BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027C19

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08361.1|  unnamed protein product                                123   1e-32   Coffea canephora [robusta coffee]
gb|AAF14242.1|AF110226_1  nuclear RNA binding protein                   112   7e-30   Nicotiana tabacum [American tobacco]
ref|XP_009613635.1|  PREDICTED: plasminogen activator inhibitor 1...    112   7e-30   Nicotiana tomentosiformis
ref|XP_011081281.1|  PREDICTED: RNA-binding protein FUS isoform X1      115   4e-29   Sesamum indicum [beniseed]
ref|XP_009613636.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    105   6e-28   Nicotiana tomentosiformis
ref|XP_009789577.1|  PREDICTED: plasminogen activator inhibitor 1...    112   8e-28   Nicotiana sylvestris
ref|XP_006362472.1|  PREDICTED: plasminogen activator inhibitor 1...    106   6e-27   Solanum tuberosum [potatoes]
ref|XP_009607512.1|  PREDICTED: intracellular hyaluronan-binding ...    111   2e-26   Nicotiana tomentosiformis
ref|XP_006362474.1|  PREDICTED: plasminogen activator inhibitor 1...    107   4e-26   Solanum tuberosum [potatoes]
ref|XP_006362473.1|  PREDICTED: plasminogen activator inhibitor 1...    106   4e-26   
ref|XP_009789579.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    105   6e-26   Nicotiana sylvestris
ref|NP_001275449.1|  plasminogen activator inhibitor 1 RNA-bindin...    104   1e-25   Solanum tuberosum [potatoes]
ref|XP_011081284.1|  PREDICTED: plasminogen activator inhibitor 1...    103   1e-25   Sesamum indicum [beniseed]
ref|XP_004253373.2|  PREDICTED: plasminogen activator inhibitor 1...    102   1e-25   Solanum lycopersicum
ref|XP_011081282.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    102   2e-25   Sesamum indicum [beniseed]
ref|XP_009766508.1|  PREDICTED: plasminogen activator inhibitor 1...  99.0    2e-24   Nicotiana sylvestris
ref|XP_009594553.1|  PREDICTED: plasminogen activator inhibitor 1...  98.2    2e-24   Nicotiana tomentosiformis
ref|XP_004244706.2|  PREDICTED: plasminogen activator inhibitor 1...    107   2e-23   Solanum lycopersicum
ref|XP_009607515.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    100   2e-23   Nicotiana tomentosiformis
ref|XP_010677113.1|  PREDICTED: plasminogen activator inhibitor 1...    100   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002303373.2|  nuclear RNA-binding family protein               96.3    3e-23   
gb|KDP39931.1|  hypothetical protein JCGZ_03462                       99.0    3e-23   Jatropha curcas
ref|XP_009772173.1|  PREDICTED: plasminogen activator inhibitor 1...  95.1    3e-23   Nicotiana sylvestris
ref|XP_011031954.1|  PREDICTED: plasminogen activator inhibitor 1...  94.0    1e-22   Populus euphratica
ref|XP_010661405.1|  PREDICTED: plasminogen activator inhibitor 1...  87.4    2e-22   Vitis vinifera
ref|XP_010275458.1|  PREDICTED: plasminogen activator inhibitor 1...  93.6    2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010258760.1|  PREDICTED: plasminogen activator inhibitor 1...  94.0    3e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002266051.1|  PREDICTED: uncharacterized protein DDB_G0288133  96.7    6e-22   Vitis vinifera
emb|CAN75176.1|  hypothetical protein VITISV_016687                   96.7    6e-22   Vitis vinifera
gb|KDO57096.1|  hypothetical protein CISIN_1g017915mg                 95.9    7e-22   Citrus sinensis [apfelsine]
ref|XP_006477112.1|  PREDICTED: plasminogen activator inhibitor 1...  95.9    7e-22   Citrus sinensis [apfelsine]
ref|XP_006440205.1|  hypothetical protein CICLE_v10020747mg           95.5    9e-22   Citrus clementina [clementine]
ref|XP_002531778.1|  Plasminogen activator inhibitor 1 RNA-bindin...  93.2    2e-21   Ricinus communis
gb|KJB37646.1|  hypothetical protein B456_006G214200                  89.4    3e-21   Gossypium raimondii
gb|KJB37648.1|  hypothetical protein B456_006G214200                  89.0    3e-21   Gossypium raimondii
gb|KJB37651.1|  hypothetical protein B456_006G214200                  89.0    4e-21   Gossypium raimondii
ref|XP_007052330.1|  Hyaluronan / mRNA binding family isoform 4       89.7    6e-21   
ref|XP_007052327.1|  Hyaluronan / mRNA binding family isoform 1       89.7    6e-21   
gb|EYU19470.1|  hypothetical protein MIMGU_mgv1a008507mg              86.7    9e-21   Erythranthe guttata [common monkey flower]
gb|AEI59279.1|  RNA binding protein                                   95.5    1e-20   Suaeda glauca
ref|XP_007039722.1|  Hyaluronan / mRNA binding family                 87.4    2e-20   
gb|KDO57095.1|  hypothetical protein CISIN_1g017915mg                 91.3    2e-20   Citrus sinensis [apfelsine]
gb|KJB37647.1|  hypothetical protein B456_006G214200                  85.5    4e-20   Gossypium raimondii
ref|XP_011093236.1|  PREDICTED: plasminogen activator inhibitor 1...  77.4    5e-20   Sesamum indicum [beniseed]
ref|XP_009772180.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  84.0    7e-20   Nicotiana sylvestris
gb|KDO57093.1|  hypothetical protein CISIN_1g017915mg                 96.3    1e-19   Citrus sinensis [apfelsine]
ref|XP_008369209.1|  PREDICTED: plasminogen activator inhibitor 1...  83.2    2e-19   Malus domestica [apple tree]
ref|XP_007209289.1|  hypothetical protein PRUPE_ppa007665mg           90.5    2e-19   Prunus persica
gb|KJB24880.1|  hypothetical protein B456_004G166200                  85.5    4e-19   Gossypium raimondii
gb|KJB24881.1|  hypothetical protein B456_004G166200                  85.5    4e-19   Gossypium raimondii
gb|KHG17525.1|  Plasminogen activator inhibitor 1 RNA-binding         84.7    6e-19   Gossypium arboreum [tree cotton]
gb|KJB37652.1|  hypothetical protein B456_006G214200                  81.3    6e-19   Gossypium raimondii
gb|KHG27284.1|  hypothetical protein F383_11722                       82.0    8e-19   Gossypium arboreum [tree cotton]
gb|KHG30709.1|  hypothetical protein F383_14338                       81.3    9e-19   Gossypium arboreum [tree cotton]
gb|KDO57094.1|  hypothetical protein CISIN_1g017915mg                 85.1    1e-18   Citrus sinensis [apfelsine]
ref|XP_006477113.1|  PREDICTED: plasminogen activator inhibitor 1...  85.1    1e-18   Citrus sinensis [apfelsine]
ref|XP_006440206.1|  hypothetical protein CICLE_v10020747mg           85.1    1e-18   Citrus clementina [clementine]
gb|KJB25493.1|  hypothetical protein B456_004G194400                  80.9    2e-18   Gossypium raimondii
gb|KHG05539.1|  Plasminogen activator inhibitor 1 RNA-binding         83.6    2e-18   Gossypium arboreum [tree cotton]
gb|KJB24891.1|  hypothetical protein B456_004G166300                  84.0    2e-18   Gossypium raimondii
ref|XP_008238397.1|  PREDICTED: plasminogen activator inhibitor 1...  89.0    2e-18   Prunus mume [ume]
ref|XP_008238398.1|  PREDICTED: plasminogen activator inhibitor 1...  88.6    2e-18   Prunus mume [ume]
ref|XP_011093237.1|  PREDICTED: plasminogen activator inhibitor 1...  71.6    2e-18   Sesamum indicum [beniseed]
ref|XP_008373667.1|  PREDICTED: plasminogen activator inhibitor 1...  83.6    4e-18   Malus domestica [apple tree]
ref|XP_006368965.1|  nuclear RNA-binding family protein               77.0    6e-18   Populus trichocarpa [western balsam poplar]
gb|ABK94426.1|  unknown                                               77.0    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_007134461.1|  hypothetical protein PHAVU_010G049300g           79.0    8e-18   Phaseolus vulgaris [French bean]
ref|XP_003521066.1|  PREDICTED: plasminogen activator inhibitor 1...  82.8    2e-17   Glycine max [soybeans]
ref|XP_006398418.1|  hypothetical protein EUTSA_v10000938mg           88.2    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_004300342.1|  PREDICTED: intracellular hyaluronan-binding ...  84.3    2e-17   Fragaria vesca subsp. vesca
ref|XP_011465242.1|  PREDICTED: plasminogen activator inhibitor 1...  84.3    2e-17   Fragaria vesca subsp. vesca
ref|XP_006853790.1|  hypothetical protein AMTR_s00056p00215280        78.6    2e-17   
gb|KJB37649.1|  hypothetical protein B456_006G214200                  89.0    2e-17   Gossypium raimondii
gb|KJB25494.1|  hypothetical protein B456_004G194400                  77.0    2e-17   Gossypium raimondii
ref|XP_009368154.1|  PREDICTED: plasminogen activator inhibitor 1...  83.2    2e-17   
gb|AAF14244.1|AF110228_1  nuclear RNA binding protein A               83.2    4e-17   Spinacia oleracea
ref|XP_009343931.1|  PREDICTED: plasminogen activator inhibitor 1...  82.4    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_011032359.1|  PREDICTED: plasminogen activator inhibitor 1...  73.6    5e-17   Populus euphratica
gb|KCW77830.1|  hypothetical protein EUGRSUZ_D02118                   79.3    5e-17   Eucalyptus grandis [rose gum]
ref|XP_006837401.1|  hypothetical protein AMTR_s00111p00140620        75.1    1e-16   Amborella trichopoda
ref|XP_011047584.1|  PREDICTED: plasminogen activator inhibitor 1...  72.0    1e-16   Populus euphratica
ref|XP_010104826.1|  hypothetical protein L484_024026                 72.8    2e-16   
ref|XP_007218155.1|  hypothetical protein PRUPE_ppa007410mg           70.5    2e-16   Prunus persica
ref|XP_004306983.1|  PREDICTED: circumsporozoite protein-like         75.1    2e-16   Fragaria vesca subsp. vesca
ref|XP_009368155.1|  PREDICTED: plasminogen activator inhibitor 1...  83.2    2e-16   Pyrus x bretschneideri [bai li]
gb|ABK94354.1|  unknown                                               73.6    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006375155.1|  hypothetical protein POPTR_0014s04820g           73.6    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008232490.1|  PREDICTED: plasminogen activator inhibitor 1...  70.5    3e-16   Prunus mume [ume]
ref|XP_011032341.1|  PREDICTED: plasminogen activator inhibitor 1...  73.9    3e-16   Populus euphratica
ref|XP_003529036.1|  PREDICTED: plasminogen activator inhibitor 1...  77.4    3e-16   Glycine max [soybeans]
ref|XP_009776248.1|  PREDICTED: plasminogen activator inhibitor 1...  71.2    3e-16   Nicotiana sylvestris
ref|XP_009373211.1|  PREDICTED: plasminogen activator inhibitor 1...  69.3    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_008344404.1|  PREDICTED: plasminogen activator inhibitor 1...  70.1    3e-16   
ref|XP_010053519.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  77.4    4e-16   Eucalyptus grandis [rose gum]
emb|CDP21265.1|  unnamed protein product                              76.6    4e-16   Coffea canephora [robusta coffee]
ref|XP_008375773.1|  PREDICTED: LOW QUALITY PROTEIN: plasminogen ...  69.3    4e-16   
gb|KJB37650.1|  hypothetical protein B456_006G214200                  85.1    4e-16   Gossypium raimondii
ref|XP_008347095.1|  PREDICTED: plasminogen activator inhibitor 1...  68.9    6e-16   
ref|XP_010053521.1|  PREDICTED: vasodilator-stimulated phosphopro...  75.5    6e-16   Eucalyptus grandis [rose gum]
ref|NP_001241515.1|  uncharacterized protein LOC100807657             74.3    6e-16   Glycine max [soybeans]
gb|KCW77831.1|  hypothetical protein EUGRSUZ_D02118                   75.5    7e-16   Eucalyptus grandis [rose gum]
ref|XP_010531668.1|  PREDICTED: plasminogen activator inhibitor 1...  72.0    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_010053520.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  76.3    8e-16   Eucalyptus grandis [rose gum]
gb|KJB24892.1|  hypothetical protein B456_004G166300                  83.6    2e-15   Gossypium raimondii
ref|XP_010924482.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  72.8    2e-15   Elaeis guineensis
ref|XP_010531670.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  71.6    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_003624316.1|  Transcription factor                             69.3    3e-15   
ref|XP_004515346.1|  PREDICTED: plasminogen activator inhibitor 1...  71.2    4e-15   Cicer arietinum [garbanzo]
ref|XP_003552493.1|  PREDICTED: plasminogen activator inhibitor 1...  75.5    4e-15   Glycine max [soybeans]
gb|KJB22277.1|  hypothetical protein B456_004G038700                  76.6    4e-15   Gossypium raimondii
ref|XP_006644341.1|  PREDICTED: plasminogen activator inhibitor 1...  74.7    5e-15   Oryza brachyantha
gb|AFK43517.1|  unknown                                               65.5    5e-15   Lotus japonicus
ref|XP_010918620.1|  PREDICTED: plasminogen activator inhibitor 1...  71.6    6e-15   Elaeis guineensis
ref|XP_011017364.1|  PREDICTED: plasminogen activator inhibitor 1...  66.6    7e-15   Populus euphratica
gb|ABY60453.1|  putative nuclear RNA binding protein                  78.6    7e-15   Adonis aestivalis var. palaestina
ref|XP_007139646.1|  hypothetical protein PHAVU_008G047300g           66.6    7e-15   Phaseolus vulgaris [French bean]
ref|XP_002458112.1|  hypothetical protein SORBIDRAFT_03g027110        75.1    7e-15   Sorghum bicolor [broomcorn]
gb|KHN40549.1|  hypothetical protein glysoja_001047                   75.5    8e-15   Glycine soja [wild soybean]
dbj|BAE71280.1|  putative nuclear antigen homolog                     65.1    8e-15   Trifolium pratense [peavine clover]
dbj|BAE71204.1|  putative nuclear antigen homolog                     65.1    9e-15   Trifolium pratense [peavine clover]
ref|XP_002301233.2|  transcription factor family protein              66.2    1e-14   
ref|XP_009395730.1|  PREDICTED: keratin, type II cytoskeletal 2 e...  67.0    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY40563.1|  BnaC02g33290D                                        79.3    2e-14   Brassica napus [oilseed rape]
ref|XP_010531669.1|  PREDICTED: plasminogen activator inhibitor 1...  70.1    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_009101440.1|  PREDICTED: suppressor protein STM1               78.6    2e-14   Brassica rapa
ref|XP_010919739.1|  PREDICTED: plasminogen activator inhibitor 1...  76.6    2e-14   Elaeis guineensis
ref|XP_010919740.1|  PREDICTED: plasminogen activator inhibitor 1...  76.6    2e-14   Elaeis guineensis
ref|XP_006654864.1|  PREDICTED: plasminogen activator inhibitor 1...  72.4    2e-14   Oryza brachyantha
ref|XP_004961407.1|  PREDICTED: RNA-binding protein FUS-like          73.2    3e-14   Setaria italica
gb|EAY75654.1|  hypothetical protein OsI_03559                        72.0    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_008459799.1|  PREDICTED: plasminogen activator inhibitor 1...  69.7    3e-14   Cucumis melo [Oriental melon]
ref|XP_009128949.1|  PREDICTED: suppressor protein STM1-like          79.0    3e-14   Brassica rapa
gb|ABD65038.1|  nuclear RNA binding protein, putative                 78.2    3e-14   Brassica oleracea
ref|NP_001043502.1|  Os01g0603000                                     73.9    4e-14   
ref|XP_009416461.1|  PREDICTED: plasminogen activator inhibitor 1...  71.2    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003567795.1|  PREDICTED: plasminogen activator inhibitor 1...  71.6    4e-14   Brachypodium distachyon [annual false brome]
gb|ABR26138.1|  salt tolerance protein 2                              73.6    5e-14   Oryza sativa Indica Group [Indian rice]
gb|ABD64914.1|  nuclear RNA binding protein, putative                 77.0    5e-14   Brassica oleracea
emb|CDY43435.1|  BnaAnng07070D                                        76.6    6e-14   Brassica napus [oilseed rape]
emb|CDY67886.1|  BnaCnng56800D                                        76.6    6e-14   Brassica napus [oilseed rape]
gb|KFK31390.1|  hypothetical protein AALP_AA6G105700                  77.4    6e-14   Arabis alpina [alpine rockcress]
ref|NP_001044098.1|  Os01g0721900                                     70.5    7e-14   
gb|EAZ13376.1|  hypothetical protein OsJ_03294                        70.5    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009114287.1|  PREDICTED: uncharacterized protein LOC103839539  77.4    8e-14   Brassica rapa
gb|AFW81314.1|  plasminogen activator inhibitor 1 RNA-binding pro...  71.2    8e-14   
ref|NP_001148572.1|  plasminogen activator inhibitor 1 RNA-bindin...  71.2    8e-14   Zea mays [maize]
ref|XP_007142624.1|  hypothetical protein PHAVU_007G003500g           67.0    8e-14   Phaseolus vulgaris [French bean]
ref|XP_009410905.1|  PREDICTED: plasminogen activator inhibitor 1...  70.1    9e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002511578.1|  RNA binding protein, putative                    78.2    1e-13   Ricinus communis
ref|XP_008810382.1|  PREDICTED: plasminogen activator inhibitor 1...  68.6    1e-13   Phoenix dactylifera
ref|XP_004969088.1|  PREDICTED: plasminogen activator inhibitor 1...  68.9    1e-13   Setaria italica
gb|EAY74854.1|  hypothetical protein OsI_02745                        73.9    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004150996.1|  PREDICTED: uncharacterized protein LOC101210473  61.6    2e-13   Cucumis sativus [cucumbers]
ref|XP_009396539.1|  PREDICTED: plasminogen activator inhibitor 1...  69.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798813.1|  PREDICTED: plasminogen activator inhibitor 1...  72.4    2e-13   Phoenix dactylifera
ref|XP_008798814.1|  PREDICTED: plasminogen activator inhibitor 1...  72.4    2e-13   Phoenix dactylifera
gb|ABR25759.1|  nuclear antigen                                       73.9    2e-13   Oryza sativa Indica Group [Indian rice]
gb|EAY99238.1|  hypothetical protein OsI_21200                        70.9    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_002440366.1|  hypothetical protein SORBIDRAFT_09g030400        73.2    3e-13   Sorghum bicolor [broomcorn]
ref|NP_001056483.1|  Os05g0589600                                     70.5    3e-13   
emb|CDY33522.1|  BnaA06g35510D                                        75.5    3e-13   Brassica napus [oilseed rape]
ref|XP_004961035.1|  PREDICTED: insulin receptor substrate 4-like     73.2    3e-13   Setaria italica
ref|XP_002870099.1|  hypothetical protein ARALYDRAFT_493124           77.0    3e-13   Arabidopsis lyrata subsp. lyrata
gb|EYU19467.1|  hypothetical protein MIMGU_mgv1a008831mg              68.2    4e-13   Erythranthe guttata [common monkey flower]
ref|XP_006280739.1|  hypothetical protein CARUB_v10026708mg           69.7    5e-13   Capsella rubella
gb|KHN27127.1|  hypothetical protein glysoja_032895                   67.8    6e-13   Glycine soja [wild soybean]
ref|XP_003556572.1|  PREDICTED: plasminogen activator inhibitor 1...  68.2    6e-13   Glycine max [soybeans]
gb|KHN11561.1|  hypothetical protein glysoja_006014                   63.5    7e-13   Glycine soja [wild soybean]
gb|KHN00198.1|  hypothetical protein glysoja_034729                   67.0    7e-13   Glycine soja [wild soybean]
ref|XP_004140509.1|  PREDICTED: uncharacterized protein LOC101209927  65.9    8e-13   Cucumis sativus [cucumbers]
emb|CDY28966.1|  BnaA02g25100D                                        73.6    1e-12   Brassica napus [oilseed rape]
gb|ACL54182.1|  unknown                                               70.1    1e-12   Zea mays [maize]
ref|NP_001281195.1|  plasminogen activator inhibitor 1 RNA-bindin...  70.5    2e-12   Zea mays [maize]
gb|AAM64962.1|  nuclear RNA binding protein A-like protein            72.4    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434652.1|  PREDICTED: plasminogen activator inhibitor 1...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|NP_199532.1|  Hyaluronan / mRNA binding family protein            71.6    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449600.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010449709.1|  PREDICTED: plasminogen activator inhibitor 1...  64.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010449710.1|  PREDICTED: plasminogen activator inhibitor 1...  63.5    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_008675099.1|  PREDICTED: plasminogen activator inhibitor 1...  69.7    3e-12   Zea mays [maize]
gb|AAM63072.1|  nuclear RNA binding protein A-like protein            70.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003568032.1|  PREDICTED: probable H/ACA ribonucleoprotein ...  71.6    3e-12   Brachypodium distachyon [annual false brome]
gb|EEE64473.1|  hypothetical protein OsJ_19323                        71.6    3e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CDX76586.1|  BnaA08g08140D                                        66.6    3e-12   
ref|XP_002870130.1|  hypothetical protein ARALYDRAFT_493188           64.7    4e-12   
ref|XP_002440127.1|  hypothetical protein SORBIDRAFT_09g026550        71.2    4e-12   Sorghum bicolor [broomcorn]
gb|EEC79581.1|  hypothetical protein OsI_20751                        71.2    4e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010481348.1|  PREDICTED: plasminogen activator inhibitor 1...  73.6    4e-12   Camelina sativa [gold-of-pleasure]
ref|NP_001056139.1|  Os05g0533100                                     70.9    5e-12   
ref|XP_010441486.1|  PREDICTED: plasminogen activator inhibitor 1...  73.2    5e-12   Camelina sativa [gold-of-pleasure]
gb|KFK22256.1|  hypothetical protein AALP_AAs66747U001100             65.5    5e-12   Arabis alpina [alpine rockcress]
gb|AAT47083.1|  unknown protein                                       70.9    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010481347.1|  PREDICTED: plasminogen activator inhibitor 1...  73.6    5e-12   Camelina sativa [gold-of-pleasure]
dbj|BAG90611.1|  unnamed protein product                              70.9    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011101848.1|  PREDICTED: plasminogen activator inhibitor 1...  53.1    6e-12   Sesamum indicum [beniseed]
gb|ACG24258.1|  plasminogen activator inhibitor 1 RNA-binding pro...  70.1    7e-12   Zea mays [maize]
gb|EMT08444.1|  hypothetical protein F775_29168                       69.7    8e-12   
ref|NP_193485.1|  hyaluronan / mRNA binding family                    70.1    8e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863351.1|  hypothetical protein ARALYDRAFT_494257           68.9    8e-12   
dbj|BAJ98247.1|  predicted protein                                    70.9    9e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009108277.1|  PREDICTED: plasminogen activator inhibitor 1...  64.7    9e-12   Brassica rapa
ref|XP_001760974.1|  predicted protein                                68.6    9e-12   
gb|EMS56112.1|  hypothetical protein TRIUR3_18406                     71.2    1e-11   Triticum urartu
ref|XP_004969787.1|  PREDICTED: eukaryotic translation initiation...  69.3    1e-11   Setaria italica
emb|CDY65881.1|  BnaAnng21260D                                        64.7    1e-11   Brassica napus [oilseed rape]
gb|EYU40365.1|  hypothetical protein MIMGU_mgv1a008102mg              58.5    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_006414296.1|  hypothetical protein EUTSA_v10025552mg           67.8    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009108276.1|  PREDICTED: plasminogen activator inhibitor 1...  64.3    1e-11   Brassica rapa
ref|XP_010494951.1|  PREDICTED: plasminogen activator inhibitor 1...  71.6    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010439990.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  70.9    1e-11   Camelina sativa [gold-of-pleasure]
gb|ADE76006.1|  unknown                                               58.2    2e-11   Picea sitchensis
ref|XP_010434762.1|  PREDICTED: plasminogen activator inhibitor 1...  64.7    2e-11   Camelina sativa [gold-of-pleasure]
ref|NP_001078724.1|  Hyaluronan / mRNA binding family protein         72.0    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EMT12851.1|  hypothetical protein F775_28068                       71.6    2e-11   
emb|CDY35615.1|  BnaC01g21370D                                        63.5    3e-11   Brassica napus [oilseed rape]
ref|XP_003569708.1|  PREDICTED: RNA-binding protein FUS-like          68.2    3e-11   Brachypodium distachyon [annual false brome]
gb|ABD65067.1|  nuclear RNA binding protein, putative                 69.7    3e-11   Brassica oleracea
gb|KEH17858.1|  nuclear RNA-binding-like protein                      58.5    3e-11   Medicago truncatula
dbj|BAJ96699.1|  predicted protein                                    72.0    3e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68133.1|  hypothetical protein TRIUR3_26332                     67.8    3e-11   Triticum urartu
ref|XP_009145362.1|  PREDICTED: plasminogen activator inhibitor 1...  62.8    3e-11   Brassica rapa
ref|XP_009145376.1|  PREDICTED: plasminogen activator inhibitor 1...  62.8    4e-11   Brassica rapa
dbj|BAE71297.1|  hypothetical protein                                 72.0    4e-11   Trifolium pratense [peavine clover]
gb|AAS75737.1|  thermoinhibition-associated THB-4 protein             67.8    4e-11   Tagetes minuta
ref|XP_010440090.1|  PREDICTED: uncharacterized protein LOC104723416  63.9    5e-11   
ref|XP_006655517.1|  PREDICTED: plasminogen activator inhibitor 1...  71.6    5e-11   
ref|XP_006414219.1|  hypothetical protein EUTSA_v10025512mg           67.8    6e-11   Eutrema salsugineum [saltwater cress]
ref|XP_008465866.1|  PREDICTED: plasminogen activator inhibitor 1...  57.4    6e-11   Cucumis melo [Oriental melon]
dbj|BAJ89734.1|  predicted protein                                    67.0    6e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS72575.1|  hypothetical protein M569_02184                       65.5    6e-11   Genlisea aurea
ref|XP_006285507.1|  hypothetical protein CARUB_v10006948mg           71.2    6e-11   Capsella rubella
ref|XP_009108330.1|  PREDICTED: plasminogen activator inhibitor 1...  67.8    8e-11   Brassica rapa
ref|XP_004148350.1|  PREDICTED: uncharacterized protein LOC101207608  56.6    1e-10   Cucumis sativus [cucumbers]
emb|CDX76567.1|  BnaA08g08330D                                        67.4    1e-10   
ref|XP_008650627.1|  PREDICTED: DNA ligase 1-like                     68.6    1e-10   
ref|XP_010925494.1|  PREDICTED: protein argonaute 2-like              56.6    1e-10   Elaeis guineensis
ref|XP_008811725.1|  PREDICTED: uncharacterized protein LOC103722810  58.2    3e-10   Phoenix dactylifera
ref|XP_006284012.1|  hypothetical protein CARUB_v10005134mg           65.5    3e-10   Capsella rubella
gb|AES80534.2|  nuclear RNA-binding-like protein                      69.7    3e-10   Medicago truncatula
ref|XP_001785274.1|  predicted protein                                63.9    4e-10   
ref|NP_193416.1|  hyaluronan / mRNA binding domain-containing pro...  65.5    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54489.1|  plasminogen activator inhibitor 1 RNA-binding pro...  64.3    6e-10   Phaseolus vulgaris [French bean]
ref|NP_001078399.1|  hyaluronan / mRNA binding domain-containing ...  64.7    6e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43474.1|  BnaC08g10790D                                        62.0    7e-10   Brassica napus [oilseed rape]
gb|KFK24045.1|  hypothetical protein AALP_AAs42697U000600             68.2    9e-10   Arabis alpina [alpine rockcress]
ref|NP_001078400.1|  hyaluronan / mRNA binding domain-containing ...  63.9    1e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CAA66481.1|  transcription factor                                 47.8    1e-09   Vicia faba var. minor [tick bean]
emb|CDY38403.1|  BnaC01g10120D                                        63.9    1e-09   Brassica napus [oilseed rape]
ref|XP_002991714.1|  hypothetical protein SELMODRAFT_448524           67.4    1e-09   Selaginella moellendorffii
emb|CDM84169.1|  unnamed protein product                              67.0    2e-09   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA57853.1|  TPA: hypothetical protein ZEAMMB73_322547            66.2    2e-09   
gb|EMT09866.1|  hypothetical protein F775_32096                       66.6    2e-09   
gb|EMS59053.1|  hypothetical protein TRIUR3_33029                     66.2    2e-09   Triticum urartu
gb|ABD65145.1|  nuclear RNA binding protein, putative                 66.6    2e-09   Brassica oleracea
gb|KHG04303.1|  hypothetical protein F383_01005                       58.5    3e-09   Gossypium arboreum [tree cotton]
ref|XP_001756282.1|  predicted protein                                60.5    3e-09   
gb|KDP28866.1|  hypothetical protein JCGZ_14637                       53.9    4e-09   Jatropha curcas
ref|XP_009605755.1|  PREDICTED: plasminogen activator inhibitor 1...  46.6    5e-09   Nicotiana tomentosiformis
tpg|DAA57846.1|  TPA: hypothetical protein ZEAMMB73_955694            65.5    5e-09   
gb|AAM61393.1|  nuclear antigen homolog                               65.5    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130695.1|  PREDICTED: intracellular hyaluronan-binding ...  65.1    6e-09   Brassica rapa
ref|XP_010231993.1|  PREDICTED: uncharacterized protein LOC100831026  59.7    6e-09   
gb|KHN46561.1|  hypothetical protein glysoja_032653                   65.5    7e-09   Glycine soja [wild soybean]
emb|CDX90469.1|  BnaA03g43120D                                        65.1    7e-09   
ref|XP_001767830.1|  predicted protein                                59.3    7e-09   
ref|XP_010926667.1|  PREDICTED: protein argonaute 3-like              57.4    7e-09   
ref|XP_009136852.1|  PREDICTED: plasminogen activator inhibitor 1...  65.1    7e-09   Brassica rapa
ref|XP_008792951.1|  PREDICTED: circumsporozoite protein-like         56.2    1e-08   Phoenix dactylifera
ref|XP_009406178.1|  PREDICTED: plasminogen activator inhibitor 1...  50.1    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383830.1|  PREDICTED: keratin, type I cytoskeletal 9-like   58.2    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275394.1|  nuclear RNA binding protein                      48.5    2e-08   Solanum tuberosum [potatoes]
ref|XP_006414295.1|  hypothetical protein EUTSA_v10025552mg           62.4    5e-08   
ref|XP_010246647.1|  PREDICTED: aspartate, glycine, lysine and se...  55.5    6e-08   Nelumbo nucifera [Indian lotus]
emb|CAC85227.1|  salt tolerance protein 1                             50.4    6e-08   Beta vulgaris [beet]
ref|XP_010692032.1|  PREDICTED: uncharacterized protein DDB_G0288...  50.4    6e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004229741.1|  PREDICTED: plasminogen activator inhibitor 1...  46.6    8e-08   
ref|XP_004492923.1|  PREDICTED: intracellular hyaluronan-binding ...  43.1    1e-07   Cicer arietinum [garbanzo]
ref|XP_006284013.1|  hypothetical protein CARUB_v10005134mg           61.2    1e-07   
ref|XP_006848446.1|  hypothetical protein AMTR_s00013p00244720        54.3    2e-07   
gb|ABI18976.1|  nuclear-localized RNA binding protein                 43.9    3e-07   
ref|XP_008459800.1|  PREDICTED: plasminogen activator inhibitor 1...  40.8    5e-07   
ref|XP_002988573.1|  hypothetical protein SELMODRAFT_447366           58.2    8e-07   
ref|XP_009388577.1|  PREDICTED: plasminogen activator inhibitor 1...  53.1    8e-07   
gb|KHN13635.1|  UDP-glucose 4-epimerase GEPI48                        58.5    9e-07   
ref|XP_002979268.1|  hypothetical protein SELMODRAFT_444118           57.8    2e-06   
ref|XP_008793172.1|  PREDICTED: uncharacterized protein DDB_G0288...  45.4    2e-06   
gb|AAF14245.1|AF110229_1  nuclear RNA binding protein B               48.5    2e-06   
gb|AAF14246.1|AF110230_1  nuclear RNA binding protein C               55.5    4e-06   
gb|EPS59059.1|  hypothetical protein M569_15751                       49.7    6e-06   
ref|XP_002458418.1|  hypothetical protein SORBIDRAFT_03g033140        50.4    8e-06   
ref|XP_001760895.1|  predicted protein                                48.9    1e-05   
emb|CAN80478.1|  hypothetical protein VITISV_018750                   49.3    5e-05   
ref|XP_003635425.2|  PREDICTED: interleukin enhancer-binding fact...  49.3    5e-05   
ref|XP_010646835.1|  PREDICTED: uncharacterized protein LOC100262339  48.5    9e-05   
ref|XP_002534519.1|  RNA binding protein, putative                    52.4    1e-04   
ref|XP_010685112.1|  PREDICTED: epsin-like                            52.0    3e-04   
gb|ACU21341.1|  unknown                                               50.8    3e-04   
dbj|BAH56853.1|  AT5G47210                                            48.1    6e-04   
ref|XP_011008634.1|  PREDICTED: spore wall protein 2-like             50.4    8e-04   
gb|AAS07374.1|  hypothetical protein                                  50.4    8e-04   
ref|NP_001173713.1|  Os03g0845300                                     50.1    8e-04   
gb|EAY92561.1|  hypothetical protein OsI_14301                        50.4    9e-04   



