLVSLVAA-----P  551

Query  197  IG-CISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             G CI+WWL      SD+       S   SER  FLG L L
Sbjct  552  SGYCINWWLRFYSFGSDDTAAASGASAPASER--FLGPLPL  590



>gb|ACF79783.1| unknown [Zea mays]
Length=89

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 49/70 (70%), Gaps = 2/70 (3%)
 Frame = -1

Query  290  IKANRDFLSLWFELEQGETVGLVAHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGES  111
            + A  DFL L+ +L+QGET+GLVAH+DP D  GC+SW+L ++   ++E K+     + E 
Sbjct  1    MNATIDFLCLYLDLDQGETLGLVAHVDPDDTYGCVSWYLTLDHHPTEEGKMSA--GSPEL  58

Query  110  ERRKFLGYLS  81
            E R+FLGYLS
Sbjct  59   EERRFLGYLS  68



>ref|XP_001782525.1| predicted protein [Physcomitrella patens]
 gb|EDQ52677.1| predicted protein [Physcomitrella patens]
Length=626

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 109/235 (46%), Gaps = 51/235 (22%)
 Frame = -1

Query  743  KDG----PNLLSHFCMSLAHRIFSNKVLAELECLVSRTPYVELISHPTWHSRTSSWTLLM  576
            KDG      L+ H    + HR+ S+K+++ LE  V   P +  ISHPTWH++ S+W L +
Sbjct  397  KDGYAESAGLVKHVSAIMKHRVASDKIISVLEKQVHGVPELRFISHPTWHAQVSTWDLWL  456

Query  575  KVPQSILNAGNEIHASYLDKNVKSQFRTKVSVYDDCISVEGEGAPNVVGLFKGKSEVTCS  396
             VP S L                 +++  V + +D ++        + GL  G      S
Sbjct  457  DVPDSAL---------------LGRWQASVVLREDMLT--------IAGLPSGNGNRLTS  493

Query  395  INRYDCDLADL-PAILLQ--------QVASQVIRWLREEALMVGIKANRDFLSLWFELEQ  243
                 C L++L P +L Q        Q+A+ ++ WL  EA  +G++A  D LS+ FEL+ 
Sbjct  494  TA---CTLSELSPFLLFQRLIADVCWQMAAHLVTWLHAEASGMGVEARLDSLSITFELDN  550

Query  242  GETVGLVAHIDPKDPIGCISWWLVMEDGYSDENKLKVDISNGESERRKFLGYLSL  78
             E V LVA   P      I+W L +    ++++    D ++      +FLG L L
Sbjct  551  FEDVSLVA--SPAVKSHTINWSLRLSGSRTEDS----DATS------RFLGPLPL  593



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420