BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027C12

Length=728
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084605.1|  PREDICTED: 60S ribosomal protein L13-1             312   5e-104   Sesamum indicum [beniseed]
ref|XP_011075827.1|  PREDICTED: 60S ribosomal protein L13-1-like        308   3e-102   Sesamum indicum [beniseed]
ref|XP_004146887.1|  PREDICTED: 60S ribosomal protein L13-2-like ...    305   2e-101   
gb|KJB08613.1|  hypothetical protein B456_001G093800                    304   6e-101   Gossypium raimondii
ref|XP_008453835.1|  PREDICTED: 60S ribosomal protein L13-3             304   7e-101   Cucumis melo [Oriental melon]
gb|KDP21801.1|  hypothetical protein JCGZ_00588                         301   7e-100   Jatropha curcas
emb|CDP17844.1|  unnamed protein product                                301   1e-99    Coffea canephora [robusta coffee]
gb|KHG24237.1|  60S ribosomal L13-2                                     301   1e-99    Gossypium arboreum [tree cotton]
gb|KDP38855.1|  hypothetical protein JCGZ_05012                         300   2e-99    Jatropha curcas
ref|XP_008238048.1|  PREDICTED: 60S ribosomal protein L13-1             300   2e-99    Prunus mume [ume]
gb|KHG03134.1|  60S ribosomal L13-2                                     300   4e-99    Gossypium arboreum [tree cotton]
gb|KJB42885.1|  hypothetical protein B456_007G172400                    300   4e-99    Gossypium raimondii
ref|XP_007158142.1|  hypothetical protein PHAVU_002G127900g             299   6e-99    Phaseolus vulgaris [French bean]
gb|AGV54370.1|  60S ribosomal protein L13-2-like protein                299   6e-99    Phaseolus vulgaris [French bean]
ref|XP_007209605.1|  hypothetical protein PRUPE_ppa011506mg             299   8e-99    Prunus persica
ref|XP_006478303.1|  PREDICTED: 60S ribosomal protein L13-1-like        298   9e-99    Citrus sinensis [apfelsine]
ref|XP_007049063.1|  60S ribosomal protein L13                          298   1e-98    
ref|XP_006441816.1|  hypothetical protein CICLE_v10022283mg             298   2e-98    Citrus clementina [clementine]
ref|XP_010269352.1|  PREDICTED: 60S ribosomal protein L13-1-like        298   2e-98    Nelumbo nucifera [Indian lotus]
ref|XP_006451725.1|  hypothetical protein CICLE_v10009507mg             298   2e-98    Citrus clementina [clementine]
gb|KJB22724.1|  hypothetical protein B456_004G062900                    298   2e-98    Gossypium raimondii
ref|XP_003626150.1|  60S ribosomal protein L13                          297   3e-98    Medicago truncatula
ref|XP_006485662.1|  PREDICTED: 60S ribosomal protein L13-1-like        297   3e-98    Citrus sinensis [apfelsine]
gb|ACJ83949.1|  unknown                                                 297   3e-98    Medicago truncatula
ref|XP_002529265.1|  60S ribosomal protein L13, putative                297   3e-98    Ricinus communis
ref|XP_011028035.1|  PREDICTED: 60S ribosomal protein L13-1-like        297   3e-98    Populus euphratica
ref|XP_007218412.1|  hypothetical protein PRUPE_ppa011512mg             297   4e-98    Prunus persica
ref|XP_009795347.1|  PREDICTED: 60S ribosomal protein L13-1             297   5e-98    Nicotiana sylvestris
ref|XP_002304378.1|  60S ribosomal protein L13                          296   5e-98    Populus trichocarpa [western balsam poplar]
ref|XP_006368290.1|  60S ribosomal protein L13                          296   6e-98    Populus trichocarpa [western balsam poplar]
ref|XP_011023520.1|  PREDICTED: 60S ribosomal protein L13-1-like        296   7e-98    Populus euphratica
emb|CDP19062.1|  unnamed protein product                                296   7e-98    Coffea canephora [robusta coffee]
ref|XP_003522855.1|  PREDICTED: 60S ribosomal protein L13-1-like ...    296   7e-98    Glycine max [soybeans]
ref|XP_011018407.1|  PREDICTED: 60S ribosomal protein L13-1             296   7e-98    Populus euphratica
gb|KHG21579.1|  60S ribosomal L13-2                                     296   9e-98    Gossypium arboreum [tree cotton]