>emb|CDP08361.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   123 bits (308),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 6/112 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL--depevkepedkEMT  596
            PTDEIAPE EEP    VN+G      EKQ GQE  GD  KDS +   E + KEPE+KEMT
Sbjct  203  PTDEIAPETEEP----VNEGEKNADAEKQSGQETVGDGNKDSHVDEPEEKEKEPEEKEMT  258

Query  595  LDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            L+EY+KLLEEKRK++LAS+PEERKV LDKEFESM LL+NKKNDD+VF+KLGS
Sbjct  259  LEEYQKLLEEKRKSLLASKPEERKVNLDKEFESMQLLSNKKNDDDVFIKLGS  310


 Score = 44.7 bits (104),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 3/56 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE YYRPGGRGRGRG G G  G   NN+ + E PSI DVGQFP+LG
Sbjct  327  SINEFLKPAEGENYYRPGGRGRGRGRGRGGYG---NNSYNVEAPSIADVGQFPSLG  379



>gb|AAF14242.1|AF110226_1 nuclear RNA binding protein [Nicotiana tabacum]
Length=299

 Score =   112 bits (280),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+IA E E P    VNDG      EK+ GQE+A D  KDS   EPE KEPE+KEMTL+
Sbjct  120  PADDIAQETEVP----VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLE  175

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKL+EEKRKA+LA +PEERKV LDKE ESM LL+NKKNDDE+F+KLGS
Sbjct  176  EYEKLMEEKRKALLALKPEERKVNLDKELESMQLLSNKKNDDEIFIKLGS  225


 Score = 46.2 bits (108),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y R GGRGRG G G G  G G     SF  PSIEDVGQFP+L +K
Sbjct  242  SINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK  299



>ref|XP_009613635.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=373

 Score =   112 bits (280),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+IA E E P    VNDG      EK+ GQE+A D  KDS   EPE KEPE+KEMTL+
Sbjct  194  PADDIAQETEVP----VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLE  249

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKL+EEKRKA+LA +PEERKV LDKE ESM LL+NKKNDDE+F+KLGS
Sbjct  250  EYEKLMEEKRKALLALKPEERKVNLDKELESMQLLSNKKNDDEIFIKLGS  299


 Score = 46.2 bits (108),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y R GGRGRG G G G  G G     SF  PSIEDVGQFP+L +K
Sbjct  316  SINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK  373



>ref|XP_011081281.1| PREDICTED: RNA-binding protein FUS isoform X1 [Sesamum indicum]
Length=365

 Score =   115 bits (289),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEI PE EEP     N+GV     EKQ G++D  DA KDS  +E E KEPE+KEMTL+
Sbjct  189  PTDEIVPETEEP----TNEGVKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLE  244

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA + EERKV LDKE ESM LL+NKKNDDEVF+KLGS
Sbjct  245  EYEKVLEEKRKALLALKSEERKVGLDKELESMQLLSNKKNDDEVFIKLGS  294


 Score = 40.0 bits (92),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG+ YYR GGRGRGRG G G  G    N  + E P+IEDVGQFP+L +K
Sbjct  311  SINEFLKPAEGDKYYRAGGRGRGRGRGRGGFGG---NNYNVEAPAIEDVGQFPSLVAK  365



>ref|XP_009613636.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=350

 Score =   105 bits (262),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  721  VNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILAS  542
            VNDG      EK+ GQE+A D  KDS   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA 
Sbjct  183  VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  242

Query  541  RPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            +PEERKV LDKE ESM LL+NKKNDDE+F+KLGS
Sbjct  243  KPEERKVNLDKELESMQLLSNKKNDDEIFIKLGS  276


 Score = 46.6 bits (109),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y R GGRGRG G G G  G G     SF  PSIEDVGQFP+L +K
Sbjct  293  SINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK  350



>ref|XP_009789577.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=374

 Score =   112 bits (280),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+IA E E P    VNDG      EK+ GQEDA D  KDS   EPE KEPE+KEMTL+
Sbjct  194  PADDIAQETEVP----VNDGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLE  249

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKL+EEKRKA+LA +PEERKV LDKE E+M LL+NKKNDDE+F+KLGS
Sbjct  250  EYEKLMEEKRKALLALKPEERKVNLDKELETMQLLSNKKNDDEIFIKLGS  299


 Score = 39.3 bits (90),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyy-rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA+GE+ Y R GGRGRG+G G G  G G     +F  PSIEDVGQFP+L +K
Sbjct  316  SINEFLKPADGESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFPSLVAK  374



>ref|XP_006362472.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum tuberosum]
Length=366

 Score =   106 bits (265),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  EE     VNDG      EKQ GQEDAGD  KDS   EPE KEPE+KEMTL+EY
Sbjct  190  DDIAPVTEE----SVNDGEKIVDAEKQSGQEDAGDTNKDSSAAEPEEKEPEEKEMTLEEY  245

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EK++EEKRKA++A + EERKV LD E +SM LL+NKKNDDE+F+KLG+
Sbjct  246  EKVMEEKRKALVALKQEERKVNLDNELQSMQLLSNKKNDDEIFIKLGA  293


 Score = 42.0 bits (97),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE+YYRPGGRGRGRG G G GG  G   +S  +PSIEDVGQFP+L +K
Sbjct  310  SINEFLKPAEGESYYRPGGRGRGRGRGRGNGGGYGG-INSVSSPSIEDVGQFPSLAAK  366



>ref|XP_009607512.1| PREDICTED: intracellular hyaluronan-binding protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=359

 Score =   111 bits (277),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P DE APE EEP+N    +G      EK   Q DA DA KDSP  EP+ KEPE+KEMTL+
Sbjct  183  PADEFAPEKEEPLN----EGEKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLE  238

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKLLE+KRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS
Sbjct  239  EYEKLLEDKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS  288


 Score = 35.8 bits (81),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA+G +YYR GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  305  SINEFLKPADGGSYYRRGGRGRGGRDHGRDGVVGNNSVSA---PSIEDVRQFPSLGAK  359



>ref|XP_006362474.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Solanum tuberosum]
Length=364

 Score =   107 bits (266),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
             D+IAPE E P    V DG      EKQ GQEDAGD  KDS   EPE KEPE+KEMTL+E
Sbjct  187  ADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEE  242

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+
Sbjct  243  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA  291


 Score = 39.3 bits (90),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +INEFLKPAEGE YYR GGRGRGRG G G GG      +S   PSIEDVGQFP+L +K
Sbjct  308  NINEFLKPAEGENYYRSGGRGRGRGRGRGNGGGYVG-NNSVSAPSIEDVGQFPSLAAK  364



>ref|XP_006362473.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Solanum tuberosum]
Length=364

 Score =   106 bits (265),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
             D+IAPE E P    V DG      EKQ GQEDAGD  KDS   EPE KEPE+KEMTL+E
Sbjct  187  ADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEE  242

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+
Sbjct  243  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA  291


 Score = 39.3 bits (90),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +INEFLKPAEGE YYR GGRGRGRG G G GG      +S   PSIEDVGQFP+L +K
Sbjct  308  NINEFLKPAEGENYYRSGGRGRGRGRGRGNGGGYVG-NNSVSAPSIEDVGQFPSLAAK  364



>ref|XP_009789579.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=351

 Score =   105 bits (263),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = -2

Query  721  VNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILAS  542
            VNDG      EK+ GQEDA D  KDS   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA 
Sbjct  183  VNDGEKIVEAEKEAGQEDAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLAL  242

Query  541  RPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            +PEERKV LDKE E+M LL+NKKNDDE+F+KLGS
Sbjct  243  KPEERKVNLDKELETMQLLSNKKNDDEIFIKLGS  276


 Score = 39.7 bits (91),  Expect(2) = 6e-26, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyy-rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA+GE+ Y R GGRGRG+G G G  G G     +F  PSIEDVGQFP+L +K
Sbjct  293  SINEFLKPADGESSYYRRGGRGRGQGRGRGGFGGGVGGNKNFSAPSIEDVGQFPSLVAK  351



>ref|NP_001275449.1| plasminogen activator inhibitor 1 RNA-binding protein-like [Solanum 
tuberosum]
 gb|ABA81884.1| nuclear RNA binding protein-like [Solanum tuberosum]
Length=363

 Score =   104 bits (259),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAPE E P    V DG      EKQ GQEDAGD  K+S   EPE KEPE+KE+TL+EY
Sbjct  187  DDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDTNKESTAAEPEEKEPEEKEITLEEY  242

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+
Sbjct  243  EKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA  290


 Score = 40.0 bits (92),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE+YYRPGGRGRGRG G G GG      +S   PSIEDVGQFP+L  K
Sbjct  307  SINEFLKPAEGESYYRPGGRGRGRGRGRGNGGGY-GGINSVSAPSIEDVGQFPSLAVK  363



>ref|XP_011081284.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=358

 Score =   103 bits (258),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 4/109 (4%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEI  + EEP +    +GV     EK+ GQ+D GDA KD+   E E KEPE+KEMTL+E
Sbjct  183  TDEIVQDTEEPDS----EGVKNVESEKRSGQDDVGDANKDTSAKEQEEKEPEEKEMTLEE  238

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+LA +  ERKV LDKE ESM LL+NKKNDD+VF+KLGS
Sbjct  239  YEKVLEEKRKALLALKSRERKVDLDKELESMQLLSNKKNDDDVFIKLGS  287


 Score = 40.4 bits (93),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY    RGRG G G G  G    N    + P+IEDVGQFP+L +K
Sbjct  304  SINEFLKPAEGEKYYGAVRRGRGHGRGRGGYGG---NNYDLQAPAIEDVGQFPSLVAK  358



>ref|XP_004253373.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like, 
partial [Solanum lycopersicum]
Length=327

 Score =   102 bits (255),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IA E E P    V DG      EKQ GQEDAGD  KDS   E E KEPE+KEMTL+EY
Sbjct  143  DDIALETEVP----VVDGEKIVEAEKQTGQEDAGDDNKDSTAAELEEKEPEEKEMTLEEY  198

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+
Sbjct  199  EKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA  246


 Score = 41.2 bits (95),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK*G  208
            SINEFLKPAEGE+YYRPGGRGRGRG G G GG  G   SS   PSIEDVGQFP+L  K G
Sbjct  263  SINEFLKPAEGESYYRPGGRGRGRGRGRGNGGGYGG-ISSVSAPSIEDVGQFPSLAVKKG  321



>ref|XP_011081282.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Sesamum indicum]
Length=343

 Score =   102 bits (255),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 4/103 (4%)
 Frame = -2

Query  748  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLE  569
            E EEP     N+GV     EKQ G++D  DA KDS  +E E KEPE+KEMTL+EYEK+LE
Sbjct  174  ETEEP----TNEGVKNVDSEKQSGEDDVIDANKDSSANEQEEKEPEEKEMTLEEYEKVLE  229

Query  568  EKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EKRKA+LA + EERKV LDKE ESM LL+NKKNDDEVF+KLGS
Sbjct  230  EKRKALLALKSEERKVGLDKELESMQLLSNKKNDDEVFIKLGS  272


 Score = 40.4 bits (93),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG+ YYR GGRGRGRG G G  G    N  + E P+IEDVGQFP+L +K
Sbjct  289  SINEFLKPAEGDKYYRAGGRGRGRGRGRGGFGG---NNYNVEAPAIEDVGQFPSLVAK  343



>ref|XP_009766508.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=369

 Score = 99.0 bits (245),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 88/110 (80%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE EEP    V +G      EK  G+EDAGDAKKDS    PE KEPE+KEMTL+
Sbjct  187  PTDEIAPETEEP----VTEGEKIVDPEKPAGEEDAGDAKKDSSAAAPEEKEPEEKEMTLE  242

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKLLEEKRKA+LA +PEERKV LDKEFESM LL+NKKN+D+VF+KLG+
Sbjct  243  EYEKLLEEKRKALLAQKPEERKVNLDKEFESMQLLSNKKNEDDVFIKLGA  292


 Score = 41.6 bits (96),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS---SFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YYR  GRG   G G G  G  G N     S E P IEDVGQFP+LG+
Sbjct  309  SINEFLKPAEGENYYRGRGRGGRGGRGRGGYGGNGGNGGNNYSVEAPKIEDVGQFPSLGA  368

Query  216  K  214
            K
Sbjct  369  K  369



>ref|XP_009594553.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=365

 Score = 98.2 bits (243),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE EEP      +G      EK  G+EDAGDAKKDS + EPE KEPE+KEMTL+
Sbjct  186  PTDEIAPETEEP----AAEGEKIVDSEKPAGEEDAGDAKKDSSVAEPEEKEPEEKEMTLE  241

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKLLEEKRKA+LA +PEERKV LDKEFESM LL+NKKN+D+VF+KLG+
Sbjct  242  EYEKLLEEKRKALLAQKPEERKVNLDKEFESMQLLSNKKNEDDVFIKLGA  291


 Score = 42.0 bits (97),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG  YYR  GRG     G G     G N  S E P IEDVGQFP+LG+K
Sbjct  308  SINEFLKPAEGGNYYRGRGRGGRGRGGRGGYEGNGGNNYSVEAPKIEDVGQFPSLGAK  365



>ref|XP_004244706.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=340

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
             D+IAPE E P    V DG      EKQ GQEDAGD  KDS   EPE KEPE+KEMTL+E
Sbjct  187  ADDIAPETEVP----VVDGEKIVEAEKQTGQEDAGDNNKDSTAAEPEEKEPEEKEMTLEE  242

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK++EEKRKA++A + EERKV LDKE +SM LL+NKKNDDE+F+KLG+
Sbjct  243  YEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKNDDEIFIKLGA  291



>ref|XP_009607515.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=337

 Score =   100 bits (249),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 4/103 (4%)
 Frame = -2

Query  748  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLE  569
            E EEP+N    +G      EK   Q DA DA KDSP  EP+ KEPE+KEMTL+EYEKLLE
Sbjct  168  EKEEPLN----EGEKIVDTEKPAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLE  223

Query  568  EKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            +KRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS
Sbjct  224  DKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS  266


 Score = 36.2 bits (82),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA+G +YYR GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  283  SINEFLKPADGGSYYRRGGRGRGGRDHGRDGVVGNNSVSA---PSIEDVRQFPSLGAK  337



>ref|XP_010677113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Beta vulgaris subsp. vulgaris]
 emb|CAC85228.1| salt tolerance protein 2 [Beta vulgaris]
Length=356

 Score =   100 bits (249),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 83/110 (75%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE EEP+  V N+     A +K  G+ +  DA+K+S   E    EPE+KEMTL+
Sbjct  177  PTDEIAPETEEPV--VENEAAV--AADKPAGEGENVDAEKESQEKEVVEAEPEEKEMTLE  232

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+L+ + EERKV LDKEFESM L++ KKNDDEVF+KLGS
Sbjct  233  EYEKVLEEKRKALLSLKGEERKVDLDKEFESMQLVSKKKNDDEVFIKLGS  282


 Score = 35.8 bits (81),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFLKPAEG+ Y+R G      G G   GGYG NN S+   PSIED  QFP+LG+
Sbjct  302  SINEFLKPAEGDGYHRRGRGRGRGGRGGYGGGYGMNNASA---PSIEDPNQFPSLGA  355



>ref|XP_002303373.2| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|EEE78352.2| nuclear RNA-binding family protein [Populus trichocarpa]
Length=361

 Score = 96.3 bits (238),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 86/110 (78%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE E+P   VV++  N    EKQ G+EDA DA KD+  ++PE KEPE+KEMTL+
Sbjct  177  PTDEIAPETEDP---VVDNEKNV-ITEKQQGEEDAADANKDT-AEKPEEKEPEEKEMTLE  231

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+L  + EERKV LDK+ + M  L++KK++DE+F+KLGS
Sbjct  232  EYEKVLEEKRKALLDLKTEERKVGLDKDLQCMQQLSSKKSNDEIFIKLGS  281


 Score = 40.0 bits (92),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 33/61 (54%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETy---yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE      R G        G G G   G+N      PSIED GQFP+LG 
Sbjct  301  SINEFLKPAEGERSYNSGRGGRGRGRGRGGYGSGSGYGSNARDVAAPSIEDPGQFPSLGG  360

Query  216  K  214
            K
Sbjct  361  K  361



>gb|KDP39931.1| hypothetical protein JCGZ_03462 [Jatropha curcas]
Length=366

 Score = 99.0 bits (245),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E EEP+  +  + V     EK  G+EDA DA K+SP DEPE K  + + MTL+
Sbjct  187  PTDEIAQETEEPVTEIEKNVV----AEKPSGEEDAADANKESPADEPEEKVEDKE-MTLE  241

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+L+S+ EERKV ++KEF SM  L+NKK +D++F+KLGS
Sbjct  242  EYEKILEEKRKALLSSKTEERKVDVEKEFGSMLQLSNKKGNDDIFIKLGS  291


 Score = 37.4 bits (85),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 30/58 (52%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SI EFLKPA+GE YY  G          G    G  N      PSIED GQFP+LG K
Sbjct  311  SITEFLKPADGEKYYSGGRGRGRGRGSRGGYVGG--NARDVAAPSIEDRGQFPSLGGK  366



>ref|XP_009772173.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=356

 Score = 95.1 bits (235),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 86/110 (78%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P DE+APE EEP    VN+G      EKQ  Q DA DA KDSP  EP+ KEPE+KEMTL+
Sbjct  180  PADELAPEKEEP----VNEGEKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLE  235

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKLLEEKRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS
Sbjct  236  EYEKLLEEKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS  285


 Score = 40.8 bits (94),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA+GE+YY  GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  302  SINEFLKPADGESYYGRGGRGRGGRDRGRDGFVGNNSVSA---PSIEDVRQFPSLGAK  356



>ref|XP_011031954.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=362

 Score = 94.0 bits (232),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 6/112 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkE--MT  596
            PTDEI PE E+P   VV++  N    EKQ G+E+A DA KD+   EPE KE E +E  MT
Sbjct  177  PTDEIVPETEDP---VVDNEKNV-ITEKQQGEENAADANKDTAEKEPEEKEKEPEEKEMT  232

Query  595  LDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            L+EYEK+LEEKRKA+LA + EERKV LDK+ + M  L++KK++DE+F+KLGS
Sbjct  233  LEEYEKVLEEKRKALLALKTEERKVGLDKDLQCMQQLSSKKSNDEIFIKLGS  284


 Score = 40.4 bits (93),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 33/59 (56%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGE-TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y    G         G G   G+N      PSIED GQFP+LG K
Sbjct  304  SINEFLKPAEGERSYNPGRGGRGRGRGRGGYGSGYGSNARDVAAPSIEDPGQFPSLGGK  362



>ref|XP_010661405.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Vitis vinifera]
 emb|CBI16673.3| unnamed protein product [Vitis vinifera]
Length=361

 Score = 87.4 bits (215),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE++   EE    VVN+G      EK  G+ED  D  K++P++EPE KEPE+KEMTL+E
Sbjct  180  TDELSGVTEE----VVNEGEKNLGAEKPVGEEDVADGNKENPVNEPEEKEPEEKEMTLEE  235

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEE+RKA+   + EERKV +DKEF+SM  L++KK +D++F+KLGS
Sbjct  236  YEKVLEERRKALQTLKTEERKVDVDKEFKSMQQLSSKKGNDDIFIKLGS  284


 Score = 46.6 bits (109),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y PGGRGRGRG GS  G  GGN  S+   PSIED GQFPTLG+K
Sbjct  304  SINEFLKPAEGERFYSPGGRGRGRGRGSRGGYGGGNAMSNVAAPSIEDPGQFPTLGAK  361



>ref|XP_010275458.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=359

 Score = 93.6 bits (231),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 80/110 (73%), Gaps = 8/110 (7%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEI  E EE     +         EK  G+++ GD  K++P++EPE KEPEDKEMTLD
Sbjct  180  PTDEIVQETEEVEKTTIT--------EKTGGEDETGDTNKENPVNEPEEKEPEDKEMTLD  231

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+ A + EERKV LDK+FESM  LA+KK +D+VF+KLGS
Sbjct  232  EYEKVLEEKRKALQALKTEERKVNLDKDFESMQQLASKKGNDDVFIKLGS  281


 Score = 39.7 bits (91),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 34/59 (58%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEG-ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG   Y   G      G GS  G  G N  S+   PSIED GQFPTLG K
Sbjct  301  SINEFLKPAEGGRYYSPGGRGRGRGGRGSRGGFSGVNQASNVVAPSIEDPGQFPTLGGK  359



>ref|XP_010258760.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=358

 Score = 94.0 bits (232),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -2

Query  703  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  524
            T   EK  G+E+AGDA K++P +EPE KEPEDKEMTLDEYEK+LEEKRKA+ A + EERK
Sbjct  193  TAITEKPVGEEEAGDANKENPTNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKTEERK  252

Query  523  VCLDKEFESMALLANKKNDDEVFVKLGS  440
            V LDK+FESM  LANKK +D+VF+KLGS
Sbjct  253  VNLDKDFESMQQLANKKGNDDVFIKLGS  280


 Score = 39.3 bits (90),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-TPSIEDVGQFPTLGSK  214
            SINEFLKP+EGE YY PGGRGRGRG    +GG+GG N +S E  PSI D GQFPTLG K
Sbjct  300  SINEFLKPSEGEKYYNPGGRGRGRGGRGSKGGFGGGNMTSNEVAPSIGDPGQFPTLGGK  358



>ref|XP_002266051.1| PREDICTED: uncharacterized protein DDB_G0288133 [Vitis vinifera]
 emb|CBI29539.3| unnamed protein product [Vitis vinifera]
Length=363

 Score = 96.7 bits (239),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P DEIAPE EEPIN       NT A EKQ G+E A DA K++P++E E KEPEDKEMTL+
Sbjct  185  PADEIAPENEEPINETEK---NTSA-EKQLGEEIAADANKENPVNESEEKEPEDKEMTLE  240

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EY+K+LEEKRKA+LA + EERKV + K+FE+M  L++KK++D+VF+KLGS
Sbjct  241  EYQKVLEEKRKALLALKTEERKVDV-KDFEAMQQLSSKKDNDDVFIKLGS  289


 Score = 35.0 bits (79),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA      R  G          RGG+ GN  S+   PSIED GQFPTLG K
Sbjct  309  SINEFLKPA---EGERYYGGRGRGRGRGTRGGFAGNTYSNVAAPSIEDPGQFPTLGGK  363



>emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera]
Length=363

 Score = 96.7 bits (239),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P DEIAPE EEPIN       NT A EKQ G+E A DA K++P++E E KEPEDKEMTL+
Sbjct  185  PADEIAPENEEPINETEK---NTSA-EKQLGEEIAADANKENPVNESEEKEPEDKEMTLE  240

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EY+K+LEEKRKA+LA + EERKV + K+FE+M  L++KK++D+VF+KLGS
Sbjct  241  EYQKVLEEKRKALLALKTEERKVDV-KDFEAMQQLSSKKDNDDVFIKLGS  289


 Score = 35.0 bits (79),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA      R  G          RGG+ GN  S+   PSIED GQFPTLG K
Sbjct  309  SINEFLKPA---EGERYYGGRGRGCGRGTRGGFAGNTYSNVAAPSIEDPGQFPTLGGK  363



>gb|KDO57096.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=364

 Score = 95.9 bits (237),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+
Sbjct  183  PTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLE  237

Query  589  EYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GS
Sbjct  238  EYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGS  288


 Score = 35.8 bits (81),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  308  SINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  364



>ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Citrus sinensis]
Length=364

 Score = 95.9 bits (237),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+
Sbjct  183  PTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLE  237

Query  589  EYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GS
Sbjct  238  EYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGS  288


 Score = 35.8 bits (81),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  308  SINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  364



>ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53445.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=364

 Score = 95.5 bits (236),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+
Sbjct  183  PTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLE  237

Query  589  EYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GS
Sbjct  238  EYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGS  288


 Score = 35.4 bits (80),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  ++S+   P IED GQFP+LG K
Sbjct  308  SINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSSSAA-APKIEDPGQFPSLGGK  364



>ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
 gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
Length=364

 Score = 93.2 bits (230),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 81/111 (73%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEP-INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTL  593
            P DEIAPE EEP I    N G+     EK  G+E A DA KD+P++E E KEPEDKEMTL
Sbjct  185  PADEIAPEIEEPLIENEKNIGI-----EKPSGEEGAADANKDNPMNELEEKEPEDKEMTL  239

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            +EYEKL EE++K++  S+ EERKV ++KEF +M  L+NKK  DE+F+KLGS
Sbjct  240  EEYEKLREERKKSLSLSKAEERKVDVEKEFGTMLQLSNKKGSDEIFIKLGS  290


 Score = 36.6 bits (83),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+   GRGRGRG   G G     + ++   PSIED GQFPTLG K
Sbjct  310  SINEFLKPAEGERYFGGRGRGRGRGSRGGYGLGSARDVAA---PSIEDRGQFPTLGGK  364



>gb|KJB37646.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=357

 Score = 89.4 bits (220),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KEMTL+
Sbjct  179  PTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLE  234

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGS
Sbjct  235  EYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGS  283


 Score = 40.0 bits (92),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  SS   PSIED G FP+LG K
Sbjct  302  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASSVLAPSIEDPGHFPSLGGK  357



>gb|KJB37648.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score = 89.0 bits (219),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KEMTL+
Sbjct  178  PTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLE  233

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGS
Sbjct  234  EYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGS  282


 Score = 40.0 bits (92),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  SS   PSIED G FP+LG K
Sbjct  301  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASSVLAPSIEDPGHFPSLGGK  356



>gb|KJB37651.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=306

 Score = 89.0 bits (219),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KEMTL+
Sbjct  128  PTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLE  183

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGS
Sbjct  184  EYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGS  232


 Score = 40.0 bits (92),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  SS   PSIED G FP+LG K
Sbjct  251  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASSVLAPSIEDPGHFPSLGGK  306



>ref|XP_007052330.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
 gb|EOX96487.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
Length=267

 Score = 89.7 bits (221),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   EE    VVN+       EK  G+EDAGDA K+SP +EPE KEPEDKEMTL+E
Sbjct  88   TDELAQVTEE----VVNESEKNLGDEKPAGEEDAGDASKESPTNEPEEKEPEDKEMTLEE  143

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEF +M  L+NKK++DEVF+KLGS
Sbjct  144  YEKVLEEKRKALQALKTEERKVDA-KEFATMQQLSNKKSNDEVFIKLGS  191


 Score = 38.9 bits (89),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = -3

Query  387  SINEFLKPAEGETyy--rpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY     GRGRGRG     GG    N S+   PSIED GQFPTLG K
Sbjct  211  SINEFLKPAEGERYYNPSGRGRGRGRGSRGFGGGSAAGNVSA---PSIEDPGQFPTLGGK  267



>ref|XP_007052327.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052328.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052329.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96484.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96485.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96486.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
Length=375

 Score = 89.7 bits (221),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 81/109 (74%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   EE    VVN+       EK  G+EDAGDA K+SP +EPE KEPEDKEMTL+E
Sbjct  196  TDELAQVTEE----VVNESEKNLGDEKPAGEEDAGDASKESPTNEPEEKEPEDKEMTLEE  251

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEF +M  L+NKK++DEVF+KLGS
Sbjct  252  YEKVLEEKRKALQALKTEERKVDA-KEFATMQQLSNKKSNDEVFIKLGS  299


 Score = 38.5 bits (88),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 37/60 (62%), Gaps = 5/60 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET--yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE        GRGRGRG     GG    N S+   PSIED GQFPTLG K
Sbjct  319  SINEFLKPAEGERYYNPSGRGRGRGRGSRGFGGGSAAGNVSA---PSIEDPGQFPTLGGK  375



>gb|EYU19470.1| hypothetical protein MIMGU_mgv1a008507mg [Erythranthe guttata]
Length=371

 Score = 86.7 bits (213),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 7/110 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGV-VNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            T++IAPE EEP + V + D       EK  G+EDA DA KDSP ++ E +  E+KEMTL+
Sbjct  194  TEDIAPETEEPASEVKIVDP------EKPSGEEDAVDANKDSPKEQEEKEPEEEKEMTLE  247

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+ EEKRKA+L+ + EERKV LDKE E+M LL+ KKNDDEVF+KLGS
Sbjct  248  EYEKVREEKRKALLSLKSEERKVNLDKELEAMQLLSTKKNDDEVFIKLGS  297


 Score = 41.2 bits (95),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YYR GGRG     G GR G  G + +    P+I DVGQFP+LG K
Sbjct  314  SINEFLKPAEGENYYRGGGRGGRGRGGRGREGGFGRSNAGERAPAIGDVGQFPSLGGK  371



>gb|AEI59279.1| RNA binding protein [Suaeda glauca]
Length=359

 Score = 95.5 bits (236),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE+ EP+  V N+ V  D  EK  G E+    +K++P  E E  EPE+K+MTL+
Sbjct  180  PTDEIAPESGEPV--VENEAVAAD--EKPSGDENVV-VEKENPEKEAEETEPEEKQMTLE  234

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EY+K+LEEKRKA+LA + EERKV LDK+FESM L++ KKNDDEVF+KLGS
Sbjct  235  EYQKVLEEKRKALLALKAEERKVDLDKDFESMQLVSKKKNDDEVFIKLGS  284


 Score = 32.0 bits (71),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFL+PAEG+ +YR GGRGR RG   G GG  G N +S   PSIED  QFP+LG+
Sbjct  304  SINEFLRPAEGDGHYRRGGRGRSRGGRGGYGGGYGMNNAS--APSIEDPSQFPSLGA  358



>ref|XP_007039722.1| Hyaluronan / mRNA binding family [Theobroma cacao]
 gb|EOY24223.1| Hyaluronan / mRNA binding family [Theobroma cacao]
Length=358

 Score = 87.4 bits (215),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 85/109 (78%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEIAPE E  +N V  +  N  A EKQ G+ED  DA K++  +EPE KEPE+KEMTL+E
Sbjct  181  TDEIAPETE--VN-VPENEKNVGA-EKQSGEEDVVDASKENAANEPEEKEPENKEMTLEE  236

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+L+EKRKA+LA + EERKV + KEFESM  L+NKK++D++F+KLGS
Sbjct  237  YEKILDEKRKALLALKTEERKVDV-KEFESMQQLSNKKSNDDIFIKLGS  284


 Score = 39.7 bits (91),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G      S+   P+IED GQFPTLG K
Sbjct  303  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGGIAG--SNVPAPAIEDRGQFPTLGGK  358



>gb|KDO57095.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=363

 Score = 91.3 bits (225),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 6/108 (6%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+
Sbjct  183  PTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLE  237

Query  589  EYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVK  449
            EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K
Sbjct  238  EYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIK  285


 Score = 35.8 bits (81),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  307  SINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  363



>gb|KJB37647.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score = 85.5 bits (210),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 6/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD IAPE EE     V +     + EKQ G+EDA DA K++       ++  + +MTL+
Sbjct  179  PTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKEN-AANEAEEKEPENKMTLE  233

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGS
Sbjct  234  EYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGS  282


 Score = 40.0 bits (92),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  SS   PSIED G FP+LG K
Sbjct  301  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASSVLAPSIEDPGHFPSLGGK  356



>ref|XP_011093236.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Sesamum indicum]
Length=376

 Score = 77.4 bits (189),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAG-DAKKDSPLdepevkepedkEMTLD  590
            TDE+A EAE  + G    G+N    EK  G+EDA  D   ++  +E   KEPE+KEMTL+
Sbjct  195  TDELAQEAEG-VGGEAEKGLNA---EKPSGEEDAAADGDNEAAKNEVGEKEPENKEMTLE  250

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+ A + EERKV + KEFES+  L+NKK +D+VF+KLGS
Sbjct  251  EYEKVLEEKRKALQALKTEERKVDV-KEFESLKPLSNKKTNDDVFIKLGS  299


 Score = 47.8 bits (112),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PGGRGRGRG GS  G  GGN  S+ + PSIED GQFPTLG K
Sbjct  319  SINEFLKPAEGERYYNPGGRGRGRGRGSRGGYSGGNEMSNVKAPSIEDPGQFPTLGGK  376



>ref|XP_009772180.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=334

 Score = 84.0 bits (206),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 4/103 (4%)
 Frame = -2

Query  748  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLE  569
            E EEP    VN+G      EKQ  Q DA DA KDSP  EP+ KEPE+KEMTL+EYEKLLE
Sbjct  165  EKEEP----VNEGEKIVVTEKQAVQADAEDASKDSPAAEPQEKEPEEKEMTLEEYEKLLE  220

Query  568  EKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EKRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KLGS
Sbjct  221  EKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKLGS  263


 Score = 41.2 bits (95),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA+GE+YY  GGRGRG       G  G N+ S+   PSIEDV QFP+LG+K
Sbjct  280  SINEFLKPADGESYYGRGGRGRGGRDRGRDGFVGNNSVSA---PSIEDVRQFPSLGAK  334



>gb|KDO57093.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=335

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+
Sbjct  183  PTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLE  237

Query  589  EYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GS
Sbjct  238  EYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGS  288



>ref|XP_008369209.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Malus domestica]
Length=359

 Score = 83.2 bits (204),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EKQ G+ +A DA K+  ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EERKV +D
Sbjct  199  EKQSGENEAADANKEDTVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVD  258

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            K+ ++M LL+NKK +DE+F+KLGS
Sbjct  259  KDLKAMQLLSNKKENDEIFIKLGS  282


 Score = 40.4 bits (93),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+   GRGRGRG   G  G  G  +S+   PSI D GQFP+LG K
Sbjct  302  SINEFLKPAEGERYHGGRGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  359



>ref|XP_007209289.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
 gb|EMJ10488.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
Length=360

 Score = 90.5 bits (223),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 83/110 (75%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD+IA E EEP   +     N  A EKQ G+ +A DA K++ ++E E KEPE+KEMTL+
Sbjct  179  PTDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKENTVNESEEKEPEEKEMTLE  234

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA + EERKV LDKE +SM  L+NKK ++++F+KLGS
Sbjct  235  EYEKVLEEKRKALLALKTEERKVDLDKELKSMQQLSNKKENNDIFIKLGS  284


 Score = 33.1 bits (74),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   G  G  G  + S   PSIED GQFPTLG K
Sbjct  304  SINEFLKPAEGERYYGGRGRGRGRGPRGGYSGGPGGYSGSA-APSIEDPGQFPTLGGK  360



>gb|KJB24880.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score = 85.5 bits (210),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   EE    V N+G      EK  G+EDA DA K+S  +EPE KEPEDKEMTL+E
Sbjct  184  TDELAQVTEE----VANEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  239

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS
Sbjct  240  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGS  287


 Score = 37.0 bits (84),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 29/58 (50%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE  Y              RG  GGN       PSIED G FP LG K
Sbjct  307  SINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  363



>gb|KJB24881.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score = 85.5 bits (210),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 80/109 (73%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   EE    V N+G      EK  G+EDA DA K+S  +EPE KEPEDKEMTL+E
Sbjct  184  TDELAQVTEE----VANEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  239

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS
Sbjct  240  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGS  287


 Score = 37.0 bits (84),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 29/58 (50%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE  Y              RG  GGN       PSIED G FP LG K
Sbjct  307  SINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  363



>gb|KHG17525.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=361

 Score = 84.7 bits (208),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 79/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   EE    V N G      EK  G+EDA DA K+S  +EPE KEPEDKEMTL+E
Sbjct  182  TDELAQVTEE----VANGGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  237

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS
Sbjct  238  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGS  285


 Score = 37.0 bits (84),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 29/58 (50%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE  Y              RG  GGN       PSIED G FP LG K
Sbjct  305  SINEFLKPAEGER-YYNPSGRGRGRGRGSRGFGGGNAARDVAAPSIEDPGHFPILGGK  361



>gb|KJB37652.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=335

 Score = 81.3 bits (199),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = -2

Query  697  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  518
            + EKQ G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV 
Sbjct  177  SIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVD  236

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
              KEFESM  L++KK++D++F+KLGS
Sbjct  237  T-KEFESMQQLSSKKSNDDIFIKLGS  261


 Score = 40.4 bits (93),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  SS   PSIED G FP+LG K
Sbjct  280  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASSVLAPSIEDPGHFPSLGGK  335



>gb|KHG27284.1| hypothetical protein F383_11722 [Gossypium arboreum]
Length=354

 Score = 82.0 bits (201),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEIAPE E              + EKQ G+EDA DA K++  +E E KEPE+KEMTL+E
Sbjct  178  TDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKENAANETEEKEPENKEMTLEE  232

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D++F+KLGS
Sbjct  233  YEKILEEKRKALAALKTEGRKVDV-KEFESMQQLSNKKSNDDIFIKLGS  280


 Score = 39.3 bits (90),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  S+ + PSI D G FP+LG K
Sbjct  299  SINEFLKPAEGERYYGPGRGRGRSRGPRGGYGG--NTASNVQAPSIADPGHFPSLGGK  354



>gb|KHG30709.1| hypothetical protein F383_14338 [Gossypium arboreum]
Length=353

 Score = 81.3 bits (199),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 82/123 (67%), Gaps = 18/123 (15%)
 Frame = -2

Query  769  PTDEIAP-------------EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdep  629
            PTD IAP             EAEE     V +       EKQ G+EDA DA K++  +E 
Sbjct  162  PTDGIAPSYAYISVILPKIREAEE----NVPENEKNVGIEKQSGEEDAMDAGKENAANEA  217

Query  628  evkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVK  449
            E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+K
Sbjct  218  EEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIK  276

Query  448  LGS  440
            LGS
Sbjct  277  LGS  279


 Score = 40.0 bits (92),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  SS   PSIED G FP+LG K
Sbjct  298  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASSVLAPSIEDPGHFPSLGGK  353



>gb|KDO57094.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=342

 Score = 85.1 bits (209),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 6/104 (6%)
 Frame = -2

Query  748  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLE  569
            E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LE
Sbjct  168  ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLE  222

Query  568  EKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GS
Sbjct  223  EKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGS  266


 Score = 35.8 bits (81),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  286  SINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  342



>ref|XP_006477113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Citrus sinensis]
Length=342

 Score = 85.1 bits (209),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 6/104 (6%)
 Frame = -2

Query  748  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLE  569
            E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LE
Sbjct  168  ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLE  222

Query  568  EKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GS
Sbjct  223  EKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGS  266


 Score = 35.8 bits (81),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + ++   P IED GQFP+LG K
Sbjct  286  SINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSGNAA-APKIEDPGQFPSLGGK  342



>ref|XP_006440206.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 ref|XP_006440207.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53446.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53447.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=342

 Score = 85.1 bits (209),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 6/104 (6%)
 Frame = -2

Query  748  EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLE  569
            E EEP    V +  NT+A EK  G+E+A DA K++P+DE E KEPE+KEMTL+EYEK+LE
Sbjct  168  ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQEEKEPEEKEMTLEEYEKVLE  222

Query  568  EKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K+GS
Sbjct  223  EKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIKVGS  266


 Score = 35.4 bits (80),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  ++S+   P IED GQFP+LG K
Sbjct  286  SINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSSSAA-APKIEDPGQFPSLGGK  342



>gb|KJB25493.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=354

 Score = 80.9 bits (198),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEIAPE E              + EKQ G+EDA DA K++  +E E KEPE+KEMTL+E
Sbjct  178  TDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKENAANEAEEKEPENKEMTLEE  232

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D++F+KLGS
Sbjct  233  YEKILEEKRKALDALKTEGRKVDV-KEFESMQQLSNKKSNDDIFIKLGS  280


 Score = 39.3 bits (90),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  S+ + PSI D G FP+LG K
Sbjct  299  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASNVQAPSIADPGHFPSLGGK  354



>gb|KHG05539.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=362

 Score = 83.6 bits (205),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TD +A   EE    V N+G      EK  G+EDA DA K+S  +EPE KEPEDKEMTL+E
Sbjct  183  TDNLAQVTEE----VTNEGERNLGDEKPAGEEDARDANKESASNEPEEKEPEDKEMTLEE  238

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++DEVF+KLGS
Sbjct  239  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSNDEVFIKLGS  286


 Score = 36.6 bits (83),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY P GRGRGRG GS   G G         PSIED G FPTLG K
Sbjct  306  SINEFLKPAEGERYYNPSGRGRGRGRGSRGFGGGSA-ARDVAAPSIEDPGHFPTLGGK  362



>gb|KJB24891.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=361

 Score = 84.0 bits (206),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   E     V N+G      EK  G+EDA +A K+S  +EPE KEPEDKEMTL+E
Sbjct  183  TDELAQVTE-----VTNEGERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEE  237

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKKN+DEVF+KLGS
Sbjct  238  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKNNDEVFIKLGS  285


 Score = 36.6 bits (83),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY P GRGRGRG GS   G G         PSIED G FPTLG K
Sbjct  305  SINEFLKPAEGERYYNPSGRGRGRGRGSRGFGGGSA-ARDVAAPSIEDPGHFPTLGGK  361



>ref|XP_008238397.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Prunus mume]
Length=360

 Score = 89.0 bits (219),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD+IA E EEP   +     N  A EKQ G+ +A DA K++ ++E E KE E+KEMTL+
Sbjct  179  PTDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKENTVNESEEKELEEKEMTLE  234

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA + EERKV LDK+ +SM  L+NKK ++++F+KLGS
Sbjct  235  EYEKVLEEKRKALLALKTEERKVDLDKDLKSMQQLSNKKENNDIFIKLGS  284


 Score = 31.6 bits (70),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   G GG  G  + S   PSIED GQFPTLG K
Sbjct  304  SINEFLKPAEGERYYGGRGRGRGRGPRGGYGGGPGGYSGSA-APSIEDPGQFPTLGGK  360



>ref|XP_008238398.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Prunus mume]
Length=359

 Score = 88.6 bits (218),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD+IA E EEP   +     N  A EKQ G+ +A DA K++ ++E E KE E+KEMTL+
Sbjct  178  PTDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKENTVNESEEKELEEKEMTLE  233

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA + EERKV LDK+ +SM  L+NKK ++++F+KLGS
Sbjct  234  EYEKVLEEKRKALLALKTEERKVDLDKDLKSMQQLSNKKENNDIFIKLGS  283


 Score = 31.6 bits (70),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   G GG  G  + S   PSIED GQFPTLG K
Sbjct  303  SINEFLKPAEGERYYGGRGRGRGRGPRGGYGGGPGGYSGSA-APSIEDPGQFPTLGGK  359



>ref|XP_011093237.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Sesamum indicum]
Length=354

 Score = 71.6 bits (174),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 5/101 (5%)
 Frame = -2

Query  739  EPINGVVNDGVNTDAFEKQHGQEDAG-DAKKDSPLdepevkepedkEMTLDEYEKLLEEK  563
            E + G    G+N    EK  G+EDA  D   ++  +E   KEPE+KEMTL+EYEK+LEEK
Sbjct  181  EGVGGEAEKGLNA---EKPSGEEDAAADGDNEAAKNEVGEKEPENKEMTLEEYEKVLEEK  237

Query  562  RKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            RKA+ A + EERKV + KEFES+  L+NKK +D+VF+KLGS
Sbjct  238  RKALQALKTEERKVDV-KEFESLKPLSNKKTNDDVFIKLGS  277


 Score = 48.1 bits (113),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PGGRGRGRG GS  G  GGN  S+ + PSIED GQFPTLG K
Sbjct  297  SINEFLKPAEGERYYNPGGRGRGRGRGSRGGYSGGNEMSNVKAPSIEDPGQFPTLGGK  354



>ref|XP_008373667.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=365

 Score = 83.6 bits (205),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 80/114 (70%), Gaps = 11/114 (10%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTD---AFEKQHGQEDAGDAKKDSPLdepevkepedkEM  599
            P+D+IAPE EEP       G  T+     EKQ G+ +A DA KDS ++E E KE E+++ 
Sbjct  182  PSDDIAPEIEEP-------GTETEKNFGAEKQSGENEAADANKDSTVNETEEKESEEEKE  234

Query  598  TLDE-YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
               E YEK+LEEKRKA+LA + EERKV +DK+ ++M LL+NKK +DE+F+KLGS
Sbjct  235  MTLEEYEKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNKKENDEIFIKLGS  288


 Score = 35.0 bits (79),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SIN+FLKPAEGE YY   GRGRGRG   G  G  G  +S+   PSIED GQFP+LG K
Sbjct  308  SINQFLKPAEGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIEDPGQFPSLGGK  365



>ref|XP_006368965.1| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|ERP65534.1| nuclear RNA-binding family protein [Populus trichocarpa]
Length=374

 Score = 77.0 bits (188),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 11/117 (9%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSP-------Ldepevkepe  611
            P DEIAPE EEP    V D   +   EKQ  +EDA  A KD+        ++EPE KEPE
Sbjct  189  PADEIAPETEEP----VVDNEKSVITEKQPEEEDAAAASKDAADASKDAAVNEPEEKEPE  244

Query  610  dkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            DKEMTL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L++KK++DE+F+KLGS
Sbjct  245  DKEMTLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGS  301


 Score = 41.6 bits (96),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 34/58 (59%), Gaps = 4/58 (7%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA G+ YY PG          G GG    NT   E PSIED GQFPTLG K
Sbjct  321  SINEFLKPAGGDRYYNPGRGRGRGRGRGGYGG----NTRDVEAPSIEDPGQFPTLGGK  374



>gb|ABK94426.1| unknown [Populus trichocarpa]
Length=370

 Score = 77.0 bits (188),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (72%), Gaps = 11/117 (9%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSP-------Ldepevkepe  611
            P DEIAPE EEP    V D   +   EKQ  +EDA  A KD+        ++EPE KEPE
Sbjct  185  PADEIAPETEEP----VVDNEKSVITEKQPEEEDAAAASKDAADASKDAAVNEPEEKEPE  240

Query  610  dkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            DKEMTL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L++KK++DE+F+KLGS
Sbjct  241  DKEMTLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNDEIFIKLGS  297