gb|AFK45847.1|  unknown                                                 296   1e-97    Medicago truncatula
ref|XP_002519996.1|  60S ribosomal protein L13, putative                296   1e-97    Ricinus communis
ref|XP_004245965.1|  PREDICTED: 60S ribosomal protein L13-1-like        296   1e-97    Solanum lycopersicum
ref|XP_009619310.1|  PREDICTED: 60S ribosomal protein L13-1             296   1e-97    Nicotiana tomentosiformis
gb|AFK47578.1|  unknown                                                 295   2e-97    Medicago truncatula
gb|AAQ96375.1|  60S ribosomal protein L13                               295   2e-97    Solanum palustre
ref|XP_010243468.1|  PREDICTED: 60S ribosomal protein L13-1             295   2e-97    Nelumbo nucifera [Indian lotus]
gb|AFK39980.1|  unknown                                                 295   2e-97    Lotus japonicus
ref|XP_008234598.1|  PREDICTED: 60S ribosomal protein L13-3-like        295   2e-97    Prunus mume [ume]
ref|XP_008467320.1|  PREDICTED: 60S ribosomal protein L13-3-like        295   2e-97    Cucumis melo [Oriental melon]
ref|XP_002319032.1|  hypothetical protein POPTR_0013s02860g             295   3e-97    Populus trichocarpa [western balsam poplar]
emb|CAN80613.1|  hypothetical protein VITISV_025451                     295   3e-97    Vitis vinifera
gb|ACJ83987.1|  unknown                                                 295   3e-97    Medicago truncatula
ref|XP_004143667.1|  PREDICTED: 60S ribosomal protein L13-1-like        295   3e-97    Cucumis sativus [cucumbers]
ref|XP_002322840.2|  hypothetical protein POPTR_0016s08310g             294   5e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010054042.1|  PREDICTED: 60S ribosomal protein L13-2             294   5e-97    Eucalyptus grandis [rose gum]
gb|AFK36916.1|  unknown                                                 294   5e-97    Medicago truncatula
ref|XP_002274000.1|  PREDICTED: 60S ribosomal protein L13-1             294   5e-97    Vitis vinifera
ref|XP_003612594.1|  60S ribosomal protein L13                          295   6e-97    
ref|XP_010503548.1|  PREDICTED: 60S ribosomal protein L13-1             293   8e-97    Camelina sativa [gold-of-pleasure]
emb|CAN84167.1|  hypothetical protein VITISV_018882                     293   1e-96    Vitis vinifera
ref|XP_011048445.1|  PREDICTED: 60S ribosomal protein L13-1-like        293   1e-96    Populus euphratica
ref|XP_004499145.1|  PREDICTED: 60S ribosomal protein L13-1-like        293   1e-96    Cicer arietinum [garbanzo]
ref|NP_001275203.1|  60S ribosomal protein L13                          293   1e-96    Solanum tuberosum [potatoes]
gb|KHG20106.1|  60S ribosomal L13-1                                     293   1e-96    Gossypium arboreum [tree cotton]
ref|XP_010269338.1|  PREDICTED: 60S ribosomal protein L13-1-like        293   1e-96    Nelumbo nucifera [Indian lotus]
ref|XP_003534321.1|  PREDICTED: 60S ribosomal protein L13-1 isofo...    293   1e-96    Glycine max [soybeans]
ref|XP_009348808.1|  PREDICTED: 60S ribosomal protein L13-1-like        292   2e-96    Pyrus x bretschneideri [bai li]
ref|XP_003547825.1|  PREDICTED: 60S ribosomal protein L13-1-like        292   3e-96    
gb|AFK40501.1|  unknown                                                 292   3e-96    Medicago truncatula
ref|XP_009382822.1|  PREDICTED: 60S ribosomal protein L13-1-like        292   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002277094.1|  PREDICTED: 60S ribosomal protein L13-1             292   4e-96    Vitis vinifera
ref|XP_008369022.1|  PREDICTED: 60S ribosomal protein L13-1-like        291   6e-96    Malus domestica [apple tree]
gb|ACJ86119.1|  unknown                                                 291   7e-96    Medicago truncatula
gb|AES82369.2|  60S ribosomal L13-like protein                          291   9e-96    Medicago truncatula
ref|XP_006394649.1|  hypothetical protein EUTSA_v10004920mg             291   1e-95    Eutrema salsugineum [saltwater cress]
ref|XP_010940804.1|  PREDICTED: 60S ribosomal protein L13-1             291   1e-95    Elaeis guineensis
ref|NP_001276322.1|  60S ribosomal protein L13-1-like                   291   1e-95    
gb|AFK44824.1|  unknown                                                 290   1e-95    Lotus japonicus
ref|XP_010056172.1|  PREDICTED: 60S ribosomal protein L13-1-like        290   2e-95    Eucalyptus grandis [rose gum]
gb|KHN27522.1|  60S ribosomal protein L13-2                             290   2e-95    Glycine soja [wild soybean]
ref|XP_008386691.1|  PREDICTED: 60S ribosomal protein L13-1             290   2e-95    
ref|XP_004512380.1|  PREDICTED: 60S ribosomal protein L13-1-like ...    290   2e-95    
gb|ACU23653.1|  unknown                                                 290   3e-95    Glycine max [soybeans]
ref|XP_010426404.1|  PREDICTED: 60S ribosomal protein L13-1-like        290   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009595065.1|  PREDICTED: 60S ribosomal protein L13-2             290   3e-95    Nicotiana tomentosiformis
ref|XP_009335726.1|  PREDICTED: 60S ribosomal protein L13-3-like        290   3e-95    Pyrus x bretschneideri [bai li]
ref|XP_010906706.1|  PREDICTED: 60S ribosomal protein L13-1-like        290   3e-95    Elaeis guineensis
ref|XP_009351877.1|  PREDICTED: 60S ribosomal protein L13-1             290   3e-95    Pyrus x bretschneideri [bai li]
dbj|BAM64854.1|  RPL13 protein                                          289   4e-95    Beta vulgaris [beet]
ref|XP_008376874.1|  PREDICTED: 60S ribosomal protein L13-3             289   5e-95    
ref|XP_006598706.1|  PREDICTED: uncharacterized protein LOC100499...    289   6e-95    
gb|EYU19728.1|  hypothetical protein MIMGU_mgv1a013902mg                289   6e-95    Erythranthe guttata [common monkey flower]
ref|XP_008381780.1|  PREDICTED: 60S ribosomal protein L13-3-like        289   7e-95    Malus domestica [apple tree]
ref|XP_007156319.1|  hypothetical protein PHAVU_003G276400g             289   7e-95    Phaseolus vulgaris [French bean]
ref|XP_010278804.1|  PREDICTED: 60S ribosomal protein L13-2-like        289   7e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010519493.1|  PREDICTED: 60S ribosomal protein L13-1             288   8e-95    Tarenaya hassleriana [spider flower]
ref|XP_009335696.1|  PREDICTED: 60S ribosomal protein L13-1-like        288   8e-95    Pyrus x bretschneideri [bai li]
ref|XP_009773597.1|  PREDICTED: 60S ribosomal protein L13-2-like        288   8e-95    Nicotiana sylvestris
ref|XP_010671181.1|  PREDICTED: 60S ribosomal protein L13-1             288   9e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002877641.1|  ATBBC1                                             288   9e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_009361223.1|  PREDICTED: 60S ribosomal protein L13-3-like        288   1e-94    Pyrus x bretschneideri [bai li]
gb|EYU45361.1|  hypothetical protein MIMGU_mgv1a013891mg                288   1e-94    Erythranthe guttata [common monkey flower]
ref|XP_010677493.1|  PREDICTED: 60S ribosomal protein L13-1-like        288   1e-94    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAM64815.1|  RPL13                                                  288   2e-94    Beta vulgaris [beet]
ref|XP_006655721.1|  PREDICTED: 60S ribosomal protein L13-1-like        287   2e-94    Oryza brachyantha
gb|KJB10376.1|  hypothetical protein B456_001G197800                    287   2e-94    Gossypium raimondii
ref|XP_009395324.1|  PREDICTED: 60S ribosomal protein L13-1             287   2e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006291856.1|  hypothetical protein CARUB_v10018032mg             287   2e-94    Capsella rubella
ref|XP_008785029.1|  PREDICTED: 60S ribosomal protein L13-1-like        287   3e-94    Phoenix dactylifera
ref|XP_006342488.1|  PREDICTED: 60S ribosomal protein L13-1-like        287   3e-94    Solanum tuberosum [potatoes]