 Score = 41.6 bits (96),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 34/58 (59%), Gaps = 4/58 (7%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA G+ YY PG          G GG    NT   E PSIED GQFPTLG K
Sbjct  317  SINEFLKPAGGDRYYNPGRGRGRGRGRGGYGG----NTRDVEAPSIEDPGQFPTLGGK  370



>ref|XP_007134461.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
 gb|ESW06455.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
Length=359

 Score = 79.0 bits (193),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EK  G+E A D  KDSP +E E KEPE+KEMTL+EYEK+LEE+RKA+ A + E RKV + 
Sbjct  196  EKPVGEESAADGNKDSPANENEEKEPEEKEMTLEEYEKVLEERRKALQALKTETRKVDI-  254

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            KEF SM  L+NKK++DE+F+KLGS
Sbjct  255  KEFASMQPLSNKKDNDEIFIKLGS  278


 Score = 38.9 bits (89),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGE----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            +I EFLKPAEGE    T  R  GRGRG G G G GGY GN  S+   PSIED GQFPTLG
Sbjct  298  NITEFLKPAEGERYYNTSGRGRGRGRGGGRGGGGGGYSGNAGSNVSAPSIEDPGQFPTLG  357

Query  219  SK  214
             K
Sbjct  358  GK  359



>ref|XP_003521066.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score = 82.8 bits (203),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
             D+IA   EE    VVN+     A EK  G+EDA +  KDSP +E E KEPEDKEMTL+E
Sbjct  190  NDDIAEVTEE----VVNETEKVLADEKPVGEEDAAEGNKDSPANENEEKEPEDKEMTLEE  245

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + E RKV + KEF SM  L+NKK +DE+F+KLGS
Sbjct  246  YEKVLEEKRKALQAQKTEARKVDI-KEFASMQPLSNKKENDEIFIKLGS  293


 Score = 34.3 bits (77),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 30/58 (52%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +I EFLKPAEGE YY  G          G      N  S+   PSIED G FP+LG K
Sbjct  313  NITEFLKPAEGERYYPGGRGRGRGRGSRGGYSG--NAYSNAPAPSIEDPGHFPSLGGK  368



>ref|XP_006398418.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
 gb|ESQ39871.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
Length=359

 Score = 88.2 bits (217),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 5/108 (5%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+I P  EEP   V    V     EKQ G++D  DAKKD+P DE E KE EDKEMTL+EY
Sbjct  173  DDIPPATEEPTTEVEKSPV----AEKQSGEDDTTDAKKDAPADEQEEKEAEDKEMTLEEY  228

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK+++E+F+KLGS
Sbjct  229  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSNEEIFIKLGS  275


 Score = 28.9 bits (63),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  387  SINEFLKPAEGET  349
            SINEFLKPA+GET
Sbjct  293  SINEFLKPADGET  305



>ref|XP_004300342.1| PREDICTED: intracellular hyaluronan-binding protein 4-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=385

 Score = 84.3 bits (207),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E E P   V  D    DA EK  G+ +A DA K++  DEP+ KEPE+KEMTL+
Sbjct  197  PTDEIASEVE-PGTEVEKD---VDA-EKPLGENEAADANKENAEDEPKEKEPEEKEMTLE  251

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+ A + EERKV LDKE +SM  L++KK +DE+F+KLGS
Sbjct  252  EYEKVLEEKRKALAALKTEERKVDLDKELKSMQQLSSKKTNDEIFIKLGS  301


 Score = 32.7 bits (73),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 34/65 (52%), Gaps = 7/65 (11%)
 Frame = -3

Query  387  SINEFLKPAEGETyyr-------pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  229
            SINEFLKPAEGE+           GGRG   G+     G   +N ++   PSI D   FP
Sbjct  321  SINEFLKPAEGESQRHYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPSIADTALFP  380

Query  228  TLGSK  214
            +LG K
Sbjct  381  SLGGK  385



>ref|XP_011465242.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=384

 Score = 84.3 bits (207),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIA E E P   V  D    DA EK  G+ +A DA K++  DEP+ KEPE+KEMTL+
Sbjct  196  PTDEIASEVE-PGTEVEKD---VDA-EKPLGENEAADANKENAEDEPKEKEPEEKEMTLE  250

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+ A + EERKV LDKE +SM  L++KK +DE+F+KLGS
Sbjct  251  EYEKVLEEKRKALAALKTEERKVDLDKELKSMQQLSSKKTNDEIFIKLGS  300


 Score = 32.7 bits (73),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 34/65 (52%), Gaps = 7/65 (11%)
 Frame = -3

Query  387  SINEFLKPAEGETyyr-------pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  229
            SINEFLKPAEGE+           GGRG   G+     G   +N ++   PSI D   FP
Sbjct  320  SINEFLKPAEGESQRHYSGRNRGRGGRGSRGGYSGEGHGGHSSNANAKPAPSIADTALFP  379

Query  228  TLGSK  214
            +LG K
Sbjct  380  SLGGK  384



>ref|XP_006853790.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
 gb|ERN15257.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
Length=403

 Score = 78.6 bits (192),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 2/86 (2%)
 Frame = -2

Query  691  EKQHGQEDAGDA--KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  518
            EKQ  QED  DA  +K++ ++EPE KEPEDKEMTL+EYEK+ EEKRKA+LA +PEERKV 
Sbjct  222  EKQPEQEDGVDAGKEKENAVNEPEEKEPEDKEMTLEEYEKVREEKRKALLAMKPEERKVD  281

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            +DKEF+SM  L+ KK +D++F+KLGS
Sbjct  282  VDKEFKSMQQLSLKKGNDDIFIKLGS  307


 Score = 38.1 bits (87),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLG  220
            SINEFLKPAEGE YY PGGRGRGRG G   G  GG   SS      PSIED GQFPTLG
Sbjct  329  SINEFLKPAEGEKYYSPGGRGRGRGRGDRGGYRGGYTGSSANVALAPSIEDPGQFPTLG  387



>gb|KJB37649.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=307

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KEMTL+
Sbjct  179  PTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLE  234

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KLGS
Sbjct  235  EYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKLGS  283



>gb|KJB25494.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=353

 Score = 77.0 bits (188),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 72/109 (66%), Gaps = 7/109 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEIAPE E              + EKQ G+EDA DA K++       ++  + +MTL+E
Sbjct  178  TDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKEN-AANEAEEKEPENKMTLEE  231

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D++F+KLGS
Sbjct  232  YEKILEEKRKALDALKTEGRKVDV-KEFESMQQLSNKKSNDDIFIKLGS  279


 Score = 39.3 bits (90),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 33/58 (57%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY PG          G  G   N  S+ + PSI D G FP+LG K
Sbjct  298  SINEFLKPAEGERYYGPGRGRGRGRGPRGGYGG--NTASNVQAPSIADPGHFPSLGGK  353



>ref|XP_009368154.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Pyrus x bretschneideri]
Length=362

 Score = 83.2 bits (204),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EKQ G+ +A DA K+  ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EERKV +D
Sbjct  202  EKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVD  261

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            K+ ++M LL+NKK +DE+F+KLGS
Sbjct  262  KDLKAMQLLSNKKENDEIFIKLGS  285


 Score = 33.1 bits (74),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   G  G  G  +S+   PSI D GQFP+LG K
Sbjct  305  SINEFLKPAEGERYYGGRGRGRGRGPRGGYSGGPGGYSSNAAAPSIGDPGQFPSLGGK  362



>gb|AAF14244.1|AF110228_1 nuclear RNA binding protein A [Spinacia oleracea]
Length=356

 Score = 83.2 bits (204),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 4/110 (4%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P DEIA E EEP   V N+ V   A EK  G+E A DA K++P  E E  EPE+K+MTL+
Sbjct  172  PADEIAQETEEPAV-VENEAVV--AAEKPAGEEVA-DAGKENPEKEAEEVEPEEKQMTLE  227

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA + EERKV +DK+FESM L   KK DDEVF++L S
Sbjct  228  EYEKVLEEKRKALLALKAEERKVDVDKDFESMQLKTKKKVDDEVFIQLNS  277


 Score = 32.3 bits (72),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET-PSIEDVGQFPTLGSK  214
            SINEFL+PAEG   Y+  G     G G   G  GG    +  T P IED  QFPTLG K
Sbjct  297  SINEFLRPAEGGDQYQRRGGRGRGGRGGRGGNGGGGYGMNHATAPKIEDPNQFPTLGGK  355



>ref|XP_009343931.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=367

 Score = 82.4 bits (202),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 80/114 (70%), Gaps = 11/114 (10%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTD---AFEKQHGQEDAGDAKKDSPLdepevkepedkEM  599
            P+D+IAPE EEP       G  T+     EKQ G+ +  DA KDS ++E E KEPE+++ 
Sbjct  184  PSDDIAPEIEEP-------GTETEKNVGAEKQSGENETADANKDSTVNETEEKEPEEEKE  236

Query  598  TLDE-YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
               E YEK+LEEKRKA+LA + EERKV +DK+ ++M LL+NKK +DE+F+KLGS
Sbjct  237  MTLEEYEKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNKKENDEIFIKLGS  290


 Score = 33.1 bits (74),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SIN+FLKP EGE YY   GRGRGRG   G  G  G  +S+   PSIED GQFP+LG K
Sbjct  310  SINQFLKPTEGERYYGGRGRGRGRGPRGGYSGGPGGYSSNVAAPSIEDPGQFPSLGGK  367



>ref|XP_011032359.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Populus euphratica]
Length=360

 Score = 73.6 bits (179),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 16/115 (14%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHG-----QEDAGDAKKDSPLdepevkepedk  605
            PTDE+A   EE      N+G      EK  G     ++ A D KK++P +EPE KEPEDK
Sbjct  184  PTDELALVTEE----AANEG------EKNWGDDKPVEDAAADGKKENPANEPEEKEPEDK  233

Query  604  EMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+NKK +++VF+KLGS
Sbjct  234  VMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFQSMQQLSNKKENNDVFIKLGS  287


 Score = 42.0 bits (97),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY  G R RGRG G+   G   +  SS   PSIED GQFPTLG K
Sbjct  304  SINEFLKPAEGERYYGAGSRSRGRGRGARGFGNR-DGMSSVPAPSIEDPGQFPTLGGK  360



>gb|KCW77830.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=370

 Score = 79.3 bits (194),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 80/111 (72%), Gaps = 5/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE EE     V +   T   EKQ   ED  DA K+ PL+EPE KEPEDKEMTL+
Sbjct  184  PTDEIAPETEE----PVTEVEKTGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLE  239

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND-DEVFVKLGS  440
            EYEK+ EE RK++LA + EERKV LDK+ +SM  L+NKK D +++F+KLGS
Sbjct  240  EYEKVFEENRKSLLALKTEERKVELDKDLKSMQQLSNKKKDNNDIFIKLGS  290


 Score = 36.2 bits (82),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 32/61 (52%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETy---yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE Y      G        G   GG GG        PSIED GQFP+LG 
Sbjct  310  SINEFLKPAEGERYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGG  369

Query  216  K  214
            K
Sbjct  370  K  370



>ref|XP_006837401.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
 gb|ERN00255.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
Length=362

 Score = 75.1 bits (183),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%), Gaps = 5/111 (5%)
 Frame = -2

Query  769  PTDEIA-PEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTL  593
            P DE A  E+EE    VV +     + EK   +E+     KD+ ++EPE KEPE+KEMTL
Sbjct  177  PIDEGAVQESEE----VVGENGKVTSPEKPSEEENNAAVNKDNAVNEPEQKEPENKEMTL  232

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             EYEK+LEEKRKA+ A + EERKV LDK+FESM  L++KK +D+VF+KLGS
Sbjct  233  SEYEKVLEEKRKALQALKNEERKVNLDKDFESMLQLSDKKANDDVFIKLGS  283


 Score = 38.9 bits (89),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKP +G  YY P GRGRG+G G   GG   N+T+S   PSIED  QFPTL +K
Sbjct  305  SINEFLKPVDGGRYYSPRGRGRGQGRGGFGGGISSNSTNSIAAPSIEDQNQFPTLAAK  362



>ref|XP_011047584.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=364

 Score = 72.0 bits (175),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L++KK++ E+F+KLGS
Sbjct  238  MTLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQLSSKKSNAEIFIKLGS  291


 Score = 41.6 bits (96),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 34/58 (59%), Gaps = 4/58 (7%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA G+ +Y PG          G GG    NT   E PSIED GQFPTLG K
Sbjct  311  SINEFLKPAGGDRHYNPGRGRGRGRGRGGYGG----NTRDVEAPSIEDPGQFPTLGGK  364



>ref|XP_010104826.1| hypothetical protein L484_024026 [Morus notabilis]
 gb|EXC02062.1| hypothetical protein L484_024026 [Morus notabilis]
Length=463

 Score = 72.8 bits (177),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE EEP+        N DA  ++ G E+A DA K+ P  E E KEPEDKEMTL+
Sbjct  211  PTDEIAPEVEEPVVENEK---NVDA--EKLGDEEASDANKEKPEKEAEEKEPEDKEMTLE  265

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+LA + EERKV   KEFESM  L++KK +DE+F+KLGS
Sbjct  266  EYEKVLEEKRKALLALKTEERKVD-SKEFESMQQLSSKKGNDEIFIKLGS  314


 Score = 40.8 bits (94),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE YY PGGRGRGRG GS  G  GG ++S+   PSIED GQFPTLG
Sbjct  334  SINEFLKPAEGERYYTPGGRGRGRGRGSRGGYGGGYSSSNVAAPSIEDPGQFPTLG  389



>ref|XP_007218155.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
 gb|EMJ19354.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
Length=369

 Score = 70.5 bits (171),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EK  G+ DA D  K++P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    
Sbjct  209  EKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSEERKVDT  268

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            KEF S+  L+NKK +D++F+KLGS
Sbjct  269  KEFASLQQLSNKKGNDDIFIKLGS  292


 Score = 42.7 bits (99),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y PGGRGRGRG G   G     +  S   PSIED GQFPTLG+K
Sbjct  312  SINEFLKPAEGERFYNPGGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGAK  369



>ref|XP_004306983.1| PREDICTED: circumsporozoite protein-like [Fragaria vesca subsp. 
vesca]
Length=387

 Score = 75.1 bits (183),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 9/100 (9%)
 Frame = -2

Query  721  VNDGVNTDAFEKQHGQE------DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKR  560
            V +GV  DA EK  G+E      +A D  K++P +EPE KEPE+KEMTL+EYEK+LEEKR
Sbjct  214  VTEGV--DATEKNLGEEKLVGEVEAADGSKETPANEPEEKEPEEKEMTLEEYEKVLEEKR  271

Query  559  KAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            KA+ A + EERKV   KEFES+  ++NKK +D+VF+KLGS
Sbjct  272  KALQALKTEERKVDT-KEFESLQQISNKKGNDDVFIKLGS  310


 Score = 38.1 bits (87),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +  P   GRGRG G   G       SS   P IED   FPTLG K
Sbjct  330  SINEFLKPAEGERFSYPSRGGRGRGRGPRGGSSSNYPQSSVRAPPIEDPSHFPTLGGK  387



>ref|XP_009368155.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Pyrus x bretschneideri]
Length=359

 Score = 83.2 bits (204),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EKQ G+ +A DA K+  ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EERKV +D
Sbjct  202  EKQSGENEAADANKEDAVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVD  261

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            K+ ++M LL+NKK +DE+F+KLGS
Sbjct  262  KDLKAMQLLSNKKENDEIFIKLGS  285


 Score = 30.0 bits (66),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   G  G  G N +    PSI D GQFP+LG K
Sbjct  305  SINEFLKPAEGERYYGGRGRGRGRGPRGGYSGGPGGNAA---PPSIGDPGQFPSLGGK  359



>gb|ABK94354.1| unknown [Populus trichocarpa]
Length=373

 Score = 73.6 bits (179),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 16/115 (14%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHG-----QEDAGDAKKDSPLdepevkepedk  605
            PTDE+A   EE      N+G      EK  G     +E A D KK++P +EPE KEPEDK
Sbjct  184  PTDELALVTEE----AANEG------EKNLGDDKPVEEAAADRKKENPANEPEEKEPEDK  233

Query  604  EMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+NKK +++VF+KLGS
Sbjct  234  VMTLEEYEKVLEEKRKALQALKTEERKVDT-KEFQSMQQLSNKKENNDVFIKLGS  287


 Score = 39.3 bits (90),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 40/67 (60%), Gaps = 9/67 (13%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggy---------gGNNTSSFETPSIEDVGQ  235
            SINEFLKPAEGE YY  G RGRGRG G+   G            +  SS   PSIED GQ
Sbjct  307  SINEFLKPAEGERYYGSGSRGRGRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQ  366

Query  234  FPTLGSK  214
            FPTLG K
Sbjct  367  FPTLGGK  373



>ref|XP_006375155.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 ref|XP_006375156.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52952.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52953.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
Length=373

 Score = 73.6 bits (179),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 16/115 (14%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHG-----QEDAGDAKKDSPLdepevkepedk  605
            PTDE+A   EE      N+G      EK  G     +E A D KK++P +EPE KEPEDK
Sbjct  184  PTDELALVTEE----AANEG------EKNLGDDKPVEEAAADRKKENPANEPEEKEPEDK  233

Query  604  EMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+NKK +++VF+KLGS
Sbjct  234  VMTLEEYEKVLEEKRKALQALKTEERKVDT-KEFQSMQQLSNKKENNDVFIKLGS  287


 Score = 39.3 bits (90),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 40/67 (60%), Gaps = 9/67 (13%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggy---------gGNNTSSFETPSIEDVGQ  235
            SINEFLKPAEGE YY  G RGRGRG G+   G            +  SS   PSIED GQ
Sbjct  307  SINEFLKPAEGERYYGSGSRGRGRGRGARGFGNRDGMSSGFGNRDGMSSVPAPSIEDPGQ  366

Query  234  FPTLGSK  214
            FPTLG K
Sbjct  367  FPTLGGK  373



>ref|XP_008232490.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Prunus mume]
Length=369

 Score = 70.5 bits (171),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EK  G+ DA D  K++P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    
Sbjct  209  EKPVGEVDAADGNKETPANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSEERKVDT  268

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            KEF S+  L+NKK +D++F+KLGS
Sbjct  269  KEFASLQQLSNKKGNDDIFIKLGS  292


 Score = 42.4 bits (98),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y PGGRGRGRG G   G     +  S   PSIED GQFPTLG K
Sbjct  312  SINEFLKPAEGERFYNPGGRGRGRGRGPRGGFSNNYSHGSAAAPSIEDPGQFPTLGGK  369



>ref|XP_011032341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
 ref|XP_011032350.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
Length=370

 Score = 73.9 bits (180),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 16/115 (14%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHG-----QEDAGDAKKDSPLdepevkepedk  605
            PTDE+A   EE      N+G      EK  G     ++ A D KK++P +EPE KEPEDK
Sbjct  184  PTDELALVTEE----AANEG------EKNWGDDKPVEDAAADGKKENPANEPEEKEPEDK  233

Query  604  EMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+NKK +++VF+KLGS
Sbjct  234  VMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFQSMQQLSNKKENNDVFIKLGS  287


 Score = 38.9 bits (89),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 36/67 (54%), Gaps = 9/67 (13%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrg---------rghgsgrggygGNNTSSFETPSIEDVGQ  235
            SINEFLKPAEGE YY  G R RG            G   G    +  SS   PSIED GQ
Sbjct  304  SINEFLKPAEGERYYGAGSRSRGRGRGARGFGNRDGMSSGFGSRDGMSSVPAPSIEDPGQ  363

Query  234  FPTLGSK  214
            FPTLG K
Sbjct  364  FPTLGGK  370



>ref|XP_003529036.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score = 77.4 bits (189),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = -2

Query  697  AFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  518
            A EK  G+EDA +  KD P +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E RKV 
Sbjct  209  ADEKPAGEEDAPEGNKDCPANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEVRKVD  268

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            + KEF SM  L+NKK +DE+F+KLGS
Sbjct  269  I-KEFASMQPLSNKKENDEIFIKLGS  293


 Score = 35.0 bits (79),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 30/58 (52%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +I EFLKPAEGE YY  G          G      N  S+   PSIED GQFPTL  K
Sbjct  313  NITEFLKPAEGERYYSGGRGRGRGRGSRGGYSG--NAYSNVPAPSIEDPGQFPTLSGK  368



>ref|XP_009776248.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=363

 Score = 71.2 bits (173),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 73/108 (68%), Gaps = 13/108 (12%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A E E+ +N            EK     +AGD KK++P  E E KEPE+KEMTL+E
Sbjct  188  TDEVANEGEKNLN-----------VEKPSADGEAGDDKKENPAAEAEDKEPENKEMTLEE  236

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLG  443
            YEK+LEEKR+A+ A + EERKV + KEFESM  L+ K +DD +F+KLG
Sbjct  237  YEKVLEEKRQALQALKTEERKVDI-KEFESMQQLSKKSSDD-IFIKLG  282


 Score = 41.6 bits (96),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 34/62 (55%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGET----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE       R  G       G G G  G N TS+ E P IED G FPTLG
Sbjct  302  SINEFLKPAEGERYYAPGGRGRGGRGRGSRGYGGGYGGANTTSNVEAPLIEDPGHFPTLG  361

Query  219  SK  214
             K
Sbjct  362  GK  363



>ref|XP_009373211.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=372

 Score = 69.3 bits (168),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  670  DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  491
            DA D  KD+P +EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEFES  
Sbjct  219  DAADGNKDTPANEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQ  278

Query  490  LLANKKNDDEVFVKLG  443
             L+NKK +DE+F+KLG
Sbjct  279  QLSNKKANDEIFIKLG  294


 Score = 43.1 bits (100),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGN-NTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE  Y PGGRGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  314  SINEFLKPAEGERSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  372



>ref|XP_008344404.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=367

 Score = 70.1 bits (170),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -2

Query  670  DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  491
            DA D KKD+P +EPE KEPEDKEMTL+EY+K+LEEKRKA+ A +  E +    KEFES  
Sbjct  214  DAADGKKDTPANEPEEKEPEDKEMTLEEYQKVLEEKRKALQALKTTEERKVDAKEFESFQ  273

Query  490  LLANKKNDDEVFVKLG  443
             L+NKK +DE+F+KLG
Sbjct  274  QLSNKKANDEIFIKLG  289


 Score = 42.4 bits (98),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGN-NTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y PGGRGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  309  SINEFLKPAEGERFYNPGGRGRGRGRGSKGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  367



>ref|XP_010053519.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X1 [Eucalyptus grandis]
Length=374

 Score = 77.4 bits (189),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (72%), Gaps = 5/110 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTDEIAPE EE     V +   T   EKQ   ED  DA K+ PL+EPE KEPEDKEMTL+
Sbjct  184  PTDEIAPETEE----PVTEVEKTGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLE  239

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND-DEVFVKLG  443
            EYEK+ EE RK++LA + EERKV LDK+ +SM  L+NKK D +++F+KLG
Sbjct  240  EYEKVFEENRKSLLALKTEERKVELDKDLKSMQQLSNKKKDNNDIFIKLG  289


 Score = 35.0 bits (79),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 34/65 (52%), Gaps = 7/65 (11%)
 Frame = -3

Query  387  SINEFLKPAEGET-------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  229
            SINEFLKPAEGE            G   RG   G G GG GG        PSIED GQFP
Sbjct  310  SINEFLKPAEGERYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFP  369

Query  228  TLGSK  214
            +LG K
Sbjct  370  SLGGK  374



>emb|CDP21265.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 76.6 bits (187),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQH-GQEDAGDAKKDSPLdepevkepedkEMTLD  590
            +DE+A  AEE     VN+G      EKQ  G+ED  D  K++P +E E KEPE+KEMTL+
Sbjct  185  SDEVAQAAEE-----VNEGEKNPNAEKQPPGEEDTADGSKETPANESEEKEPENKEMTLE  239

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRK +   + EERKV   K F SM  LANKK +++VF+KLGS
Sbjct  240  EYEKVLEEKRKTLQTLKTEERKVDA-KAFASMQQLANKKANEDVFIKLGS  288


 Score = 35.8 bits (81),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y PGGRGRGRG GS   G G +   + ETPSIED+  FP+LGSK
Sbjct  308  SINEFLKPAEGEKFYNPGGRGRGRGRGSRGYGGGNS-YGNVETPSIEDLVLFPSLGSK  364



>ref|XP_008375773.1| PREDICTED: LOW QUALITY PROTEIN: plasminogen activator inhibitor 
1 RNA-binding protein-like [Malus domestica]
Length=373

 Score = 69.3 bits (168),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  670  DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  491
            DA D  KD+P  EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEFES  
Sbjct  220  DAADGNKDTPXKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQ  279

Query  490  LLANKKNDDEVFVKLG  443
             L+NKK +DE+F+KLG
Sbjct  280  QLSNKKANDEIFIKLG  295


 Score = 43.1 bits (100),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGN-NTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE  Y PGGRGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  315  SINEFLKPAEGERSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  373



>gb|KJB37650.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=284

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 5/108 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            PTD IAPE EE     V +     + EKQ G+EDA DA K++  +E E KEPE+KEMTL+
Sbjct  179  PTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKENAANEAEEKEPENKEMTLE  234

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  446
            EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KL
Sbjct  235  EYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKL  281



>ref|XP_008347095.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=236

 Score = 68.9 bits (167),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  670  DAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  491
            DA D  KD+P  EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEFES  
Sbjct  83   DAADGNKDTPAKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQ  142

Query  490  LLANKKNDDEVFVKLG  443
             L+NKK +DE+F+KLG
Sbjct  143  QLSNKKANDEIFIKLG  158


 Score = 42.7 bits (99),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGN-NTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE  Y PGGRGRGRG GS  GG+  N + SS   PSIED GQFPTLG K
Sbjct  178  SINEFLKPAEGERSYNPGGRGRGRGRGSRGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  236



>ref|XP_010053521.1| PREDICTED: vasodilator-stimulated phosphoprotein-like [Eucalyptus 
grandis]
Length=368

 Score = 75.5 bits (184),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EKQ   E+A DA K++PL+EPE KEPEDKEMTL+EYEK+ EEKRKA+L  + EERKV +D
Sbjct  205  EKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEERKVEVD  264

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            KE +SM  L++KK + ++F+KLGS
Sbjct  265  KELKSMQQLSSKKENHDIFIKLGS  288


 Score = 36.2 bits (82),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 32/61 (52%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETy---yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE Y      G        G   GG GG        PSIED GQFP+LG 
Sbjct  308  SINEFLKPAEGERYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGG  367