ref|XP_008776365.1|  PREDICTED: 60S ribosomal protein L13-1-like        286   5e-94    Phoenix dactylifera
gb|EPS71909.1|  hypothetical protein M569_02849                         286   5e-94    Genlisea aurea
ref|XP_009792303.1|  PREDICTED: 60S ribosomal protein L13-1-like        286   5e-94    Nicotiana sylvestris
ref|XP_006659160.1|  PREDICTED: 60S ribosomal protein L13-1-like        286   7e-94    Oryza brachyantha
ref|XP_009624483.1|  PREDICTED: 60S ribosomal protein L13-1-like        286   9e-94    Nicotiana tomentosiformis
ref|XP_006404190.1|  hypothetical protein EUTSA_v10010724mg             286   1e-93    Eutrema salsugineum [saltwater cress]
ref|NP_001056613.1|  Os06g0115500                                       286   1e-93    
ref|XP_010918091.1|  PREDICTED: 60S ribosomal protein L13-1-like        286   1e-93    Elaeis guineensis
emb|CDY66119.1|  BnaC01g42370D                                          286   1e-93    Brassica napus [oilseed rape]
ref|XP_010102662.1|  60S ribosomal protein L13-2                        286   1e-93    Morus notabilis
ref|XP_009150164.1|  PREDICTED: 60S ribosomal protein L13-2             285   1e-93    Brassica rapa
ref|NP_190470.1|  60S ribosomal protein L13-1                           285   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149775.1|  PREDICTED: 60S ribosomal protein L13-1-like        285   2e-93    Brassica rapa
ref|XP_006847908.1|  hypothetical protein AMTR_s00029p00111280          285   2e-93    Amborella trichopoda
ref|XP_009386549.1|  PREDICTED: 60S ribosomal protein L13-1-like        285   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775606.1|  PREDICTED: 60S ribosomal protein L13-1             285   2e-93    Phoenix dactylifera
ref|XP_004509537.1|  PREDICTED: 60S ribosomal protein L13-1-like        285   2e-93    Cicer arietinum [garbanzo]
ref|XP_004253080.1|  PREDICTED: 60S ribosomal protein L13-1             285   2e-93    Solanum lycopersicum
emb|CDY16871.1|  BnaA09g05110D                                          285   2e-93    Brassica napus [oilseed rape]
ref|XP_002874151.1|  60S ribosomal protein L13                          285   2e-93    
ref|XP_010421197.1|  PREDICTED: 60S ribosomal protein L13-3             285   3e-93    Camelina sativa [gold-of-pleasure]
ref|NP_001288976.1|  60S ribosomal protein L13-2                        285   3e-93    Brassica rapa
sp|P41129.1|RL132_BRANA  RecName: Full=60S ribosomal protein L13-...    285   3e-93    Brassica napus [oilseed rape]
emb|CDX87152.1|  BnaC09g04670D                                          284   5e-93    
emb|CDY05893.1|  BnaC08g20700D                                          284   5e-93    
ref|XP_002456870.1|  hypothetical protein SORBIDRAFT_03g044290          284   6e-93    Sorghum bicolor [broomcorn]
ref|XP_004969597.1|  PREDICTED: 60S ribosomal protein L13-1-like        283   1e-92    Setaria italica
ref|NP_001152730.1|  LOC100286371                                       283   1e-92    Zea mays [maize]
gb|AAM61490.1|  60S ribosomal protein L13, BBC1 protein                 283   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493519.1|  PREDICTED: 60S ribosomal protein L13-3-like        283   2e-92    
ref|XP_009141778.1|  PREDICTED: 60S ribosomal protein L13-3             283   2e-92    Brassica rapa
ref|XP_006288673.1|  hypothetical protein CARUB_v10001981mg             283   2e-92    Capsella rubella
sp|P41128.1|RL131_BRANA  RecName: Full=60S ribosomal protein L13-...    282   2e-92    Brassica napus [oilseed rape]
ref|XP_009151668.1|  PREDICTED: 60S ribosomal protein L13-1             282   3e-92    Brassica rapa
ref|XP_009392764.1|  PREDICTED: 60S ribosomal protein L13-1-like        282   3e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010233707.1|  PREDICTED: 60S ribosomal protein L13-1-like        282   4e-92    Brachypodium distachyon [annual false brome]
ref|XP_004969592.1|  PREDICTED: 60S ribosomal protein L13-1-like        281   5e-92    Setaria italica
ref|XP_010545924.1|  PREDICTED: 60S ribosomal protein L13-1-like        281   6e-92    Tarenaya hassleriana [spider flower]
gb|ABK25466.1|  unknown                                                 281   7e-92    Picea sitchensis
ref|NP_001148638.1|  60S ribosomal protein L13-2                        281   7e-92    Zea mays [maize]
emb|CAC27142.1|  60S ribosomal protein L13E                             281   8e-92    Picea abies
ref|XP_010454674.1|  PREDICTED: 60S ribosomal protein L13-3-like        281   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_003573442.1|  PREDICTED: 60S ribosomal protein L13-1-like        281   1e-91    Brachypodium distachyon [annual false brome]
ref|XP_008800008.1|  PREDICTED: 60S ribosomal protein L13-1-like        280   1e-91    Phoenix dactylifera
ref|NP_001050537.1|  Os03g0576700                                       280   2e-91    
ref|XP_002440279.1|  hypothetical protein SORBIDRAFT_09g028960          280   3e-91    Sorghum bicolor [broomcorn]
ref|NP_001078260.1|  60S ribosomal protein L13-1                        279   4e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404189.1|  hypothetical protein EUTSA_v10010724mg             279   4e-91    
ref|XP_002439380.1|  hypothetical protein SORBIDRAFT_09g005460          278   8e-91    Sorghum bicolor [broomcorn]
ref|NP_001155192.1|  60S ribosomal protein L13 isoform 1                278   2e-90    Zea mays [maize]
ref|XP_010550553.1|  PREDICTED: 60S ribosomal protein L13-1-like        277   2e-90    Tarenaya hassleriana [spider flower]
ref|NP_197778.1|  60S ribosomal protein L13-3                           277   2e-90    Arabidopsis thaliana [mouse-ear cress]
gb|ABK24025.1|  unknown                                                 275   1e-89    Picea sitchensis
gb|AFW84113.1|  hypothetical protein ZEAMMB73_641905                    275   2e-89    
ref|XP_006850159.1|  hypothetical protein AMTR_s00022p00239970          275   3e-89    Amborella trichopoda
ref|XP_009396207.1|  PREDICTED: 60S ribosomal protein L13-1-like        274   4e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT28307.1|  60S ribosomal protein L13-1                             274   4e-89    
gb|ABR18061.1|  unknown                                                 274   4e-89    Picea sitchensis
gb|ABF97255.1|  60S ribosomal protein L13-2, putative, expressed        273   4e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982044.1|  PREDICTED: 60S ribosomal protein L13-2-like ...    273   6e-89    Setaria italica
gb|EMT10064.1|  60S ribosomal protein L13-1                             273   2e-88    
dbj|BAJ99213.1|  predicted protein                                      272   3e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50076.1|  60S ribosomal protein L13-1                             272   2e-87    Triticum urartu
gb|AIZ68174.1|  60S ribosomal protein L13-1-like protein                268   2e-86    Ornithogalum longebracteatum [sea-onion]
ref|XP_007040896.1|  60S ribosomal protein L13                          266   5e-86    
gb|EMS59514.1|  60S ribosomal protein L13-1                             265   2e-85    Triticum urartu
ref|XP_010539934.1|  PREDICTED: 60S ribosomal protein L13-1-like        262   3e-84    Tarenaya hassleriana [spider flower]
ref|NP_190465.1|  putative 60S ribosomal protein L13-2                  246   3e-78    Arabidopsis thaliana [mouse-ear cress]
sp|P49627.1|RL13_TOBAC  RecName: Full=60S ribosomal protein L13; ...    245   7e-78    Nicotiana tabacum [American tobacco]
ref|XP_001770513.1|  predicted protein                                  241   2e-76    
ref|XP_001762920.1|  predicted protein                                  241   4e-76    
ref|XP_001756184.1|  predicted protein                                  240   7e-76    
ref|XP_001761309.1|  predicted protein                                  237   1e-74    
ref|XP_001785308.1|  predicted protein                                  235   6e-74    
gb|AAT08722.1|  cold-induced protein                                    234   6e-74    Hyacinthus orientalis [common hyacinth]