Query  216  K  214
            K
Sbjct  368  K  368



>ref|NP_001241515.1| uncharacterized protein LOC100807657 [Glycine max]
 gb|ACU21122.1| unknown [Glycine max]
Length=367

 Score = 74.3 bits (181),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   +E    V N+       EK   +ED  D  KDSP +E E KEPEDKEMTL+E
Sbjct  187  TDELAQVTDE----VANETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEE  242

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS
Sbjct  243  YEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGS  290


 Score = 37.4 bits (85),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SI EFLKPAEGE YY PG          G GGY G+ T++   PSIED G FPTL +K
Sbjct  310  SITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGYHGSATNNAPAPSIEDPGHFPTLSAK  367



>gb|KCW77831.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=369

 Score = 75.5 bits (184),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EKQ   E+A DA K++PL+EPE KEPEDKEMTL+EYEK+ EEKRKA+L  + EERKV +D
Sbjct  206  EKQLVDEEAADASKENPLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEERKVEVD  265

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            KE +SM  L++KK + ++F+KLGS
Sbjct  266  KELKSMQQLSSKKENHDIFIKLGS  289


 Score = 36.2 bits (82),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 32/61 (52%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETy---yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE Y      G        G   GG GG        PSIED GQFP+LG 
Sbjct  309  SINEFLKPAEGERYYNPGGRGRGRGRGARGGYGGGGGGGYARDAAAPSIEDPGQFPSLGG  368

Query  216  K  214
            K
Sbjct  369  K  369



>ref|XP_010531668.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score = 72.0 bits (175),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVC  518
            EK  G ++A DA K++P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LA+   ERKV 
Sbjct  197  EKPAGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLATSDSERKVD  256

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            L KEFESM  L+NKK +DE+F+KLGS
Sbjct  257  L-KEFESMQQLSNKKANDEIFIKLGS  281


 Score = 39.3 bits (90),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE YY  GGRGRGRG G G  G G     S   P+IED  QFP+LG
Sbjct  301  SINEFLKPAEGEGYYPRGGRGRGRGRGGGSRGGGYGGYQSKAAPAIEDTAQFPSLG  356



>ref|XP_010053520.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW77832.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=352

 Score = 76.3 bits (186),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = -2

Query  703  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  524
            T   EKQ   ED  DA K+ PL+EPE KEPEDKEMTL+EYEK+ EE RK++LA + EERK
Sbjct  180  TGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEERK  239

Query  523  VCLDKEFESMALLANKKND-DEVFVKLG  443
            V LDK+ +SM  L+NKK D +++F+KLG
Sbjct  240  VELDKDLKSMQQLSNKKKDNNDIFIKLG  267


 Score = 35.0 bits (79),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 34/65 (52%), Gaps = 7/65 (11%)
 Frame = -3

Query  387  SINEFLKPAEGET-------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  229
            SINEFLKPAEGE            G   RG   G G GG GG        PSIED GQFP
Sbjct  288  SINEFLKPAEGERYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFP  347

Query  228  TLGSK  214
            +LG K
Sbjct  348  SLGGK  352



>gb|KJB24892.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=333

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   E     V N+G      EK  G+EDA +A K+S  +EPE KEPEDKEMTL+E
Sbjct  183  TDELAQVTE-----VTNEGERNLGDEKPAGEEDAREANKESASNEPEEKEPEDKEMTLEE  237

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + EERKV   KEFESM  L+NKKN+DEVF+KLGS
Sbjct  238  YEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKNNDEVFIKLGS  285



>ref|XP_010924482.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1-like 
protein [Elaeis guineensis]
Length=376

 Score = 72.8 bits (177),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 70/105 (67%), Gaps = 7/105 (7%)
 Frame = -2

Query  733  INGVVNDGVNTD----AFEKQHGQEDA--GDAKKDSPLdepevkepedkE-MTLDEYEKL  575
            I    ++ VN D    A EKQ  QEDA   +A KD  +   E ++  + + MTL+EYEK+
Sbjct  190  IAQASDENVNADDKLVATEKQQEQEDAPSSEANKDKDVQTNEEEKEPEDKEMTLEEYEKI  249

Query  574  LEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             EEKRKA+LA + EERKV +D+E +SM  L++KK +++VF+KLGS
Sbjct  250  REEKRKALLALKIEERKVEIDRELQSMQQLSSKKGNEDVFIKLGS  294


 Score = 37.0 bits (84),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 36/61 (59%), Gaps = 4/61 (7%)
 Frame = -3

Query  387  SINEFLKPAEGE----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SIN+FLKPAEGE       R  GRGRG       G  GG+ ++    PSIED GQFPTLG
Sbjct  316  SINQFLKPAEGERYYSATGRGRGRGRGGRGPFRGGFGGGDTSAPAAAPSIEDPGQFPTLG  375

Query  219  S  217
             
Sbjct  376  K  376



>ref|XP_010531670.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Tarenaya 
hassleriana]
Length=359

 Score = 71.6 bits (174),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVC  518
            EK  G ++A DA K++P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LAS   ERKV 
Sbjct  197  EKPAGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVD  256

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            L KEFESM  L+NKK +DE+F+KLGS
Sbjct  257  L-KEFESMQQLSNKKANDEIFIKLGS  281


 Score = 37.7 bits (86),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE YY  GGRGRGRG G G  G G     +   P+IED  QFP+LG
Sbjct  301  SINEFLKPAEGEGYYPRGGRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFPSLG  356



>ref|XP_003624316.1| Transcription factor [Medicago truncatula]
Length=625

 Score = 69.3 bits (168),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEIA   EE    V+N+G      EK   + D  +  KDSP +E E KEPEDKEMTL+E
Sbjct  197  TDEIAQVTEE----VMNEGEKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEE  252

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+   + EERKV   K FE+M  L+ KK++ E+F KLG+
Sbjct  253  YEKVLEEKRKALQTLKTEERKVDT-KAFETMQALSCKKDNTEIFAKLGA  300


 Score = 39.7 bits (91),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 41/57 (72%), Gaps = 1/57 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE++Y  GGRGRGRG    RGG    N+ S+   PSIED G FPTLG
Sbjct  320  SINEFLKPAEGESHYNSGGRGRGRGGRGARGGGFRGNSYSNVPAPSIEDPGHFPTLG  376



>ref|XP_004515346.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cicer arietinum]
Length=371

 Score = 71.2 bits (173),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            +DEIA   EE    V N+       EK  G+E+A D  K++P +E E KEPEDKEMTL+E
Sbjct  188  SDEIAQVTEE----VANETEKNLGEEKPAGEEEAADVSKETPANEAEEKEPEDKEMTLEE  243

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+ A + E RKV   KEFESM  L+ KK++ E+F KLGS
Sbjct  244  YEKVLEEKRKALQALKTEGRKVDA-KEFESMKPLSCKKDNVEIFAKLGS  291


 Score = 37.4 bits (85),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -3

Query  387  SINEFLKPAEGET---yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPA+GE        GGRG   G GS  GG+GGN  S+   PSIED GQFPTLG
Sbjct  310  SINEFLKPADGEKFYNPGGRGGRGGRGGRGSRGGGFGGNAYSNVPAPSIEDPGQFPTLG  368



>ref|XP_003552493.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=370

 Score = 75.5 bits (184),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   +E    VVN+       EK   +ED  D  KDSP +E E KEPEDKEMTL+E
Sbjct  186  TDELAQVTDE----VVNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEE  241

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS
Sbjct  242  YEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGS  289


 Score = 33.1 bits (74),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGET----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SI EFLKPAEGE         G     RG G G G Y G++T++   PSIED G FP LG
Sbjct  309  SITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGGGGVYRGSSTNNAPAPSIEDPGHFPNLG  368

Query  219  SK  214
            +K
Sbjct  369  AK  370



>gb|KJB22277.1| hypothetical protein B456_004G038700 [Gossypium raimondii]
Length=366

 Score = 76.6 bits (187),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            T+E+A   EE    V N+G      EK     D GDA K+S  +E E KEPE+K MTL+E
Sbjct  178  TNELARVTEE----VANEGNQNLGDEKLARDGDGGDADKESLTNELEEKEPEEKVMTLEE  233

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEKL+EEKRKA+ A + E RKV   KEFESM  L+NKK++DE+F+KLGS
Sbjct  234  YEKLMEEKRKALQALKTEGRKVDA-KEFESMQQLSNKKSNDEIFIKLGS  281


 Score = 32.0 bits (71),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 35/66 (53%), Gaps = 8/66 (12%)
 Frame = -3

Query  387  SINEFLKPAE--------GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  232
            SINEFLKPAE        G    R  G+ +GRGH S   G G   +S    PSIED   F
Sbjct  301  SINEFLKPAERKRYYNPSGRGRGRVQGQDQGRGHSSRGFGGGNARSSMAAAPSIEDRSHF  360

Query  231  PTLGSK  214
            PTLG K
Sbjct  361  PTLGGK  366



>ref|XP_006644341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=370

 Score = 74.7 bits (182),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS
Sbjct  237  MTLEEYEKVLEEKRKALLSLKAEERKVVVDKELQSMQQLSVKKDSDEVFIKLGS  290


 Score = 33.9 bits (76),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS---FETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YY PGGRGRGRG G G  G   +  SS      P+IED  QFP+L  
Sbjct  310  SINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPAIEDQAQFPSLAG  369

Query  216  K  214
            K
Sbjct  370  K  370



>gb|AFK43517.1| unknown [Lotus japonicus]
Length=370

 Score = 65.5 bits (158),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -2

Query  673  EDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESM  494
            ED  D  K+S  +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E RKV + KEFESM
Sbjct  215  EDVADGNKESSANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEGRKVDI-KEFESM  273

Query  493  ALLANKKNDDEVFVKLGS  440
              L+ KK+++++F KLGS
Sbjct  274  QPLSCKKDNNDIFAKLGS  291


 Score = 43.1 bits (100),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETy--yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGETY     G        G G G + GN TS+   PSIED G FPTLG K
Sbjct  311  SINEFLKPAEGETYYPSGRGRGRGRGSRGGGGGSFRGNATSNAPAPSIEDPGHFPTLGGK  370



>ref|XP_010918620.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Elaeis guineensis]
Length=369

 Score = 71.6 bits (174),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 73/106 (69%), Gaps = 8/106 (8%)
 Frame = -2

Query  733  INGVVNDGVNTD----AFEKQHGQEDA----GDAKKDSPLdepevkepedkEMTLDEYEK  578
            I    ++ VN D    A EKQ  Q++A     + +KD   +E E KEP+DKEMTL+EYEK
Sbjct  182  IAQATDENVNADDKIPASEKQPEQDNAPSSEANKEKDVQANEAEEKEPDDKEMTLEEYEK  241

Query  577  LLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            + EEKRKA+LA + EERKV +DKE +SM  L+ KK +D+VF+KLGS
Sbjct  242  IREEKRKALLAMKTEERKVEIDKELQSMQQLSLKKGNDDVFIKLGS  287


 Score = 36.6 bits (83),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 37/61 (61%), Gaps = 4/61 (7%)
 Frame = -3

Query  387  SINEFLKPAEGE---TyyrpggrgrgrghgsgrggygGNNTSSFET-PSIEDVGQFPTLG  220
            SINEFLKPAEGE   +    G        G  RGG+GG  TS+  T PSIED GQFPTLG
Sbjct  309  SINEFLKPAEGERYYSPVGRGRGRGRGDRGPFRGGFGGRGTSTPATAPSIEDPGQFPTLG  368

Query  219  S  217
             
Sbjct  369  K  369



>ref|XP_011017364.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
 ref|XP_011017365.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=359

 Score = 66.6 bits (161),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV   KEF+SM  +++KK +++VF+KLGS
Sbjct  234  MTLEEYEKVLEEKRKALLALKTEERKVDA-KEFQSMQQISSKKENNDVFIKLGS  286


 Score = 41.6 bits (96),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y   GGRGRGRG G+   G   +  S+   PSIED GQFPTLG K
Sbjct  303  SINEFLKPAEGERYQGSGGRGRGRGRGARGFGNR-DGISNVPAPSIEDPGQFPTLGGK  359



>gb|ABY60453.1| putative nuclear RNA binding protein, partial [Adonis aestivalis 
var. palaestina]
Length=154

 Score = 78.6 bits (192),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEY+K+LEEKRKA+LA + EERKV +DK+FESM  L+ KKN+DE+F KLGS
Sbjct  18   MTLDEYQKVLEEKRKALLALKVEERKVTVDKDFESMQQLSGKKNNDEIFAKLGS  71


 Score = 29.6 bits (65),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-----TSSFETPSIEDVGQFPTL  223
            SINEFLKPA GE YY PGGRGRGRG   G  G G        + + E PSIED G+FP L
Sbjct  91   SINEFLKPAGGEKYYSPGGRGRGRGGRGGARGGGAGGFSGGVSKNVEAPSIEDPGEFPNL  150

Query  222  GSK  214
              K
Sbjct  151  LKK  153



>ref|XP_007139646.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
 gb|ESW11640.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
Length=365

 Score = 66.6 bits (161),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -2

Query  673  EDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESM  494
            E+  D  KDSP +E E KEPEDKEMTL+EYEK+LEE+RKA  A + E RKV   KEFE+M
Sbjct  212  EEVADGNKDSPANETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEGRKVDA-KEFETM  270

Query  493  ALLANKKNDDEVFVKLGS  440
              L++KK + ++F+KLGS
Sbjct  271  QPLSSKKTNHDIFIKLGS  288


 Score = 41.6 bits (96),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SI EFLKPAEGETYY PGGRGRGRG    RGGY G  T++   PSIED G FPTLG+K
Sbjct  308  SITEFLKPAEGETYYNPGGRGRGRGGRGSRGGYRGGATNNAPAPSIEDPGHFPTLGAK  365



>ref|XP_002458112.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
 gb|EES03232.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
Length=366

 Score = 75.1 bits (183),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L  +PEERKV +DKE +SM  L+ KK  DE+F+KLGS
Sbjct  231  MTLEEYEKVLEEKRKALLGLKPEERKVEVDKELQSMQQLSVKKGADEIFIKLGS  284


 Score = 33.1 bits (74),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-----TPSIEDVGQFPTL  223
            SINEFLKPAEG+ YY PGGRGRGRG G G  G      S  E      P+I+D  QFP+L
Sbjct  304  SINEFLKPAEGQRYYSPGGRGRGRGRGRGDRGGFRGGYSPREVAAAPAPAIQDQAQFPSL  363

Query  222  GSK  214
            G K
Sbjct  364  GGK  366



>gb|KHN40549.1| hypothetical protein glysoja_001047 [Glycine soja]
Length=363

 Score = 75.5 bits (184),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE+A   +E    VVN+       EK   +ED  D  KDSP +E E KEPEDKEMTL+E
Sbjct  177  TDELAQVTDE----VVNETEKNLGDEKPAVEEDVADGNKDSPTNETEEKEPEDKEMTLEE  232

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS
Sbjct  233  YEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGS  280


 Score = 32.3 bits (72),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 37/64 (58%), Gaps = 6/64 (9%)
 Frame = -3

Query  387  SINEFLKPAEGET------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  226
            SI EFLKPAEGE           G   RG G G G G Y G++T++   PSIED G FP 
Sbjct  300  SITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGGGGGGVYRGSSTNNAPAPSIEDPGHFPN  359

Query  225  LGSK  214
            LG+K
Sbjct  360  LGAK  363



>dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score = 65.1 bits (157),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = -2

Query  766  TDEIAPEAEEP-INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            TDEIA   EE  I G  N G    A E      DA +  KDS  +E E KE EDKEMTL+
Sbjct  191  TDEIAQVTEEAVIEGEKNIGDEKPAVEN-----DAAEGNKDSAANEAEEKEAEDKEMTLE  245

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EY+K+LEEKRKA+   + EERKV   KEFE+M  L+ KK++ E+F KLGS
Sbjct  246  EYQKVLEEKRKALQVVKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGS  294


 Score = 42.7 bits (99),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG+ Y+R  G       G G G  GGN   +   PSIED G FPTLG+K
Sbjct  314  SINEFLKPAEGDAYHRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGHFPTLGAK  371



>dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score = 65.1 bits (157),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 70/110 (64%), Gaps = 7/110 (6%)
 Frame = -2

Query  766  TDEIAPEAEEP-INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            TDEIA   EE  I G  N G    A E      DA +  KDS  +E E KE EDKEMTL+
Sbjct  191  TDEIAQVTEEAVIEGEKNIGDEKPAVEN-----DAAEGNKDSAANEAEEKEAEDKEMTLE  245

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EY+K+LEEKRKA+   + EERKV   KEFE+M  L+ KK++ E+F KLGS
Sbjct  246  EYQKVLEEKRKALQVVKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGS  294


 Score = 42.4 bits (98),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG+ YYR  G       G G G  GGN   +   PSIED G FPTLG+K
Sbjct  314  SINEFLKPAEGDAYYRGRGGRGREARGGGGGYRGGNLNRNVRAPSIEDPGHFPTLGAK  371



>ref|XP_002301233.2| transcription factor family protein [Populus trichocarpa]
 gb|ABK94212.1| unknown [Populus trichocarpa]
 gb|EEE80506.2| transcription factor family protein [Populus trichocarpa]
Length=359

 Score = 66.2 bits (160),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV   +EF+SM  +++KK +++VF+KLGS
Sbjct  234  MTLEEYEKVLEEKRKALLALKTEERKVDT-REFQSMQQISSKKENNDVFIKLGS  286


 Score = 41.2 bits (95),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE Y+  GGRGRGRG G+   G   +  S+   PSIED GQFPTLG K
Sbjct  303  SINEFLKPAEGERYHGSGGRGRGRGRGARGFGNR-DGISNVPAPSIEDPGQFPTLGGK  359



>ref|XP_009395730.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal-like [Musa 
acuminata subsp. malaccensis]
Length=381

 Score = 67.0 bits (162),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+ EEKRKA+ A + EERKV +DK+ +SM  L+ KK +D++FVKLGS
Sbjct  245  MTLEEYEKVREEKRKALAAMKSEERKVEMDKDLQSMKQLSLKKENDDIFVKLGS  298


 Score = 40.0 bits (92),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGET--yyrpggrgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLG  220
            SINEFLKPAEGE        GRGRGRG      G      S+F T  PSIED GQFPTLG
Sbjct  320  SINEFLKPAEGERYYNSGGRGRGRGRGGRGQFRGGFMGGVSTFTTDAPSIEDPGQFPTLG  379

Query  219  SK  214
             K
Sbjct  380  GK  381



>emb|CDY40563.1| BnaC02g33290D [Brassica napus]
Length=330

 Score = 79.3 bits (194),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EE    V    V     EK+ G++D  DAKKD+P DE + KEPEDKEMTL+
Sbjct  148  PEDDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDTPADEGKEKEPEDKEMTLE  203

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FESM  L++KK N++E+F+KLGS
Sbjct  204  EYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNNEEIFIKLGS  253


 Score = 27.3 bits (59),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFPTLGS  217
            SINEFLKPA+GE Y   GG  RGRG  +G  G      +     P+I D  QFP+LG 
Sbjct  273  SINEFLKPADGERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQFPSLGK  330



>ref|XP_010531669.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score = 70.1 bits (170),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 3/86 (3%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVC  518
            EK  G ++A DA K++P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LAS   ERKV 
Sbjct  197  EKPAGDDEAADANKETPAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVD  256

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            L KEFESM  L+NKK +DE F+KLGS
Sbjct  257  L-KEFESMQQLSNKKANDEFFIKLGS  281


 Score = 36.2 bits (82),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPA+GE YY  GGRGRGRG G G  G G     +   P+IED  QFP+LG
Sbjct  301  SINEFLKPADGEGYYPRGGRGRGRGRGGGSRGGGYGGYQNKAAPAIEDTAQFPSLG  356



>ref|XP_009101440.1| PREDICTED: suppressor protein STM1 [Brassica rapa]
Length=333

 Score = 78.6 bits (192),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+I P   EP   V    V     E   G++D  DAKKDSP  E E KEPEDKEMTL+EY
Sbjct  151  DDIPPPTVEPTTEVEKSPV----AENDGGEDDTTDAKKDSPAAEQEEKEPEDKEMTLEEY  206

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK N++E+F+KLGS
Sbjct  207  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTNNEEIFIKLGS  254


 Score = 27.7 bits (60),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 29/59 (49%), Gaps = 3/59 (5%)
 Frame = -3

Query  387  SINEFLKPAEGET---yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPA+GE             GRG G G+   G         P+I D  QFP+LG
Sbjct  274  SINEFLKPADGERYNNPRGGYRGRGGRGGGRGQRDGGNQRHGGAPAPAIGDSAQFPSLG  332



>ref|XP_010919739.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Elaeis guineensis]
Length=376

 Score = 76.6 bits (187),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEKLLEEKRKA+ A  R EERKV +DKEFE M  L+ KKNDD+VF+KLGS
Sbjct  243  MTLDEYEKLLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKKNDDDVFIKLGS  297


 Score = 29.6 bits (65),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  384  INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            IN FL+PAE E  + PGGRGRGRG   G  G G     +   PSIED G FPTLG
Sbjct  320  INTFLRPAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPSIEDPGHFPTLG  374



>ref|XP_010919740.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Elaeis guineensis]
Length=375

 Score = 76.6 bits (187),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEKLLEEKRKA+ A  R EERKV +DKEFE M  L+ KKNDD+VF+KLGS
Sbjct  242  MTLDEYEKLLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKKNDDDVFIKLGS  296


 Score = 29.6 bits (65),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  384  INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            IN FL+PAE E  + PGGRGRGRG   G  G G     +   PSIED G FPTLG
Sbjct  319  INTFLRPAEEERQHNPGGRGRGRGGRDGGIGSGRTGAMNTTPPSIEDPGHFPTLG  373



>ref|XP_006654864.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=379

 Score = 72.4 bits (176),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK+++EVF+KLGS
Sbjct  242  MTLEEYEKVLEEKRKALLALKAEERKVEVDKELQSMQQLSVKKDNEEVFIKLGS  295


 Score = 33.5 bits (75),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 33/64 (52%), Gaps = 6/64 (9%)
 Frame = -3

Query  387  SINEFLKPAEGET------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  226
            SINEFLKPAEGE         R  GRGRG   G   G  G         P+IED  QFP+
Sbjct  316  SINEFLKPAEGERYYNPSGRGRGRGRGRGEHRGFYGGFNGNGGRRHASAPAIEDQAQFPS  375

Query  225  LGSK  214
            LG K
Sbjct  376  LGGK  379



>ref|XP_004961407.1| PREDICTED: RNA-binding protein FUS-like [Setaria italica]
Length=374

 Score = 73.2 bits (178),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = -2

Query  691  EKQHGQEDAGDAK--KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  518
            EKQ   EDA  A+  KDS     E ++ EDKEMTL+E+EK+ EEKRKA+LA + EERKV 
Sbjct  209  EKQGALEDAPQAEENKDSKDANAEEEKEEDKEMTLEEFEKIREEKRKALLALKTEERKVE  268

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            +DK+ +SM  L+NKK +DE+FVKLGS
Sbjct  269  VDKDLQSMQPLSNKKENDEIFVKLGS  294


 Score = 33.1 bits (74),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE-TPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y   GRGRGRG   G  G  G    +    P+I+D  QFP+LG K
Sbjct  316  SINEFLKPAEGERFYGGRGRGRGRGDRGGFRGGYGGGYRAPPAAPAIQDQSQFPSLGGK  374



>gb|EAY75654.1| hypothetical protein OsI_03559 [Oryza sativa Indica Group]
Length=332

 Score = 72.0 bits (175),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  518
            EKQ  Q+DA   +KDS       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV 
Sbjct  165  EKQGEQDDAPTGEKDSKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVE  224

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            +DK+ +SM  L+ KK +DE+F+KLGS
Sbjct  225  VDKDLQSMQPLSTKKGNDEIFIKLGS  250


 Score = 34.3 bits (77),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   GRG  GG     + T  PSIED  QFPTLG K
Sbjct  270  SINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  329



>ref|XP_008459799.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=361

 Score = 69.7 bits (169),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE A  AEE     VN+       EK   + D   A  D P  EPE  EPEDKEMTL+E
Sbjct  182  TDEFAEVAEE----TVNETEKNVGDEKPIQENDTSGANTDDPAKEPEETEPEDKEMTLEE  237

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEKLLE+KRK++LA + EERKV   KEF SM  L++KK+++++F+KLGS
Sbjct  238  YEKLLEDKRKSLLALKTEERKVD-PKEFASMQQLSSKKDNNDIFIKLGS  285


 Score = 36.2 bits (82),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFL+PAEGE +Y PGGRGRGRG GS  G  G +  S+   PSIED GQFP LG+K
Sbjct  305  SINEFLRPAEGERHYTPGGRGRGRGRGSRGGYSGSS-MSNVAAPSIEDPGQFPILGAK  361



>ref|XP_009128949.1| PREDICTED: suppressor protein STM1-like [Brassica rapa]
Length=337

 Score = 79.0 bits (193),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 79/111 (71%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EE    V    V     EK+ G++D  DAKKD+P DE + KEPEDKEMTL+
Sbjct  148  PEDDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDAPADEGKEKEPEDKEMTLE  203

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FESM  L++KK N++E+F+KLGS
Sbjct  204  EYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNNEEIFIKLGS  253


 Score = 26.9 bits (58),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPA+GE
Sbjct  273  SINEFLKPADGE  284



>gb|ABD65038.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score = 78.2 bits (191),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EE    V    V     EK+ G++D  DAKKD P DE + KEPEDKEMTL+
Sbjct  154  PEDDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDPPADEGKEKEPEDKEMTLE  209

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FESM  L++KK N++E+F+KLGS
Sbjct  210  EYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNNEEIFIKLGS  259


 Score = 27.3 bits (59),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 33/58 (57%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-SFETPSIEDVGQFPTLGS  217
            SINEFLKPA+GE Y   GG  RGRG  +G  G      +     P+I D  QFP+LG 
Sbjct  279  SINEFLKPADGERYNPRGGGYRGRGGRNGGRGQRDEKVNEGAPAPAIGDSAQFPSLGK  336



>ref|NP_001043502.1| Os01g0603000 [Oryza sativa Japonica Group]
 dbj|BAD52651.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAD53119.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAF05416.1| Os01g0603000 [Oryza sativa Japonica Group]
 gb|EAZ12602.1| hypothetical protein OsJ_02509 [Oryza sativa Japonica Group]
Length=378

 Score = 73.9 bits (180),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS
Sbjct  242  MTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGS  295


 Score = 31.6 bits (70),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS---FETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YY PGGRGRGRG G G  G   +  SS      P IED  QFP L  
Sbjct  315  SINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQFPGLAG  374