emb|CDP02021.1|  unnamed protein product                                223   4e-70    Coffea canephora [robusta coffee]
ref|XP_002962809.1|  hypothetical protein SELMODRAFT_266648             225   8e-70    Selaginella moellendorffii
ref|XP_002962473.1|  hypothetical protein SELMODRAFT_165483             223   4e-69    Selaginella moellendorffii
ref|XP_003626151.1|  60S ribosomal protein L13                          220   6e-69    
ref|XP_003626152.1|  60S ribosomal protein L13                          214   2e-66    
ref|XP_011395748.1|  60S ribosomal protein L13-2                        214   1e-65    Auxenochlorella protothecoides
ref|XP_005646484.1|  ribosomal protein L13e                             214   1e-65    Coccomyxa subellipsoidea C-169
ref|NP_001238240.1|  uncharacterized protein LOC100499935               209   1e-64    
ref|XP_001633643.1|  predicted protein                                  209   1e-63    Nematostella vectensis
dbj|BAB71993.1|  BBC1-like protein                                      206   3e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005843532.1|  hypothetical protein CHLNCDRAFT_33026              207   7e-63    Chlorella variabilis
gb|AAL93210.1|AF487458_1  BBC1-like protein                             203   2e-62    Triticum aestivum [Canadian hard winter wheat]
gb|KDD76767.1|  ribosomal protein L13e                                  204   7e-62    Helicosporidium sp. ATCC 50920
gb|KDO51401.1|  hypothetical protein CISIN_1g041207mg                   194   7e-59    Citrus sinensis [apfelsine]
ref|XP_002502525.1|  predicted protein                                  196   2e-58    Micromonas commoda
emb|CCQ18590.1|  60S ribosomal protein L13                              195   3e-58    Sycon ciliatum
emb|CAD28610.1|  60S ribosomal protein L13                              194   6e-58    Polytomella sp. Pringsheim 198.80
ref|NP_937786.1|  60S ribosomal protein L13                             194   1e-57    Danio rerio [leopard danio]
ref|XP_003056914.1|  predicted protein                                  192   5e-57    Micromonas pusilla CCMP1545
gb|KCW72783.1|  hypothetical protein EUGRSUZ_E01232                     188   4e-56    Eucalyptus grandis [rose gum]
ref|XP_002195773.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     189   6e-56    Taeniopygia guttata
ref|XP_005052310.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    189   7e-56    Ficedula albicollis
gb|AEB31272.1|  60S ribosomal protein                                   189   8e-56    Epinephelus bruneus
ref|XP_010716479.1|  PREDICTED: 60S ribosomal protein L13               189   9e-56    Meleagris gallopavo [common turkey]
ref|XP_003382527.1|  PREDICTED: 60S ribosomal protein L13-like          189   1e-55    Amphimedon queenslandica
ref|XP_002154424.1|  PREDICTED: 60S ribosomal protein L13-like          189   1e-55    
ref|XP_008286406.1|  PREDICTED: 60S ribosomal protein L13               189   1e-55    Stegastes partitus
emb|CEF98175.1|  Ribosomal protein L13e                                 189   1e-55    Ostreococcus tauri
ref|NP_990330.1|  60S ribosomal protein L13                             188   1e-55    Gallus gallus [bantam]
ref|XP_001418121.1|  Ribosomal protein L13, component of cytosoli...    189   1e-55    Ostreococcus lucimarinus CCE9901
emb|CAF99615.1|  unnamed protein product                                188   1e-55    Tetraodon nigroviridis
gb|AFM90798.1|  60S ribosomal protein L13                               188   2e-55    Callorhinchus milii [Australian ghost shark]
ref|XP_004543183.1|  PREDICTED: 60S ribosomal protein L13-like is...    187   3e-55    Maylandia zebra
ref|XP_008489456.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    187   4e-55    Calypte anna
gb|AFM90648.1|  60S ribosomal protein L13                               187   4e-55    Callorhinchus milii [Australian ghost shark]