Query  216  K  214
            +
Sbjct  375  R  375



>ref|XP_009416461.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=389

 Score = 71.2 bits (173),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+ EEKRKA+LA + EERKV +DKE +SM  L+ KK +D +FVKLGS
Sbjct  252  MTLEEYEKIREEKRKALLAMKAEERKVEIDKELQSMQQLSTKKENDPIFVKLGS  305


 Score = 33.9 bits (76),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 35/63 (56%), Gaps = 5/63 (8%)
 Frame = -3

Query  387  SINEFLKPAEG-----ETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEG           G     RG   G  G GG++ ++   PSIED GQFPTL
Sbjct  327  SINEFLKPAEGGRYYSPGGRGRGRGRGDRGPLRGSYGGGGSSFAAAAAPSIEDPGQFPTL  386

Query  222  GSK  214
            G K
Sbjct  387  GGK  389



>ref|XP_003567795.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brachypodium distachyon]
Length=381

 Score = 71.6 bits (174),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK  DEVF+KLGS
Sbjct  242  MTLEEYEKVLEEKRKALLALKAEERKVEVDKELQSMQQLSVKKVADEVFIKLGS  295


 Score = 33.5 bits (75),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 34/66 (52%), Gaps = 8/66 (12%)
 Frame = -3

Query  387  SINEFLKPAEGET--------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQF  232
            SINEFLKPAEGE              GRG  RG  +G G  GG        P+IED  QF
Sbjct  316  SINEFLKPAEGERYNPGGRGRGRGFRGRGELRGGYNGGGYNGGGGRRQAPAPAIEDQAQF  375

Query  231  PTLGSK  214
            PTLG K
Sbjct  376  PTLGGK  381



>gb|ABR26138.1| salt tolerance protein 2 [Oryza sativa Indica Group]
Length=175

 Score = 73.6 bits (179),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS
Sbjct  39   MTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGS  92


 Score = 31.6 bits (70),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS---FETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YY PGGRGRGRG G G  G   +  SS      P IED  QFP L  
Sbjct  112  SINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQFPGLAG  171

Query  216  K  214
            +
Sbjct  172  R  172



>gb|ABD64914.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score = 77.0 bits (188),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EEP   V    V     EK+ G++   DAKK++P      +EPEDKEMTL+
Sbjct  153  PEDDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLE  205

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS
Sbjct  206  EYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSNDEEIFIKLGS  255


 Score = 28.1 bits (61),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 31/62 (50%), Gaps = 5/62 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPA GET      YR  G    R      GG   N  +S   P+I D  QFP+L
Sbjct  275  SINEFLKPANGETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSL  334

Query  222  GS  217
             S
Sbjct  335  AS  336



>emb|CDY43435.1| BnaAnng07070D [Brassica napus]
Length=339

 Score = 76.6 bits (187),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EEP   V    V     EK+ G++   DAKK++P      +EPEDKEMTL+
Sbjct  152  PEDDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLE  204

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS
Sbjct  205  EYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTNDEEIFIKLGS  254


 Score = 28.1 bits (61),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 29/65 (45%), Gaps = 9/65 (14%)
 Frame = -3

Query  387  SINEFLKPAEGET---------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  235
            SINEFLKPA GET              G    R      GG   N  +S   P+I D  Q
Sbjct  274  SINEFLKPANGETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQ  333

Query  234  FPTLG  220
            FP+LG
Sbjct  334  FPSLG  338



>emb|CDY67886.1| BnaCnng56800D [Brassica napus]
Length=361

 Score = 76.6 bits (187),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EEP   V    V     EK+ G++   DAKK++P      +EPEDKEMTL+
Sbjct  178  PEDDIQPATEEPTTEVEKSPVA----EKEGGEDATTDAKKEAP---EVEQEPEDKEMTLE  230

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS
Sbjct  231  EYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSNDEEIFIKLGS  280


 Score = 28.1 bits (61),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 31/62 (50%), Gaps = 5/62 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPA GET      YR  G    R      GG   N  +S   P+I D  QFP+L
Sbjct  300  SINEFLKPANGETYNPRGGYRGRGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQFPSL  359

Query  222  GS  217
             S
Sbjct  360  AS  361



>gb|KFK31390.1| hypothetical protein AALP_AA6G105700 [Arabis alpina]
Length=353

 Score = 77.4 bits (189),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 73/108 (68%), Gaps = 9/108 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+I P  EEP+  V    V     EKQ G+++  DAKK++P +E E K+     MTL+EY
Sbjct  174  DDIPPATEEPMTEVEKSPVTA---EKQEGEDETTDAKKETPAEEEEEKQ-----MTLEEY  225

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EK+ EEK+KA+  ++ EERKV   K FESM  L+NKK+++E+F+KLGS
Sbjct  226  EKIQEEKKKAMQGAKVEERKVDT-KVFESMQQLSNKKSNEEIFIKLGS  272


 Score = 27.3 bits (59),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 13/13 (100%), Gaps = 0/13 (0%)
 Frame = -3

Query  387  SINEFLKPAEGET  349
            SINEFLKPA+GE+
Sbjct  290  SINEFLKPADGES  302



>ref|NP_001044098.1| Os01g0721900 [Oryza sativa Japonica Group]
 dbj|BAB84432.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 dbj|BAF06012.1| Os01g0721900 [Oryza sativa Japonica Group]
Length=380

 Score = 70.5 bits (171),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EKL EEKRKA+LA + EERKV +DK+ +SM  L+ KK +DE+F+KLGS
Sbjct  245  MTLEEFEKLREEKRKALLAFKAEERKVEVDKDLQSMQPLSTKKGNDEIFIKLGS  298


 Score = 34.3 bits (77),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   GRG  GG     + T  PSIED  QFPTLG K
Sbjct  318  SINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  377



>gb|EAZ13376.1| hypothetical protein OsJ_03294 [Oryza sativa Japonica Group]
Length=332

 Score = 70.5 bits (171),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVC  518
            EKQ  Q+DA   +KD+       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV 
Sbjct  165  EKQGEQDDAPTGEKDNKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVE  224

Query  517  LDKEFESMALLANKKNDDEVFVKLGS  440
            +DK+ +SM  L+ KK +DE+F+KLGS
Sbjct  225  VDKDLQSMQPLSTKKGNDEIFIKLGS  250


 Score = 34.3 bits (77),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   GRG  GG     + T  PSIED  QFPTLG K
Sbjct  270  SINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  329



>ref|XP_009114287.1| PREDICTED: uncharacterized protein LOC103839539 [Brassica rapa]
Length=343

 Score = 77.4 bits (189),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EEP   V    V     EK+ G++   DAKK++P      +EPEDKEMTL+
Sbjct  156  PEDDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEAP---EVEQEPEDKEMTLE  208

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND+E+F+KLGS
Sbjct  209  EYEKILEEKKKALQATKVEERKVDT-KAFESMQQLSNKKTNDEEIFIKLGS  258


 Score = 26.9 bits (58),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 29/65 (45%), Gaps = 9/65 (14%)
 Frame = -3

Query  387  SINEFLKPAEGET---------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQ  235
            SIN+FLKPA GET              G    R      GG   N  +S   P+I D  Q
Sbjct  278  SINQFLKPANGETYNPRGGYRGRGGRSGGRGQRDGKVNGGGNQRNGGASAPAPAIGDSAQ  337

Query  234  FPTLG  220
            FP+LG
Sbjct  338  FPSLG  342



>gb|AFW81314.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=365

 Score = 71.2 bits (173),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV +DKE ++M  L+ KK+ DEVF+KLGS
Sbjct  236  MTLEEYEKVLEEKRKALLSLKAEERKVEIDKELQAMQQLSVKKDGDEVFIKLGS  289


 Score = 33.1 bits (74),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE YY P GRGRGRG G  RGGY G        P+IED  QFP L
Sbjct  310  SINEFLKPAEGERYYNPSGRGRGRGRGGFRGGYNGGYRGPAAAPAIEDQAQFPAL  364



>ref|NP_001148572.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACG32086.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=364

 Score = 71.2 bits (173),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV +DKE ++M  L+ KK+ DEVF+KLGS
Sbjct  235  MTLEEYEKVLEEKRKALLSLKAEERKVEIDKELQAMQQLSVKKDGDEVFIKLGS  288


 Score = 33.1 bits (74),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE YY P GRGRGRG G  RGGY G        P+IED  QFP L
Sbjct  309  SINEFLKPAEGERYYNPSGRGRGRGRGGFRGGYNGGYRGPAAAPAIEDQAQFPAL  363



>ref|XP_007142624.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
 gb|ESW14618.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
Length=358

 Score = 67.0 bits (162),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 2/84 (2%)
 Frame = -2

Query  688  KQHGQED-AGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            K  G++D A D  K++P +E E KEPEDKEMTL+EYEK+LEE+RKA+ A + EERKV   
Sbjct  198  KPSGEDDVAADGNKENPANEAEEKEPEDKEMTLEEYEKVLEERRKALQALKTEERKVDT-  256

Query  511  KEFESMALLANKKNDDEVFVKLGS  440
            K FESM  L+NKK++ ++F+KLGS
Sbjct  257  KVFESMQQLSNKKDNFDIFIKLGS  280


 Score = 37.4 bits (85),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGET-yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKP EGE+ Y   G           RGG+GG  T++   PSIED GQFPTLG K
Sbjct  300  SINEFLKPPEGESFYSAGGRGRGRGRGRGARGGFGGYATANVTAPSIEDPGQFPTLGVK  358



>ref|XP_009410905.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=387

 Score = 70.1 bits (170),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEKL EEKRKA+LA + EERKV +D+E +SM  L+ KK +D+VFVKLGS
Sbjct  251  MTLEEYEKLREEKRKALLALKNEERKVEIDEELQSMKQLSVKKGNDDVFVKLGS  304


 Score = 34.3 bits (77),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 38/61 (62%), Gaps = 4/61 (7%)
 Frame = -3

Query  384  INEFLKPAEGETyyr--pggrgrgrghgsgrggygGNNTSSF--ETPSIEDVGQFPTLGS  217
            I EFLKPAEGE YY     GRGRGRG     GG  G   S+F    PSIED GQFPTLG 
Sbjct  327  ITEFLKPAEGERYYSPGGRGRGRGRGGRGQYGGGFGGGVSTFPAAAPSIEDPGQFPTLGG  386

Query  216  K  214
            K
Sbjct  387  K  387



>ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF50247.1| RNA binding protein, putative [Ricinus communis]
Length=295

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEIA   EE     VN+G      EK  G+ +A D KK+SP +EPE K+PEDKEMTL+E
Sbjct  187  TDEIAQVTEE----AVNEGEKNMGDEKPVGEGEAVDGKKESPTNEPEEKQPEDKEMTLEE  242

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  446
            YEK+LEEKRKA+ A++ EERKV   KEF SM  L++KK  D++F+KL
Sbjct  243  YEKVLEEKRKALQATKAEERKVDT-KEFASMQQLSSKKGGDDIFIKL  288



>ref|XP_008810382.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Phoenix dactylifera]
Length=373

 Score = 68.6 bits (166),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+ EEKRKA+LA + EERKV +D+E +SM  L+ KK +D+VF+KLGS
Sbjct  237  MTLEEYEKIREEKRKALLALKTEERKVEIDQELQSMQQLSLKKRNDDVFMKLGS  290


 Score = 35.4 bits (80),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 32/62 (52%), Gaps = 5/62 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE          G     RG   G  G G  + +    PSIED GQFPTL
Sbjct  312  SINEFLKPAEGERYYSPVGRGRGRARGDRGQFRGGFGGGRGSGAPATAPSIEDPGQFPTL  371

Query  222  GS  217
            G 
Sbjct  372  GK  373



>ref|XP_004969088.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Setaria italica]
Length=371

 Score = 68.9 bits (167),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L  + E RKV +DKE +SM  L+ KK  DE+F+KLGS
Sbjct  237  MTLEEYEKVLEEKRKALLGLKTEVRKVEVDKELQSMQQLSVKKGSDEIFIKLGS  290


 Score = 34.7 bits (78),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVGQFPTLG  220
            SINEFLKPAEGE YY PGGRGRGRG G G  G   +  S  E     P+I+D  QFP+LG
Sbjct  310  SINEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRSGYSPREPGALAPAIQDQAQFPSLG  369

Query  219  SK  214
             K
Sbjct  370  GK  371



>gb|EAY74854.1| hypothetical protein OsI_02745 [Oryza sativa Indica Group]
Length=380

 Score = 73.9 bits (180),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS
Sbjct  242  MTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGS  295


 Score = 29.6 bits (65),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 26/63 (41%), Gaps = 5/63 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE          G          G    G ++      P IED  QFP L
Sbjct  315  SINEFLKPAEGERYYSPGGRGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQFPGL  374

Query  222  GSK  214
              +
Sbjct  375  AGR  377



>ref|XP_004150996.1| PREDICTED: uncharacterized protein LOC101210473 [Cucumis sativus]
 ref|XP_004166647.1| PREDICTED: uncharacterized LOC101210473 [Cucumis sativus]
 gb|KGN46514.1| hypothetical protein Csa_6G105680 [Cucumis sativus]
Length=360

 Score = 61.6 bits (148),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEKLL+EKRK++LA + EERKV   KEF S+  L++KK + ++F+KLGS
Sbjct  230  MTLEEYEKLLDEKRKSLLALKTEERKVD-PKEFASLQQLSSKKENQDIFIKLGS  282


 Score = 42.0 bits (97),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS-FETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +Y PGGRGRGRG GS  GGY G++ SS    PSIED GQFPTLG+K
Sbjct  302  SINEFLKPAEGEKHYTPGGRGRGRGRGSRGGGYVGSSMSSNVAAPSIEDPGQFPTLGAK  360



>ref|XP_009396539.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=385

 Score = 69.3 bits (168),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+ EEKRKA+LA + EERKV +D+E +SM  L+ KK +D+VFVKLGS
Sbjct  250  MTLEEYEKVREEKRKALLAMKNEERKVEIDEELQSMKQLSVKKGNDDVFVKLGS  303


 Score = 33.9 bits (76),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 36/61 (59%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFET---PSIEDVGQFPTLGS  217
            SINEFLKP EGE      GRGRGRG     G   G   S+F     PSIED GQFPTLG 
Sbjct  325  SINEFLKPTEGERNRGGRGRGRGRGGRGQFGSGFGGEGSTFAAAAAPSIEDPGQFPTLGG  384

Query  216  K  214
            K
Sbjct  385  K  385



>ref|XP_008798813.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Phoenix dactylifera]
Length=373

 Score = 72.4 bits (176),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEKLLEEKRKA+ A  + EERKV +DKEFE M  L+ KKN+D+VF+KLGS
Sbjct  240  MTLDEYEKLLEEKRKALQALQKIEERKVDVDKEFEFMQQLSAKKNNDDVFIKLGS  294


 Score = 30.8 bits (68),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -3

Query  384  INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            IN FL+PAE E +Y PGGRGRGRG    RGG+G   T +   PSIED G FPTLG
Sbjct  317  INTFLRPAEEERHYNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHFPTLG  371



>ref|XP_008798814.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Phoenix dactylifera]
Length=372

 Score = 72.4 bits (176),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEKLLEEKRKA+ A  + EERKV +DKEFE M  L+ KKN+D+VF+KLGS
Sbjct  239  MTLDEYEKLLEEKRKALQALQKIEERKVDVDKEFEFMQQLSAKKNNDDVFIKLGS  293


 Score = 30.8 bits (68),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -3

Query  384  INEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            IN FL+PAE E +Y PGGRGRGRG    RGG+G   T +   PSIED G FPTLG
Sbjct  316  INTFLRPAEEERHYNPGGRGRGRGGRGARGGFGRTGTMNTPPPSIEDPGHFPTLG  370



>gb|ABR25759.1| nuclear antigen [Oryza sativa Indica Group]
Length=243

 Score = 73.9 bits (180),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS
Sbjct  130  MTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGS  183


 Score = 28.9 bits (63),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 12/12 (100%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPAEGE
Sbjct  203  SINEFLKPAEGE  214



>gb|EAY99238.1| hypothetical protein OsI_21200 [Oryza sativa Indica Group]
Length=383

 Score = 70.9 bits (172),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV +DKE ++M  L+ KK ++EVF+KLGS
Sbjct  247  MTLEEYEKVLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKANEEVFIKLGS  300


 Score = 32.0 bits (71),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 32/63 (51%), Gaps = 5/63 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE        R  GRGRG   G   G  G         P IED  QFP+L
Sbjct  321  SINEFLKPAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAAAPVIEDQAQFPSL  380

Query  222  GSK  214
            G K
Sbjct  381  GGK  383



>ref|XP_002440366.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
 gb|EES18796.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
Length=378

 Score = 73.2 bits (178),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK+ DEVF+KLGS
Sbjct  244  MTLEEYEKVLEEKRKALLALKAEERKVEIDKELQSMQQLSVKKDADEVFIKLGS  297


 Score = 29.3 bits (64),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 30/60 (50%), Gaps = 5/60 (8%)
 Frame = -3

Query  387  SINEFLKPAEGE-----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE     +    G        G  RGGY G+       P+IED  QFP L
Sbjct  318  SINEFLKPAEGERYYNPSSRGRGRGRGRGERGGFRGGYNGSYRGPAAAPAIEDQAQFPAL  377



>ref|NP_001056483.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|AAT38003.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 gb|AAT58811.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18397.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|EEE64880.1| hypothetical protein OsJ_19739 [Oryza sativa Japonica Group]
Length=383

 Score = 70.5 bits (171),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV +DKE ++M  L+ KK ++EVF+KLGS
Sbjct  247  MTLEEYEKVLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKANEEVFIKLGS  300


 Score = 32.0 bits (71),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 32/63 (51%), Gaps = 5/63 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE        R  GRGRG   G   G  G         P IED  QFP+L
Sbjct  321  SINEFLKPAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAAAPVIEDQAQFPSL  380

Query  222  GSK  214
            G K
Sbjct  381  GGK  383



>emb|CDY33522.1| BnaA06g35510D [Brassica napus]
Length=327

 Score = 75.5 bits (184),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = -2

Query  676  QEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  497
            ++D  DAKKDSP  E E KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FES
Sbjct  167  EDDTTDAKKDSPAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFES  225

Query  496  MALLANKK-NDDEVFVKLGS  440
            M  L+NKK ND+E+F+KLGS
Sbjct  226  MQQLSNKKTNDEEIFIKLGS  245


 Score = 27.3 bits (59),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 31/62 (50%), Gaps = 6/62 (10%)
 Frame = -3

Query  387  SINEFLKPAEGET------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  226
            SINEFLKPA+GE        YR  G   GR  G G+   G         P+I D  QFP+
Sbjct  265  SINEFLKPADGERYNNPRGGYRGRGGRGGRRDGRGQRDGGNQRHGGAPAPAIGDSAQFPS  324

Query  225  LG  220
            LG
Sbjct  325  LG  326



>ref|XP_004961035.1| PREDICTED: insulin receptor substrate 4-like [Setaria italica]
Length=373

 Score = 73.2 bits (178),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK+ DEVF+KLGS
Sbjct  238  MTLEEYEKVLEEKRKALLALKAEERKVEIDKELQSMQQLSIKKDADEVFIKLGS  291


 Score = 29.3 bits (64),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 31/61 (51%), Gaps = 6/61 (10%)
 Frame = -3

Query  387  SINEFLKPAEGET------yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPT  226
            SINEFLKPAEGE         R   RGRG   G   G  GG    +   P+IED  QFP 
Sbjct  312  SINEFLKPAEGERYYNPSGRGRGRSRGRGERGGFYGGYNGGYRGPAAAAPAIEDQAQFPA  371

Query  225  L  223
            L
Sbjct  372  L  372



>ref|XP_002870099.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46358.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score = 77.0 bits (188),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 6/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  EE  + VV+  +     EKQ G+ +A DA K++P +    ++PEDKEMTL+EY
Sbjct  168  DDIAPVTEE-TSAVVDKNL---TVEKQGGEGEATDANKETPAEVQAEEKPEDKEMTLEEY  223

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  224  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGT  271


 Score = 25.4 bits (54),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPA+G+
Sbjct  289  SINEFLKPADGK  300



>gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
 gb|EYU19468.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
Length=361

 Score = 68.2 bits (165),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDS-PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCL  515
            EK+ G+++  DA KDS P ++ E +  E+KEMTL+EYEK+LEEKRK +L+ + E RKV +
Sbjct  198  EKKSGEDETDDANKDSSPKEKEEKEAEEEKEMTLEEYEKVLEEKRKTLLSMKSEARKVNV  257

Query  514  DKEFESMALLANKKND-DEVFVKLGS  440
            DKE ESM LL+NKK D D+VF+KLGS
Sbjct  258  DKELESMQLLSNKKIDHDDVFIKLGS  283


 Score = 33.5 bits (75),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGET--yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKP EGE        GRGRGRG     GG GG    S   P+IEDV QFP+LG K
Sbjct  300  SINEFLKPVEGEKYSRGGGRGRGRGRGREGFGGGGGGGFGRSERAPAIEDVDQFPSLGGK  359



>ref|XP_006280739.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
 gb|EOA13637.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
Length=346

 Score = 69.7 bits (169),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  EE    V      + A EKQ G ED  DA K++   E   KE EDKEMTL+EY
Sbjct  170  DDIAPATEEATTEVEK----SPAAEKQGG-EDETDASKEAAAAEQAQKEAEDKEMTLEEY  224

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN ++E+FVKLGS
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTEEEIFVKLGS  272


 Score = 32.0 bits (71),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 1/57 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLG  220
            SINEFLKPA+GETY   GG     G G      GGN +      P I D  QFP+LG
Sbjct  289  SINEFLKPAKGETYNPRGGNRGRGGRGGREQRGGGNQSHREAAAPVIGDTAQFPSLG  345



>gb|KHN27127.1| hypothetical protein glysoja_032895 [Glycine soja]
Length=319

 Score = 67.8 bits (164),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 72/113 (64%), Gaps = 18/113 (16%)
 Frame = -2

Query  727  GVVNDGVNTDAF----------------EKQHGQED-AGDAKKDSPLdepevkepedkEM  599
            G  N GV TD F                EK  G++D A    K++P +E E KEPEDKEM
Sbjct  130  GRGNWGVQTDEFAQATDEVNETSKNFGDEKPSGEDDVAAIGNKENPANEAEEKEPEDKEM  189

Query  598  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            TL+EYEK+LEE+RKA+ A + EERKV   K FESM  L+NKK+ D++F+KLGS
Sbjct  190  TLEEYEKVLEERRKALQALKTEERKVDT-KVFESMQQLSNKKDIDDIFIKLGS  241


 Score = 33.9 bits (76),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyr-pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +INEFLK  EGE+YY   G   R       RGGYGG  T++   PSIED GQFPTLG K
Sbjct  261  NINEFLKSPEGESYYNPGGHGRRHGRGRGARGGYGGYATANIPAPSIEDPGQFPTLGVK  319



>ref|XP_003556572.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Glycine max]
Length=332

 Score = 68.2 bits (165),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 72/113 (64%), Gaps = 18/113 (16%)
 Frame = -2

Query  727  GVVNDGVNTDAF----------------EKQHGQED-AGDAKKDSPLdepevkepedkEM  599
            G  N GV TD F                EK  G++D A    K++P +E E KEPEDKEM
Sbjct  143  GRGNWGVQTDEFAQATDEVNETSKNFGDEKPSGEDDVAAIGNKENPANEAEEKEPEDKEM  202

Query  598  TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            TL+EYEK+LEE+RKA+ A + EERKV   K FESM  L+NKK+ D++F+KLGS
Sbjct  203  TLEEYEKVLEERRKALQALKTEERKVDT-KVFESMQQLSNKKDIDDIFIKLGS  254


 Score = 33.5 bits (75),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyr-pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +INEFLK  EGE+YY   G   R       RGGYGG  T++   PSIED GQFPTLG K
Sbjct  274  NINEFLKSPEGESYYNPGGHGRRHGRGRGARGGYGGYATANIPAPSIEDPGQFPTLGVK  332



>gb|KHN11561.1| hypothetical protein glysoja_006014 [Glycine soja]
Length=170

 Score = 63.5 bits (153),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ ++F+KLGS
Sbjct  41   MTLEEYEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNHDIFIKLGS  93


 Score = 37.7 bits (86),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SI EFLKPAEGE YY PG          G GGY G+ T++   PSIED G FPTL +K
Sbjct  113  SITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGYHGSATNNAPAPSIEDPGHFPTLSAK  170



>gb|KHN00198.1| hypothetical protein glysoja_034729 [Glycine soja]
Length=128

 Score = 67.0 bits (162),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+ A + E RKV + KEF SM  L+NKK +DE+F+KLGS
Sbjct  1    MTLEEYEKVLEEKRKALQAQKTEARKVDI-KEFASMQPLSNKKENDEIFIKLGS  53


 Score = 34.3 bits (77),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 30/58 (52%), Gaps = 2/58 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +I EFLKPAEGE YY  G          G      N  S+   PSIED G FP+LG K
Sbjct  73   NITEFLKPAEGERYYPGGRGRGRGRGSRGGYSG--NAYSNAPAPSIEDPGHFPSLGGK  128



>ref|XP_004140509.1| PREDICTED: uncharacterized protein LOC101209927 [Cucumis sativus]
 ref|XP_004166646.1| PREDICTED: uncharacterized LOC101209927 [Cucumis sativus]
 gb|KGN46515.1| hypothetical protein Csa_6G106180 [Cucumis sativus]
Length=361

 Score = 65.9 bits (159),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 72/109 (66%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDE A  A E     VN+       EK   ++D      ++P  EP+  EPEDKEMTL+E
Sbjct  182  TDEFAEVAGE----TVNETEKNVGDEKPIQEDDTSGVNTENPAKEPQETEPEDKEMTLEE  237

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEKLLE+KRKA+LA + EERKV   KEF SM  L++KK+++++F+KLGS
Sbjct  238  YEKLLEDKRKALLALKTEERKVD-PKEFASMQQLSSKKDNNDIFIKLGS  285


 Score = 35.0 bits (79),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFL+PA+GE +Y PGGRGRGRG GS  G  G    S+   PSI D GQFPTLG+K
Sbjct  305  SINEFLRPADGERHYAPGGRGRGRGRGSRGGYSGSP-MSNVAAPSIGDPGQFPTLGAK  361



>emb|CDY28966.1| BnaA02g25100D [Brassica napus]
Length=340

 Score = 73.6 bits (179),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EK+ G+++  DAKKD+P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   
Sbjct  173  EKEGGEDNTTDAKKDAPADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-  231

Query  511  KEFESMALLANKK-NDDEVFVKLGS  440
            K FESM  L++KK N++E+F+KLGS
Sbjct  232  KVFESMQQLSSKKTNNEEIFIKLGS  256


 Score = 26.9 bits (58),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPA+GE
Sbjct  276  SINEFLKPADGE  287



>gb|ACL54182.1| unknown [Zea mays]
 gb|ACN34418.1| unknown [Zea mays]
Length=204

 Score = 70.1 bits (170),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+ EEKRKA+LA + EERKV +DK+ +S+  L+NKK +DEVF+KLGS
Sbjct  71   MTLEEFEKIREEKRKALLALKAEERKVEVDKDLQSLQPLSNKKENDEVFIKLGS  124


 Score = 30.0 bits (66),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS---SFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YY   GRGRGRG   G  G  G   S   +   PSIED  QFP+LG 
Sbjct  144  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQFPSLGG  203

Query  216  K  214
            K
Sbjct  204  K  204



>ref|NP_001281195.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACF84633.1| unknown [Zea mays]
 gb|ACR38621.1| unknown [Zea mays]
 tpg|DAA57852.1| TPA: hypothetical protein ZEAMMB73_322547 [Zea mays]
Length=378

 Score = 70.5 bits (171),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+ EEKRKA+LA + EERKV +DK+ +S+  L+NKK +DEVF+KLGS
Sbjct  245  MTLEEFEKIREEKRKALLALKAEERKVEVDKDLQSLQPLSNKKENDEVFIKLGS  298


 Score = 29.6 bits (65),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS---SFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YY   GRGRGRG   G  G  G   S   +   PSIED  QFP+LG 
Sbjct  318  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQFPSLGG  377

Query  216  K  214
            K
Sbjct  378  K  378



>gb|AAM64962.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=360

 Score = 72.4 bits (176),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 76/111 (68%), Gaps = 7/111 (6%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLD  590
            P D+I P  EE    VV+  +     EKQ G+ +A DAK ++P ++ E K  + + MTL+
Sbjct  165  PQDDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPAEKAEEKPEDKE-MTLE  219

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  220  EYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGT  269


 Score = 27.7 bits (60),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 29/73 (40%), Gaps = 17/73 (23%)
 Frame = -3

Query  387  SINEFLKPAEGET-----------------yyrpggrgrgrghgsgrggygGNNTSSFET  259
            SINEFLKPA+G++                        G       GR    G   +   T
Sbjct  287  SINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGAAAQAPT  346

Query  258  PSIEDVGQFPTLG  220
            P+I D  QFPTLG
Sbjct  347  PAIGDSAQFPTLG  359



>ref|XP_010434652.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=389

 Score = 74.3 bits (181),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 77/109 (71%), Gaps = 6/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  +E    V  +       EKQ G+ +A DA K++P +E   KEPE+KEMTL+EY
Sbjct  175  DDIAPVTDESTAAVEKNVT----VEKQGGEGEATDANKETPAEEQPEKEPENKEMTLEEY  230

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  231  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGT  278


 Score = 25.8 bits (55),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPA GE
Sbjct  296  SINEFLKPANGE  307



>ref|NP_199532.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
 dbj|BAA97154.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM98181.1| putative protein [Arabidopsis thaliana]
 gb|AAQ56814.1| At5g47210 [Arabidopsis thaliana]
 dbj|BAE98584.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95484.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
Length=357

 Score = 71.6 bits (174),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 9/112 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD---SPLdepevkepedkEMTL  593
            D+I P +EEP   V    V     EKQ G+++  +AKK+       + E +E E +EMTL
Sbjct  178  DDIPPTSEEPTTEVEKSPV----AEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTL  233

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGS  440
            +EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS
Sbjct  234  EEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS  284


 Score = 28.1 bits (61),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 33/57 (58%), Gaps = 1/57 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-TSSFETPSIEDVGQFPTLG  220
            SINEFLKPA+G+ Y   GG  RGRG   GRG  G          P+I D  QFP+LG
Sbjct  301  SINEFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTAQFPSLG  357



>ref|XP_010449600.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 [Camelina 
sativa]
Length=387

 Score = 74.3 bits (181),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 77/109 (71%), Gaps = 6/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  +E     V   V  D   KQ G+ +A DA K++P +E   KEPE+KEMTL+EY
Sbjct  172  DDIAPVTDEST-AAVEKNVTVD---KQGGEGEATDANKETPAEEQPEKEPENKEMTLEEY  227

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  228  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGT  275


 Score = 25.8 bits (55),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPA GE
Sbjct  293  SINEFLKPANGE  304



>ref|XP_010449709.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=352

 Score = 64.3 bits (155),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS
Sbjct  221  MTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGS  273


 Score = 35.4 bits (80),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT----SSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE YYR G  GRGRG      G   N       +   P+IED  QFP+LG
Sbjct  291  SINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAIEDTAQFPSLG  350

Query  219  SK  214
             K
Sbjct  351  GK  352



>ref|XP_010449710.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=263

 Score = 63.5 bits (153),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS
Sbjct  132  MTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGS  184


 Score = 35.8 bits (81),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT----SSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE YYR G  GRGRG      G   N       +   P+IED  QFP+LG
Sbjct  202  SINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSNEEHVGYRNEAAPAIEDTAQFPSLG  261

Query  219  SK  214
             K
Sbjct  262  GK  263



>ref|XP_008675099.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Zea mays]
 gb|ACG33523.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 tpg|DAA57847.1| TPA: plasminogen activator inhibitor 1 RNA-binding protein [Zea 
mays]
Length=378

 Score = 69.7 bits (169),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+ EEKRKA+LA + EERKV +DK+  S+  L+NKK +DEVF+KLGS
Sbjct  245  MTLEEFEKIREEKRKALLALKAEERKVEVDKDLRSLQPLSNKKENDEVFIKLGS  298


 Score = 29.6 bits (65),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS---SFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YY   GRGRGRG   G  G  G   S   +   PSIED  QFP+LG 
Sbjct  318  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYSRGPAAAAPSIEDQAQFPSLGG  377

Query  216  K  214
            K
Sbjct  378  K  378



>gb|AAM63072.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=357

 Score = 70.9 bits (172),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 9/112 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD---SPLdepevkepedkEMTL  593
            D+I P +EEP   V    V     EKQ G+++  +AKK+       + E +E E +EMTL
Sbjct  178  DDIPPTSEEPTTEVEKSPV----AEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTL  233

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGS  440
            +EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS
Sbjct  234  EEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS  284


 Score = 28.1 bits (61),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 33/57 (58%), Gaps = 1/57 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-TSSFETPSIEDVGQFPTLG  220
            SINEFLKPA+G+ Y   GG  RGRG   GRG  G          P+I D  QFP+LG
Sbjct  301  SINEFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTAQFPSLG  357



>ref|XP_003568032.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1 
[Brachypodium distachyon]
Length=376

 Score = 71.6 bits (174),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+LEEKRKA+LA + EERKV +DK+ ++M  L+ KK +DEVF+KLGS
Sbjct  241  MTLEEFEKVLEEKRKALLALKSEERKVEIDKDLQAMQQLSTKKGNDEVFIKLGS  294


 Score = 27.7 bits (60),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGS  217
            SINEFLKPAEGE +Y   GRGRGRG   G    G            P+I+D  QFPTLG 
Sbjct  316  SINEFLKPAEGERFYGGRGRGRGRGGDRGGFRGGAGGGGYRGPPAAPAIQDQNQFPTLGG  375

Query  216  K  214
            K
Sbjct  376  K  376



>gb|EEE64473.1| hypothetical protein OsJ_19323 [Oryza sativa Japonica Group]
Length=392

 Score = 71.6 bits (174),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS
Sbjct  258  MTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGS  311


 Score = 27.3 bits (59),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  333  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  392



>emb|CDX76586.1| BnaA08g08140D [Brassica napus]
Length=342

 Score = 66.6 bits (161),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 66/92 (72%), Gaps = 5/92 (5%)
 Frame = -2

Query  712  GVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPE  533
            GV T   EK  G E A DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    
Sbjct  174  GVET---EKPAGDEVAADAKKENTAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTS  230

Query  532  ERKVCLDKEFESMALLAN-KKNDDEVFVKLGS  440
            ERKV   K FESM  L+N KK++DE+F+KLGS
Sbjct  231  ERKVDT-KVFESMQQLSNKKKSNDEIFIKLGS  261


 Score = 32.7 bits (73),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 39/64 (61%), Gaps = 6/64 (9%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPT  226
            SINEFLKPAEGE YYR GGRG GRG G G    G  +   F+       P+I D  QFP+
Sbjct  279  SINEFLKPAEGENYYRGGGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPS  338

Query  225  LGSK  214
            LG K
Sbjct  339  LGGK  342



>ref|XP_002870130.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46389.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 64.7 bits (156),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS
Sbjct  228  MTLDEYEKILEEKKKALQSLATSERKVDT-KVFESMQQLSNKKSNDEIFIKLGS  280


 Score = 33.9 bits (76),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YYR GGRG     G GRGG     +  +     P+I D  QFP+LG 
Sbjct  298  SINEFLKPAEGENYYRGGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGG  357

Query  216  K  214
            K
Sbjct  358  K  358



>ref|XP_002440127.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
 gb|EES18557.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
Length=373

 Score = 71.2 bits (173),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+ EEKRK++LA + EERKV +D++ +SM  LANKK +DE+FVKLGS
Sbjct  240  MTLEEFEKIREEKRKSLLALKTEERKVEVDRDLQSMQPLANKKGNDEIFVKLGS  293


 Score = 27.3 bits (59),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT-SSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY   GRGRGRG   G  G  G    +    P+I+D  QFP+LG K
Sbjct  315  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGGGYHAPPAAPAIQDQSQFPSLGGK  373



>gb|EEC79581.1| hypothetical protein OsI_20751 [Oryza sativa Indica Group]
Length=381

 Score = 71.2 bits (173),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS
Sbjct  247  MTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGS  300


 Score = 27.3 bits (59),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  322  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  381



>ref|XP_010481348.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=349

 Score = 73.6 bits (179),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKEMTL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  ++E+FVKLGS
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGS  272


 Score = 25.0 bits (53),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 4/60 (7%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVGQFPTLG  220
            SINEFLKPA+G      GGRG   G G      G N   +       P+I D  QFP+LG
Sbjct  289  SINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|NP_001056139.1| Os05g0533100 [Oryza sativa Japonica Group]
 dbj|BAF18053.1| Os05g0533100, partial [Oryza sativa Japonica Group]
Length=286

 Score = 70.9 bits (172),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS
Sbjct  152  MTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGS  205


 Score = 27.7 bits (60),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  227  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  286



>ref|XP_010441486.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score = 73.2 bits (178),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKEMTL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  ++E+FVKLGS
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGS  272


 Score = 25.0 bits (53),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 4/60 (7%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVGQFPTLG  220
            SINEFLKPA+G      GGRG   G G      G N   +       P+I D  QFP+LG
Sbjct  289  SINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLG  348



>gb|KFK22256.1| hypothetical protein AALP_AAs66747U001100 [Arabis alpina]
Length=374

 Score = 65.5 bits (158),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS
Sbjct  241  MTLDEYEKILEEKKKALQSETVSERKVDT-KVFESMQQLSNKKSNDEIFIKLGS  293


 Score = 33.1 bits (74),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 34/64 (53%), Gaps = 6/64 (9%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPT  226
            SINEFLKPAEGE Y+R GGRG     G G  G        F        P+I D  QFP+
Sbjct  311  SINEFLKPAEGENYHRGGGRGGRGRGGRGGRGGNSTGGGGFAGYRNEPAPAIADTAQFPS  370

Query  225  LGSK  214
            LG K
Sbjct  371  LGGK  374



>gb|AAT47083.1| unknown protein [Oryza sativa Japonica Group]
Length=390

 Score = 70.9 bits (172),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS
Sbjct  256  MTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGS  309


 Score = 27.3 bits (59),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  331  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  390



>ref|XP_010481347.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=349

 Score = 73.6 bits (179),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKEMTL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  ++E+FVKLGS
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTEEEIFVKLGS  272


 Score = 24.6 bits (52),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 30/61 (49%), Gaps = 4/61 (7%)
 Frame = -3

Query  387  SINEFLKPAE----GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPA+    G    R G  GRG     G G  G N       P+I D  QFP+LG
Sbjct  289  SINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGGNGGENQRRGPSAPAIGDTAQFPSLG  348

Query  219  S  217
             
Sbjct  349  K  349



>dbj|BAG90611.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score = 70.9 bits (172),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS
Sbjct  87   MTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGS  140


 Score = 27.3 bits (59),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPA--EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA  E     R  GRGRG   G   G   G+ +++   P I+D  QFPTLG K
Sbjct  162  SINEFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  221



>ref|XP_011101848.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=369

 Score = 53.1 bits (126),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 7/110 (6%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA-GDAKKDSPLdepevkepedkEMTLD  590
            TDE+A   EE    VVN+G  +   EK  G ED   D  K++       ++PEDKEMTL+
Sbjct  189  TDELAEVTEE----VVNEGEKSLNVEKPSGDEDPPADGDKEA-ATTEVEEKPEDKEMTLE  243

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEKLLEEKRKA+ A + EERKV + KEFE+M  LANKK +D+VF+KLGS
Sbjct  244  EYEKLLEEKRKALQALKTEERKVDV-KEFETMQQLANKKANDDVFIKLGS  292


 Score = 44.7 bits (104),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY  GGRGRGRG GS  G  GG+   + E P+IED GQFPTLG K
Sbjct  312  SINEFLKPAEGEAYYNRGGRGRGRGRGSRGGYTGGSKMGNAEAPAIEDPGQFPTLGGK  369



>gb|ACG24258.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=360

 Score = 70.1 bits (170),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+I P  EE    VV+  +     EKQ G+ +A DAK ++P ++ E K  + + MTL+EY
Sbjct  167  DDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPAEKAEEKPEDKE-MTLEEY  221

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  222  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGT  269


 Score = 27.7 bits (60),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 29/73 (40%), Gaps = 17/73 (23%)
 Frame = -3

Query  387  SINEFLKPAEGET-----------------yyrpggrgrgrghgsgrggygGNNTSSFET  259
            SINEFLKPA+G++                        G       GR    G   +   T
Sbjct  287  SINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNQREGGRNQRDGGAAAQAPT  346

Query  258  PSIEDVGQFPTLG  220
            P+I D  QFPTLG
Sbjct  347  PAIGDSAQFPTLG  359



>gb|EMT08444.1| hypothetical protein F775_29168 [Aegilops tauschii]
Length=833

 Score = 69.7 bits (169),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 62/91 (68%), Gaps = 5/91 (5%)
 Frame = -2

Query  697  AFEKQHGQEDAGDAKKDSPLdepev----kepedkEMTLDEYEKLLEEKRKAILA-SRPE  533
            A EKQ   EDA  A ++    +       ++ ED EMTLDE+EK++EEKRKA+ A  + E
Sbjct  224  APEKQGAPEDAPQADENKATKDGAAVVEEEKEEDNEMTLDEFEKVMEEKRKALAALKKSE  283

Query  532  ERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            ERKV +DK+ ++M LL+ KK +DEVF+KLG+
Sbjct  284  ERKVEIDKDLQAMQLLSTKKGNDEVFIKLGA  314


 Score = 28.1 bits (61),  Expect(2) = 8e-12, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 31/61 (51%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE +Y   GRG       G    G            P+I+D  QFPTLG 
Sbjct  336  SINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGG  395

Query  216  K  214
            K
Sbjct  396  K  396



>ref|NP_193485.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
 emb|CAB10532.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78755.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL09735.1| AT4g17520/dl4795w [Arabidopsis thaliana]
 gb|AAL91151.1| unknown protein [Arabidopsis thaliana]
 gb|AAN65040.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83906.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
Length=360

 Score = 70.1 bits (170),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 7/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+I P  EE    VV+  +     EKQ G+ +A DAK ++P ++ E K  + + MTL+EY
Sbjct  167  DDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPAEKAEEKPEDKE-MTLEEY  221

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  222  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGT  269


 Score = 27.7 bits (60),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 35/73 (48%), Gaps = 17/73 (23%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-----------------TSSFET  259
            SINEFLKPA+G++YYRP G  +G   G G       +                  +   T
Sbjct  287  SINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQRDGGRNLREGGRNQRDGGAAAQAPT  346

Query  258  PSIEDVGQFPTLG  220
            P+I D  QFPTLG
Sbjct  347  PAIGDSAQFPTLG  359



>ref|XP_002863351.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39610.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score = 68.9 bits (167),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 9/112 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD---SPLdepevkepedkEMTL  593
            D+I P  EEP   V    V     EKQ G+++  +A K+       + E +E E +EMTL
Sbjct  177  DDIPPVTEEPTTEVEKSPV----AEKQGGEDETAEANKEPTAEEKAQKEAEEAEAREMTL  232

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGS  440
            +EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS
Sbjct  233  EEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS  283


 Score = 28.9 bits (63),  Expect(2) = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 32/63 (51%), Gaps = 7/63 (11%)
 Frame = -3

Query  387  SINEFLKPAEGE-------TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFP  229
            SINEFLKPA+GE          R G  GRG     G GG   N   +   P+I D  QFP
Sbjct  300  SINEFLKPADGERYNGRGGHRGRGGCGGRGGREHRGDGGNQRNVKPAAPAPAIGDTAQFP  359

Query  228  TLG  220
            +LG
Sbjct  360  SLG  362



>dbj|BAJ98247.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS
Sbjct  38   MTLEEYEKVLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGS  91



>ref|XP_009108277.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Brassica rapa]
Length=273

 Score = 64.7 bits (156),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -2

Query  694  FEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCL  515
             EK  G E   DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERKV  
Sbjct  108  IEKPAGDEVVADAKKENAAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT  167

Query  514  DKEFESMALLAN-KKNDDEVFVKLGS  440
             K FESM  L+N KK++DE+F+KLGS
Sbjct  168  -KVFESMQQLSNKKKSNDEIFIKLGS  192


 Score = 33.1 bits (74),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 39/64 (61%), Gaps = 6/64 (9%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPT  226
            SINEFLKPAEGE YYR GGRG GRG G G    G  +   F+       P+I D  QFP+
Sbjct  210  SINEFLKPAEGENYYRGGGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPS  269

Query  225  LGSK  214
            LG K
Sbjct  270  LGGK  273



>ref|XP_001760974.1| predicted protein [Physcomitrella patens]
 gb|EDQ74363.1| predicted protein [Physcomitrella patens]
Length=343

 Score = 68.6 bits (166),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLG  443
            MTL+EYEK++EEKRK + AS+  ERKV +DK FE M L++NKK ++++F+KLG
Sbjct  190  MTLEEYEKVMEEKRKTLEASKASERKVEVDKAFEKMQLVSNKKREEDIFIKLG  242


 Score = 28.9 bits (63),  Expect(2) = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 35/80 (44%), Gaps = 22/80 (28%)
 Frame = -3

Query  387  SINEFLKPAEGETy------yrpggrgrgrghgsgrggygGNNTSSFE------------  262
            SIN+FLKPAEGE         R G  GR     SG  G   +  S+F             
Sbjct  264  SINQFLKPAEGEKSYFPSNRGRGGRGGRDDRRESGGRGNRESTRSNFSAGRGGGGRGSAA  323

Query  261  ----TPSIEDVGQFPTLGSK  214
                 P IED  QFPTLG+K
Sbjct  324  GDASAPKIEDQAQFPTLGAK  343



>gb|EMS56112.1| hypothetical protein TRIUR3_18406 [Triticum urartu]
Length=199

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS
Sbjct  108  MTLEEYEKVLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGS  161



>ref|XP_004969787.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
A-like [Setaria italica]
Length=375

 Score = 69.3 bits (168),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+ EEKRKA+LA + EER+V +DK+ +S+  L+NKK +DEVF+KLGS
Sbjct  244  MTLEEFEKIREEKRKALLALKAEERRVEVDKDLQSLQPLSNKKENDEVFIKLGS  297


 Score = 27.7 bits (60),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 29/59 (49%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPA-EGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPA     Y   G        G   G +GG +      P+IED  QFP+LG K
Sbjct  317  SINEFLKPAEGERYYGGRGRGRGRGERGGRGGYFGGYHRGPAAAPAIEDQAQFPSLGGK  375



>emb|CDY65881.1| BnaAnng21260D [Brassica napus]
Length=333

 Score = 64.7 bits (156),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 62/80 (78%), Gaps = 4/80 (5%)
 Frame = -2

Query  670  DAGDAKKDSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  497
            +A DA K++P++    KEPE ++  MTL+EYEK+LEEKRKA+ A++ EERKV   K FE+
Sbjct  179  EATDANKETPVEAQAEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERKVDT-KAFET  237

Query  496  MALLANKK-NDDEVFVKLGS  440
            M  L++KK N+DEVF+KLG+
Sbjct  238  MQQLSSKKSNNDEVFIKLGT  257


 Score = 32.7 bits (73),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETy--yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFLKPA GE Y     GGRGRG   G      G +  ++   P IED   FPTLG 
Sbjct  275  SINEFLKPANGERYRGADEGGRGRGAEGGGRGPKGGADRKAAAPAPKIEDAAHFPTLGK  333



>gb|EYU40365.1| hypothetical protein MIMGU_mgv1a008102mg [Erythranthe guttata]
Length=385

 Score = 58.5 bits (140),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 47/57 (82%), Gaps = 4/57 (7%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASR--PEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            MTL+EYEK+LEEKRK++LA +   E RKV + KEFESM  L++KK ++D++F+KLGS
Sbjct  251  MTLEEYEKVLEEKRKSLLALKADSEARKVDV-KEFESMQQLSSKKRSNDDIFIKLGS  306


 Score = 38.5 bits (88),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 33/59 (56%), Gaps = 1/59 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETy-yrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE +    G          G GGYG     +   P+IED GQFPTLG K
Sbjct  326  SINEFLKPAEGERHYSSGGRGRGRGRGSRGGGGYGVGGNENVRAPAIEDPGQFPTLGGK  384



>ref|XP_006414296.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
 gb|ESQ55749.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
Length=359

 Score = 67.8 bits (164),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 64/87 (74%), Gaps = 1/87 (1%)
 Frame = -2

Query  700  DAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKV  521
            +A EK  G + A DA K++  +  E KEPE+KEMTLDEYEK+LEEK+KA+ +    ERKV
Sbjct  194  NAVEKPAGDDVAADANKENTAEAEEEKEPENKEMTLDEYEKILEEKKKALQSQTTSERKV  253

Query  520  CLDKEFESMALLANKKNDDEVFVKLGS  440
               K FESM  L+NKK++DE+F+KLGS
Sbjct  254  DT-KVFESMQQLSNKKSNDEIFIKLGS  279


 Score = 29.6 bits (65),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 27/63 (43%), Gaps = 5/63 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE            RG       G    G     S   P I D  QFP+L
Sbjct  297  SINEFLKPAEGENYYRGGGRGGRERGGRGRGRGGASSGGFGGHRSEAAPVIGDTAQFPSL  356

Query  222  GSK  214
            G K
Sbjct  357  GGK  359



>ref|XP_009108276.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Brassica rapa]
Length=342

 Score = 64.3 bits (155),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 2/86 (2%)
 Frame = -2

Query  694  FEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCL  515
             EK  G E   DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERKV  
Sbjct  177  IEKPAGDEVVADAKKENAAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT  236

Query  514  DKEFESMALLAN-KKNDDEVFVKLGS  440
             K FESM  L+N KK++DE+F+KLGS
Sbjct  237  -KVFESMQQLSNKKKSNDEIFIKLGS  261


 Score = 32.7 bits (73),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 39/64 (61%), Gaps = 6/64 (9%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPT  226
            SINEFLKPAEGE YYR GGRG GRG G G    G  +   F+       P+I D  QFP+
Sbjct  279  SINEFLKPAEGENYYRGGGRGGGRGRGRGGRDRGVVSGGGFDGYRSEAAPAIGDTAQFPS  338

Query  225  LGSK  214
            LG K
Sbjct  339  LGGK  342



>ref|XP_010494951.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score = 71.6 bits (174),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 75/109 (69%), Gaps = 8/109 (7%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  EEP   V    V     EKQ G+++  DA K++  +E   KE EDKEMTL+EY
Sbjct  171  DDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA--EEKAQKEAEDKEMTLEEY  224

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K F+SM  L+NKK  ++E+FVKLGS
Sbjct  225  EKILEEKKKALQATKVEERKVDT-KVFDSMQQLSNKKTTEEEIFVKLGS  272


 Score = 25.0 bits (53),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 4/60 (7%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE----TPSIEDVGQFPTLG  220
            SINEFLKPA+G      GGRG   G G      G N   +       P+I D  QFP+LG
Sbjct  289  SINEFLKPADGARGGYRGGRGGRGGRGGRDQRGGSNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|XP_010439990.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Camelina 
sativa]
Length=390

 Score = 70.9 bits (172),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            D+IAP  +E    V  +       EKQ G+ +A  A K++P +E   KEPE+KEMTL+EY
Sbjct  175  DDIAPVTDESTAAVEKNVT----VEKQSGEGEATIANKETPAEEQPEKEPENKEMTLEEY  230

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  231  EKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGT  278


 Score = 25.8 bits (55),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 11/12 (92%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPA GE
Sbjct  296  SINEFLKPANGE  307



>gb|ADE76006.1| unknown [Picea sitchensis]
Length=135

 Score = 58.2 bits (139),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKND-DEVFVKLG  443
            MTLDEYE + EEKRKA+LA  + EERKV + KEFESM +L+NKK D D +F+KLG
Sbjct  1    MTLDEYEIVREEKRKALLALKKVEERKVDV-KEFESMQVLSNKKKDEDAMFIKLG  54


 Score = 38.5 bits (88),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF--ETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YY  G          G    G +   S   E PSIED  QFPTLG K
Sbjct  76   SINEFLKPAEGERYYSGGRVRGRGCGERGGFRGGYSGAYSNYPEAPSIEDPRQFPTLGGK  135



>ref|XP_010434762.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
 ref|XP_010434763.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=347

 Score = 64.7 bits (156),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS
Sbjct  218  MTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKANDEIFIKLGS  270


 Score = 32.0 bits (71),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 34/60 (57%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS--SFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YYR G  GRGRG           +    +   P+I D  QFP+LG K
Sbjct  288  SINEFLKPAEGENYYRGGRGGRGRGGRGRGRVSSEEHGGYRNEAAPAIGDTAQFPSLGGK  347



>ref|NP_001078724.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
 gb|AED95486.1| Hyaluronan / mRNA binding family protein [Arabidopsis thaliana]
Length=301