gb|AFM87368.1|  RPL13 protein isoform 1                                 187   4e-55    Callorhinchus milii [Australian ghost shark]
ref|XP_009271349.1|  PREDICTED: 60S ribosomal protein L13               187   4e-55    Aptenodytes forsteri
ref|XP_001356321.1|  GA18330                                            187   4e-55    Drosophila pseudoobscura pseudoobscura
gb|AFM88842.1|  RPL13 protein isoform 1                                 187   4e-55    Callorhinchus milii [Australian ghost shark]
gb|AFM90524.1|  RPL13 protein isoform 1                                 187   5e-55    Callorhinchus milii [Australian ghost shark]
ref|NP_001279295.1|  ribosomal protein L13                              187   5e-55    Callorhinchus milii [Australian ghost shark]
gb|AFM88774.1|  RPL13 protein isoform 1                                 187   5e-55    Callorhinchus milii [Australian ghost shark]
ref|XP_009675145.1|  PREDICTED: 60S ribosomal protein L13               187   5e-55    Struthio camelus australis
ref|XP_005741646.1|  PREDICTED: 60S ribosomal protein L13-like          187   5e-55    Pundamilia nyererei
ref|XP_005810478.1|  PREDICTED: 60S ribosomal protein L13-like          187   6e-55    Xiphophorus maculatus
ref|XP_006139461.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    187   6e-55    Pelodiscus sinensis [Chinese softshell turtle]
gb|KFV82308.1|  60S ribosomal protein L13                               186   7e-55    Struthio camelus australis
ref|XP_001969383.1|  GG10074                                            187   7e-55    Drosophila erecta
gb|AFM85620.1|  RPL13 protein isoform 1                                 186   8e-55    Callorhinchus milii [Australian ghost shark]
ref|XP_010743079.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    186   8e-55    
ref|XP_003442322.1|  PREDICTED: 60S ribosomal protein L13-like is...    186   8e-55    Oreochromis niloticus
ref|XP_008403549.1|  PREDICTED: 60S ribosomal protein L13               186   1e-54    Poecilia reticulata
ref|NP_523530.1|  ribosomal protein L13, isoform A                      186   1e-54    Drosophila melanogaster
emb|CDW52162.1|  60S ribosomal protein L13                              186   1e-54    Trichuris trichiura
ref|XP_003970021.1|  PREDICTED: 60S ribosomal protein L13-like is...    186   1e-54    
gb|AFM87311.1|  RPL13 protein isoform 1                                 186   1e-54    Callorhinchus milii [Australian ghost shark]
ref|XP_005308237.1|  PREDICTED: 60S ribosomal protein L13               186   1e-54    Chrysemys picta bellii
ref|XP_001366584.1|  PREDICTED: 60S ribosomal protein L13               186   1e-54    Monodelphis domestica
ref|XP_008335251.1|  PREDICTED: 60S ribosomal protein L13               186   2e-54    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007059366.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    186   2e-54    Chelonia mydas [green seaturtle]
gb|AFM86534.1|  RPL13 protein isoform 1                                 186   2e-54    Callorhinchus milii [Australian ghost shark]
gb|AFM89144.1|  RPL13 protein isoform 1                                 186   2e-54    Callorhinchus milii [Australian ghost shark]
gb|ACH70813.1|  ribosomal protein L13                                   186   2e-54    Salmo salar
gb|AFM87461.1|  RPL13 protein isoform 1                                 185   2e-54    Callorhinchus milii [Australian ghost shark]
gb|AFM85555.1|  RPL13 protein isoform 1                                 185   2e-54    Callorhinchus milii [Australian ghost shark]
ref|NP_001230274.1|  ribosomal protein L13                              185   2e-54    Sus scrofa [pigs]
ref|XP_003758535.1|  PREDICTED: 60S ribosomal protein L13               185   2e-54    Sarcophilus harrisii
gb|AFM90194.1|  RPL13 protein isoform 1                                 185   2e-54    Callorhinchus milii [Australian ghost shark]
gb|KFO77864.1|  60S ribosomal protein L13                               185   2e-54    Cuculus canorus