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 9/112 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD---SPLdepevkepedkEMTL  593
            D+I P +EEP   V    V     EKQ G+++  +AKK+       + E +E E +EMTL
Sbjct  178  DDIPPTSEEPTTEVEKSPV----AEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTL  233

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGS  440
            +EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS
Sbjct  234  EEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTDEEIFIKLGS  284



>gb|EMT12851.1| hypothetical protein F775_28068 [Aegilops tauschii]
Length=288

 Score = 71.6 bits (174),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS
Sbjct  154  MTLEEYEKVLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGS  207


 Score = 24.6 bits (52),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 28/62 (45%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAE----GETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPAE         R  G         G  G GG        P+IED  QFPTLG
Sbjct  227  SINEFLKPAEGERYSGGRGRGRGFRGRGEARGGYNGGGGGGRRPAAAPAIEDQSQFPTLG  286

Query  219  SK  214
             K
Sbjct  287  GK  288



>emb|CDY35615.1| BnaC01g21370D [Brassica napus]
Length=338

 Score = 63.5 bits (153),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKNDDEVFVKLGS  440
            MTLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK++DE+F+KLGS
Sbjct  204  MTLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGS  257


 Score = 32.3 bits (72),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 36/64 (56%), Gaps = 6/64 (9%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF------ETPSIEDVGQFPT  226
            SINEFLKPA+GE YYR G  GRGRG    R      ++  +        P+I D  QFP+
Sbjct  275  SINEFLKPADGENYYRGGRGGRGRGGRESRDRGARASSGGYGGNRSEAAPAIADTAQFPS  334

Query  225  LGSK  214
            LG K
Sbjct  335  LGGK  338



>ref|XP_003569708.1| PREDICTED: RNA-binding protein FUS-like [Brachypodium distachyon]
Length=377

 Score = 68.2 bits (165),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+ EEKRKA+LA + EERKV LDK+ +S+  L+ KK +DE+F+KLGS
Sbjct  244  MTLEEFEKIREEKRKALLALKTEERKVELDKDLQSLQPLSTKKANDEIFIKLGS  297


 Score = 27.7 bits (60),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 33/61 (54%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGS  217
            SINEFLKPAEGE YY   GRGRG     G    G            PSI+D  +FPTLG 
Sbjct  317  SINEFLKPAEGERYYGGRGRGRGGRGDRGGFRGGYGGGGYQRGPAAPSIQDQAEFPTLGG  376

Query  216  K  214
            K
Sbjct  377  K  377



>gb|ABD65067.1| nuclear RNA binding protein, putative [Brassica oleracea]
 emb|CDY52558.1| BnaC08g48170D [Brassica napus]
Length=367

 Score = 69.7 bits (169),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 9/109 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            DEI P  EE    V  D     A EK+    +A DA K++P++    KEPED EMTL+EY
Sbjct  157  DEIPPVTEESATVVEKD----LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEY  209

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEKRKA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  210  EKVLEEKRKALQATKVEERKVDT-KVFEAMQQLSSKKSNNDEVFIKLGT  257


 Score = 26.2 bits (56),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  387  SINEFLKPAEGET  349
            SINEFLKPA GE+
Sbjct  275  SINEFLKPANGES  287



>gb|KEH17858.1| nuclear RNA-binding-like protein [Medicago truncatula]
Length=373

 Score = 58.5 bits (140),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 70/111 (63%), Gaps = 14/111 (13%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAG--DAKKDSPLdepevkepedkEMTL  593
            TDE+A E E+ +           A +K  G+EDA   D  K++P  E E KEPEDKEMTL
Sbjct  193  TDEVANETEKNV-----------AEDKPVGEEDAAAADGNKETPAPEAEEKEPEDKEMTL  241

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            +EYEK+LEEKRKA+       RKV   KEFES+  L+ KK +DE+F KLGS
Sbjct  242  EEYEKVLEEKRKALNVKTDGGRKVDT-KEFESLKPLSCKKENDEIFAKLGS  291


 Score = 37.4 bits (85),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 36/61 (59%), Gaps = 5/61 (8%)
 Frame = -3

Query  387  SINEFLKPAEGET-----yyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE           G   GRG   G GGYGGN   +   PSIED GQFPTL
Sbjct  310  SINEFLKPAEGEKYYNPGGRGGRGGRGGRGGSRGGGGYGGNAYGNVSAPSIEDPGQFPTL  369

Query  222  G  220
            G
Sbjct  370  G  370



>dbj|BAJ96699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRKAILA + EERKV +DKE +SM  L+ KK+ +EVF+KLGS
Sbjct  236  MTLEEYEKVLEEKRKAILALKAEERKVEVDKELQSMQQLSVKKDAEEVFIKLGS  289



>gb|EMS68133.1| hypothetical protein TRIUR3_26332 [Triticum urartu]
Length=785

 Score = 67.8 bits (164),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPL----depevkepedkEMTLDEYEKLLEEKRKAILA-SRPEER  527
            EKQ   EDA  A ++ P        E ++ ED EMTLDE+EK++EEKRKA+ A  + EER
Sbjct  206  EKQGAPEDAPQADENKPTKDGATVVEEEKEEDNEMTLDEFEKVMEEKRKALAALKKSEER  265

Query  526  KVCLDKEFESMALLANKKNDDEVFVKLGS  440
            KV +DK+ ++M LL+ KK +DEVF+KLG+
Sbjct  266  KVEIDKDLQAMQLLSTKKGNDEVFIKLGA  294


 Score = 28.1 bits (61),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 31/61 (51%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE +Y   GRG       G    G            P+I+D  QFPTLG 
Sbjct  316  SINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGG  375

Query  216  K  214
            K
Sbjct  376  K  376



>ref|XP_009145362.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
 ref|XP_009145369.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
Length=335

 Score = 62.8 bits (151),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKNDDEVFVKLGS  440
            MTLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK++DE+F+KLGS
Sbjct  208  MTLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGS  261


 Score = 32.7 bits (73),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YYR G  GRGRG     GG    N S    P+I D  QFP+LG K
Sbjct  279  SINEFLKPAEGENYYRGGRGGRGRGGRVSSGGGFSGNRSEA-APAIADTAQFPSLGGK  335



>ref|XP_009145376.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 ref|XP_009145384.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 emb|CDY42945.1| BnaA01g18090D [Brassica napus]
Length=304

 Score = 62.8 bits (151),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKNDDEVFVKLGS  440
            MTLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK++DE+F+KLGS
Sbjct  177  MTLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSNDEIFIKLGS  230


 Score = 32.7 bits (73),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEGE YYR G  GRGRG     GG    N S    P+I D  QFP+LG K
Sbjct  248  SINEFLKPAEGENYYRGGRGGRGRGGRVSSGGGFSGNRSEA-APAIADTAQFPSLGGK  304



>dbj|BAE71297.1| hypothetical protein [Trifolium pratense]
Length=371

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 74/110 (67%), Gaps = 6/110 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA-GDAKKDSPLdepevkepedkEMTLD  590
            +DEIA   EE    V N+     A EK  G EDA  +  KD+P +E E KEPEDKEMTL+
Sbjct  186  SDEIAQVTEE----VSNEPEKNVAEEKPAGGEDATAEGNKDAPANEAEEKEPEDKEMTLE  241

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EYEK+LEEKRKA+ A + E RKV   KEFESM  L+ KK +DE+F KLGS
Sbjct  242  EYEKVLEEKRKALQALKTEGRKVDT-KEFESMKPLSCKKENDEIFAKLGS  290



>gb|AAS75737.1| thermoinhibition-associated THB-4 protein [Tagetes minuta]
Length=115

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EY+K+LEEKRKA+   + EERKV +DKE  SM  L+NKK++DE+F KLG+
Sbjct  17   MTLEEYQKVLEEKRKALETLKTEERKVEVDKELASMQQLSNKKSNDEIFAKLGT  70



>ref|XP_010440090.1| PREDICTED: uncharacterized protein LOC104723416 [Camelina sativa]
Length=132

 Score = 63.9 bits (154),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +DE+F+KLGS
Sbjct  1    MTLDEYEKILEEKKKALQSLTTSERKVD-TKVFESMQQLSNKKANDEIFIKLGS  53


 Score = 31.6 bits (70),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 28/62 (45%), Gaps = 4/62 (6%)
 Frame = -3

Query  387  SINEFLKPAEGE----TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLKPAEGE          GRG       G          +   P+I D  QFP+LG
Sbjct  71   SINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGVSSEEHGGYRNEAAPAIGDTAQFPSLG  130

Query  219  SK  214
             K
Sbjct  131  GK  132



>ref|XP_006655517.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=363

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK +DEVF+KLGS
Sbjct  241  MTLEEFEKLREEKRKALLSLKTEERKVEIDKDLQSMQPLSNKKENDEVFIKLGS  294



>ref|XP_006414219.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
 gb|ESQ55672.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
Length=368

 Score = 67.8 bits (164),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            DEI P  EE    VV   +   A EK  G+++A    KD+P+ E   +EPEDK MTL+EY
Sbjct  163  DEITPVTEESTT-VVEKNL---AVEKLGGEDEA---NKDTPVKEKAEEEPEDKSMTLEEY  215

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEKR+A+ A++ EERKV   K FE+M  +++KK N+D+VF+KLG+
Sbjct  216  EKVLEEKRQALQATKVEERKVDT-KAFETMQQISSKKSNNDDVFIKLGT  263


 Score = 26.9 bits (58),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPA+GE
Sbjct  281  SINEFLKPADGE  292



>ref|XP_008465866.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=358

 Score = 57.4 bits (137),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 7/111 (6%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKK-DSPLdepevkepedkEMTL  593
            P DE AP+ EEP    V +     A E+Q G++   D  K +  + EPE KEPEDKEMTL
Sbjct  177  PGDENAPDVEEP----VAENEKNVAPEQQLGEDGVDDNNKAEEAVKEPEEKEPEDKEMTL  232

Query  592  DEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             EYEKL EE RK  L ++ E RK  +D+E E+M  L++KK +DE+F KLG+
Sbjct  233  KEYEKLREESRK--LLAKTEVRKAEVDEELENMQQLSSKKTNDEIFAKLGT  281


 Score = 37.4 bits (85),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +I EFLKPAEGE YY PGGRGRGRG GS  G   G+N  +   PSIED GQFP+L +K
Sbjct  301  TITEFLKPAEGERYYNPGGRGRGRGRGSRGGFNNGSNRMNVAAPSIEDPGQFPSLSAK  358



>dbj|BAJ89734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=375

 Score = 67.0 bits (162),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDE+EK++EEKRKA+ A  + EERKV +DK+ ++M LL+ KK +DEVF+KLG+
Sbjct  239  MTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKKGNDEVFIKLGA  293


 Score = 27.7 bits (60),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 31/61 (51%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGS  217
            SINEFLKPAEGE +Y   GRG       G    G            P+I+D  QFPTLG 
Sbjct  315  SINEFLKPAEGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHNPPPAPAIQDQNQFPTLGG  374

Query  216  K  214
            K
Sbjct  375  K  375



>gb|EPS72575.1| hypothetical protein M569_02184 [Genlisea aurea]
Length=362

 Score = 65.5 bits (158),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LEEKRK + + + EERKV   KEFE+M  L+NKK  D +F+KLGS
Sbjct  239  MTLEEYEKVLEEKRKGLQSLKTEERKVDA-KEFEAMQQLSNKKTGDHIFIKLGS  291


 Score = 29.3 bits (64),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 35/56 (63%), Gaps = 4/56 (7%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  220
            SINEFLK  EGE YY    RGRGRG GS  G     N    + PSIED G+FP+LG
Sbjct  311  SINEFLKAGEGEKYYNNPSRGRGRGRGSRGG----GNVGGVQAPSIEDPGEFPSLG  362



>ref|XP_006285507.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
 gb|EOA18405.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
Length=363

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -2

Query  691  EKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLD  512
            EKQ G+ +A DA K+   +E   KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   
Sbjct  191  EKQGGEGEATDANKEISAEEQAEKEPEDKEMTLEEYEKVLEEKKKALQATKVEERKVDT-  249

Query  511  KEFESMALLANKK-NDDEVFVKLGS  440
            K FE+M  LANKK N+DEVF+KLG+
Sbjct  250  KAFEAMQQLANKKSNNDEVFIKLGT  274



>ref|XP_009108330.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
 ref|XP_009108331.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
Length=367

 Score = 67.8 bits (164),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 9/109 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            DE+ P  EE    V  D     A EK+    +A DA K++P++    KEPED EMTL+EY
Sbjct  157  DEVPPVTEESTTVVEKD----LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEY  209

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEKRKA+ +++ EERKV   K F+SM  L++KK N+DEVF+KLG+
Sbjct  210  EKVLEEKRKALQSTKVEERKVDT-KVFDSMQQLSSKKSNNDEVFIKLGT  257


 Score = 26.6 bits (57),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  387  SINEFLKPAEGET  349
            SINEFLKPA GE+
Sbjct  275  SINEFLKPANGES  287



>ref|XP_004148350.1| PREDICTED: uncharacterized protein LOC101207608 [Cucumis sativus]
 ref|XP_004166199.1| PREDICTED: uncharacterized protein LOC101223435 [Cucumis sativus]
 gb|KGN60476.1| hypothetical protein Csa_3G914560 [Cucumis sativus]
Length=358

 Score = 56.6 bits (135),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 8/112 (7%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGD--AKKDSPLdepevkepedkEMT  596
            P DE AP+ EEP    V +     A E+Q G++   D   K +  + EPE KEPEDKEMT
Sbjct  176  PGDENAPDVEEP----VAENEKNVAPEQQLGEDGVVDDNNKTEEAVKEPEEKEPEDKEMT  231

Query  595  LDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            L EYEKL EE RK  L ++ E RK  +D+E E+M  L++KK +DE+F KLG+
Sbjct  232  LKEYEKLREESRK--LLAKTEVRKAEVDEELENMQQLSSKKTNDEIFAKLGT  281


 Score = 37.4 bits (85),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  214
            +I EFLKPAEGE YY PGGRGRGRG GS  G   G+N  +   PSIED GQFP+L +K
Sbjct  301  TITEFLKPAEGERYYNPGGRGRGRGRGSRGGFNNGSNRMNVAAPSIEDPGQFPSLSAK  358



>emb|CDX76567.1| BnaA08g08330D [Brassica napus]
Length=367

 Score = 67.4 bits (163),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 9/109 (8%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEY  584
            DE+ P  EE    V  D     A EK+    +A DA K++P++    KEPED EMTL+EY
Sbjct  157  DELPPVTEESTTVVEKD----LAVEKEG---EATDANKETPVEAQAEKEPEDTEMTLEEY  209

Query  583  EKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EK+LEEKRKA+ +++ EERKV   K F+SM  L++KK N+DEVF+KLG+
Sbjct  210  EKVLEEKRKALQSTKVEERKVDT-KVFDSMQQLSSKKSNNDEVFIKLGT  257


 Score = 26.6 bits (57),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 11/13 (85%), Positives = 12/13 (92%), Gaps = 0/13 (0%)
 Frame = -3

Query  387  SINEFLKPAEGET  349
            SINEFLKPA GE+
Sbjct  275  SINEFLKPANGES  287



>ref|XP_008650627.1| PREDICTED: DNA ligase 1-like [Zea mays]
Length=217

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+LE+K+KA+L+ + EERKV +DKE ++M  L+ KK+ DEVF+KLGS
Sbjct  143  MTLEEYEKVLEQKQKALLSLKAEERKVEIDKELQAMQQLSVKKDGDEVFIKLGS  196



>ref|XP_010925494.1| PREDICTED: protein argonaute 2-like [Elaeis guineensis]
Length=378

 Score = 56.6 bits (135),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 82/118 (69%), Gaps = 17/118 (14%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTD----AFEKQHGQEDA--GDAKKDSP---Ldepevkep  614
            TD++  +A E       D VNTD    + EKQ  QEDA   +A KD+    ++E E KEP
Sbjct  185  TDDVLAQATE-------DNVNTDEKVASPEKQPEQEDAPFAEANKDTKEGEVNEAEEKEP  237

Query  613  edkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            EDKEMTL+EYEK+ EEKRKA+LA +PEERKV LDKEFESM  L+ KK DD VFVKLG+
Sbjct  238  EDKEMTLEEYEKIKEEKRKALLALKPEERKVQLDKEFESMQQLSLKKGDD-VFVKLGT  294


 Score = 37.0 bits (84),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 39/61 (64%), Gaps = 5/61 (8%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggy-----gGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPAEGE YY P GRGRGRG G G         G   T +   PSIED GQFPTL
Sbjct  316  SINEFLKPAEGERYYSPAGRGRGRGRGRGDRRTFGDGFGRGGTIAAAAPSIEDPGQFPTL  375

Query  222  G  220
            G
Sbjct  376  G  376



>ref|XP_008811725.1| PREDICTED: uncharacterized protein LOC103722810 [Phoenix dactylifera]
Length=140

 Score = 58.2 bits (139),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+EYEK+ EEKRKA+LAS+PEERKV LDK+FESM LL+ KK +D+VF+KLG+
Sbjct  1    MTLEEYEKIKEEKRKALLASKPEERKVELDKDFESMQLLSLKKGNDDVFMKLGT  54


 Score = 34.7 bits (78),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN-------TSSFETPSIEDVGQFP  229
            SI EFLKPAEGE YY PGGRG GRG G GRG             T +   PSIED GQFP
Sbjct  76   SITEFLKPAEGERYYSPGGRGFGRGRGRGRGDRRPFGDGFGSGVTVNATAPSIEDPGQFP  135

Query  228  TLGSK  214
            TLG K
Sbjct  136  TLGGK  140



>ref|XP_006284012.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
 gb|EOA16910.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
Length=354

 Score = 65.5 bits (158),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS
Sbjct  225  MTLDEYEKILEEKKKALQSLTTTERKVDT-KVFESMQQLSNKKSNDEIFIKLGS  277


 Score = 26.9 bits (58),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 11/12 (92%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPAEG+
Sbjct  295  SINEFLKPAEGQ  306



>gb|AES80534.2| nuclear RNA-binding-like protein [Medicago truncatula]
Length=583

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 72/109 (66%), Gaps = 5/109 (5%)
 Frame = -2

Query  766  TDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDE  587
            TDEIA   EE    V+N+G      EK   + D  +  KDSP +E E KEPEDKEMTL+E
Sbjct  197  TDEIAQVTEE----VMNEGEKNLGDEKPAVEADVAEGNKDSPANEAEEKEPEDKEMTLEE  252

Query  586  YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            YEK+LEEKRKA+   + EERKV   K FE+M  L+ KK++ E+F KLG+
Sbjct  253  YEKVLEEKRKALQTLKTEERKVDT-KAFETMQALSCKKDNTEIFAKLGA  300



>ref|XP_001785274.1| predicted protein [Physcomitrella patens]
 gb|EDQ49926.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 63.9 bits (154),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLG  443
            MTL+EYEK+L EKRKA+  ++  ERKV  DKEFE M L+ NKK ++++F+KLG
Sbjct  249  MTLEEYEKVLAEKRKALEDAKAAERKVEADKEFEKMQLVDNKKREEDIFIKLG  301


 Score = 28.1 bits (61),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 12/12 (100%), Positives = 12/12 (100%), Gaps = 0/12 (0%)
 Frame = -3

Query  387  SINEFLKPAEGE  352
            SINEFLKPAEGE
Sbjct  323  SINEFLKPAEGE  334



>ref|NP_193416.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF14243.1|AF110227_1 nuclear RNA binding protein [Arabidopsis thaliana]
 emb|CAB10456.1| nuclear antigen homolog [Arabidopsis thaliana]
 emb|CAB80954.1| nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAL36252.1| putative nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAM20150.1| putative nuclear antigen-like protein [Arabidopsis thaliana]
 gb|AAM83242.1| AT4g16830/dl4440w [Arabidopsis thaliana]
 gb|AAN18128.1| At4g16830/dl4440w [Arabidopsis thaliana]
 gb|AEE83809.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=355

 Score = 65.5 bits (158),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS
Sbjct  226  MTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGS  278


 Score = 26.2 bits (56),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS--SFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG  YYR G  GRGRG     G   G +    +   P+I D  QFP+LG K
Sbjct  296  SINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  355



>gb|AGV54489.1| plasminogen activator inhibitor 1 RNA-binding protein [Phaseolus 
vulgaris]
Length=411

 Score = 64.3 bits (155),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -2

Query  673  EDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESM  494
            E+  D  KDSP +E E KEPEDKEMTL+EYEK+LEE+RKA  A + E RKV   KEFE+M
Sbjct  214  EEVADENKDSPANETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEGRKVDA-KEFETM  272

Query  493  ALLANKKNDDEVFVKLGS  440
              L++KK + ++F+KLGS
Sbjct  273  QPLSSKKTNRDIFIKLGS  290


 Score = 26.9 bits (58),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK*G  208
            SI EFLKP EGETY+ PGGRGRGRG    RGGY G   ++    SI D G   TLG + G
Sbjct  310  SIREFLKPMEGETYFNPGGRGRGRGGRGSRGGYRGGAANNAPGASIGDRGHLATLGHEWG  369

Query  207  IKPFLPSSQFKISSGFMFLYYQ  142
                LP +   I+  F FL  Q
Sbjct  370  ----LPGAVSHIAVIFSFLGNQ  387



>ref|NP_001078399.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83810.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=265

 Score = 64.7 bits (156),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS
Sbjct  136  MTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGS  188


 Score = 26.6 bits (57),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT--SSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG  YYR G  GRGRG     G   G +    +   P+I D  QFP+LG K
Sbjct  206  SINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  265



>emb|CDY43474.1| BnaC08g10790D [Brassica napus]
Length=420

 Score = 62.0 bits (149),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  694  FEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCL  515
             EK  G E A DAKK++  +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERK   
Sbjct  149  IEKSAGDEVAADAKKENTAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKFDT  208

Query  514  DKEFESMALLANKKNDDEVFV  452
             K FESM  L+NKK++DE+F+
Sbjct  209  -KVFESMQQLSNKKSNDEIFI  228


 Score = 29.3 bits (64),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSFE------TPSIEDVGQFPT  226
            SINEFLKPAEGE +YR GGRG GRG G G    GG +   F+        +I D  QFP+
Sbjct  250  SINEFLKPAEGENHYRGGGRGGGRGRGRGGRDRGGVSGGVFDGYRSEAASAIGDTAQFPS  309

Query  225  LG  220
            LG
Sbjct  310  LG  311



>gb|KFK24045.1| hypothetical protein AALP_AAs42697U000600 [Arabis alpina]
Length=393

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 72/111 (65%), Gaps = 13/111 (12%)
 Frame = -2

Query  763  DEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedk--EMTLD  590
            D++AP  EE           T A EKQ  + +A DAKK+SP  E    EPE +  E TL+
Sbjct  179  DDVAPVTEE---------SKTVAVEKQGSKGEAADAKKESPAKEQAKSEPEPEPVEFTLE  229

Query  589  EYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            EYEK++EEK+KA+  ++ EERKV   K F+SM  L+NK+ N+DEVF+KLG+
Sbjct  230  EYEKIMEEKKKALEVTKVEERKVDT-KVFDSMQQLSNKRSNNDEVFIKLGT  279



>ref|NP_001078400.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83811.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=345

 Score = 63.9 bits (154),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 1/54 (2%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++DE+F+KLGS
Sbjct  216  MTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSNDEIFIKLGS  268


 Score = 26.6 bits (57),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT--SSFETPSIEDVGQFPTLGSK  214
            SINEFLKPAEG  YYR G  GRGRG     G   G +    +   P+I D  QFP+LG K
Sbjct  286  SINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK  345



>emb|CAA66481.1| transcription factor [Vicia faba var. minor]
Length=370

 Score = 47.8 bits (112),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = -2

Query  724  VVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA  545
            VVN+       EK   + D  +  KD+P +E E KEPEDKEMTL+EYEKLLEEKRKA+ A
Sbjct  197  VVNEAEKNFGDEKPAAENDVAEGNKDTPANEAEEKEPEDKEMTLEEYEKLLEEKRKALQA  256

Query  544  SRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
             + EERKV   KEFE+M  L+ KK++ E+F KLGS
Sbjct  257  LKTEERKVDT-KEFETMQALSCKKDNFEIFAKLGS  290


 Score = 42.7 bits (99),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  387  SINEFLKPAEGE---TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGS  217
            SINEFLKPAEGE        GGRGRGRG   G GG+ GN+TS+   PSIED G FPTLG+
Sbjct  310  SINEFLKPAEGEGYYNQGGRGGRGRGRGTRGGFGGFRGNSTSNVPAPSIEDPGHFPTLGA  369

Query  216  K  214
            K
Sbjct  370  K  370



>emb|CDY38403.1| BnaC01g10120D [Brassica napus]
Length=336

 Score = 63.9 bits (154),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGS  440
            MTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L++KK N+DEVF+KLG+
Sbjct  204  MTLEEYEKVLEEKRKALQATKIEERKVDT-KAFETMQQLSSKKSNNDEVFIKLGT  257


 Score = 26.2 bits (56),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 30/62 (48%), Gaps = 5/62 (8%)
 Frame = -3

Query  387  SINEFLKPAEGETyyrpggrgrgrghgsgrg-----gygGNNTSSFETPSIEDVGQFPTL  223
            SINEFLKPA GE Y      GRGRG             G +  ++   P IED   FPTL
Sbjct  275  SINEFLKPANGERYRGGYRGGRGRGPRGADEGGRGPKGGADRKAAAPAPKIEDAAHFPTL  334

Query  222  GS  217
            G 
Sbjct  335  GK  336



>ref|XP_002991714.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
 gb|EFJ07285.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
Length=421

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = -2

Query  769  PTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSP--LdepevkepedkEMT  596
            P D ++ E    I GV  DG   +A E +  + +A    +++P   +E + +E E+KEMT
Sbjct  242  PIDPVSVEEGNAIEGVKLDGAKLEAPEAEAPKSEAA---QETPEVTEEQKEEEKEEKEMT  298

Query  595  LDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            LDEYEK++EEKRKA+ A + EERKV  D EF+ M L+ +KK D+++F+KLG+
Sbjct  299  LDEYEKVMEEKRKALTAMKSEERKVVADSEFQKMQLV-DKKADEDIFIKLGA  349



>emb|CDM84169.1| unnamed protein product [Triticum aestivum]
Length=381

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  601  MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  440
            MTL+E+EK+ EE+RKA+LA + EERKV +DK+ +S+  L+ KK +DEVF+KLGS
Sbjct  245  MTLEEFEKIREEQRKALLALKTEERKVEVDKDLQSLQPLSTKKANDEVFIKLGS  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100