ref|XP_006027900.1|  PREDICTED: 60S ribosomal protein L13               185   3e-54    Alligator sinensis
ref|XP_010401937.1|  PREDICTED: 60S ribosomal protein L13               184   3e-54    
ref|XP_007670825.1|  PREDICTED: 60S ribosomal protein L13               185   4e-54    Ornithorhynchus anatinus [duck-billed platypus]
gb|AAX48845.1|  L13                                                     184   4e-54    Suberites domuncula
gb|AAN73374.1|  ribosomal protein L13                                   183   4e-54    Scyliorhinus canicula [smaller spotted dogfish]
sp|O48513.1|RL13_CHLSW  RecName: Full=60S ribosomal protein L13; ...    184   5e-54    Chlamydomonas sp. W80
ref|XP_004067037.1|  PREDICTED: 60S ribosomal protein L13               184   5e-54    Oryzias latipes [Japanese rice fish]
ref|XP_007531327.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    184   5e-54    Erinaceus europaeus [common hedgehog]
gb|AFM89025.1|  RPL13 protein isoform 1                                 184   5e-54    Callorhinchus milii [Australian ghost shark]
ref|NP_001086472.1|  ribosomal protein L13                              184   5e-54    Xenopus laevis [clawed frog]
ref|NP_001134763.1|  60S ribosomal protein L13                          184   6e-54    Salmo salar
gb|EPZ33898.1|  Ribosomal protein L13e domain-containing protein        184   6e-54    Rozella allomycis CSF55
gb|AFM88430.1|  RPL13 protein isoform 1                                 184   6e-54    Callorhinchus milii [Australian ghost shark]
ref|XP_004392184.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     184   6e-54    Odobenus rosmarus divergens
ref|XP_007468509.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    184   7e-54    Lipotes vexillifer [baiji]
gb|AFM90533.1|  RPL13 protein isoform 1                                 184   7e-54    Callorhinchus milii [Australian ghost shark]
ref|XP_010789836.1|  PREDICTED: 60S ribosomal protein L13               184   7e-54    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006641265.1|  PREDICTED: 60S ribosomal protein L13-like is...    184   8e-54    Lepisosteus oculatus
gb|AFM88766.1|  RPL13 protein isoform 1                                 184   8e-54    Callorhinchus milii [Australian ghost shark]
gb|ABI26261.1|  ribosomal protein L13                                   184   9e-54    Dicentrarchus labrax [European sea bass]
ref|XP_006001099.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    184   1e-53    Latimeria chalumnae
ref|NP_058018.2|  60S ribosomal protein L13                             184   1e-53    Mus musculus [mouse]
ref|XP_002739297.1|  PREDICTED: 60S ribosomal protein L13-like          184   1e-53    Saccoglossus kowalevskii
dbj|BAB27309.1|  unnamed protein product                                183   1e-53    Mus musculus [mouse]
gb|KFO95639.1|  60S ribosomal protein L13                               183   1e-53    Calypte anna
ref|XP_536749.1|  PREDICTED: 60S ribosomal protein L13 isoformX1        183   1e-53    Canis lupus familiaris [dogs]
ref|XP_001140497.2|  PREDICTED: 60S ribosomal protein L13               183   1e-53    Pan troglodytes
ref|XP_008838743.1|  PREDICTED: 60S ribosomal protein L13               183   1e-53    Nannospalax galili
gb|ADG29169.1|  60S ribosomal protein L13                               182   1e-53    Epinephelus coioides [estuary cod]
ref|XP_005862549.1|  PREDICTED: 60S ribosomal protein L13               183   1e-53    
ref|XP_005345872.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    183   1e-53    
gb|AAH66320.1|  Ribosomal protein L13                                   183   1e-53    
gb|ACN10300.1|  60S ribosomal protein L13                               183   1e-53    
ref|XP_006751829.1|  PREDICTED: 60S ribosomal protein L13-like is...    183   2e-53    
ref|NP_150254.1|  60S ribosomal protein L13 isoform 1                   183   2e-53    
gb|AFM86501.1|  RPL13 protein isoform 1                                 183   2e-53    
ref|XP_003800857.1|  PREDICTED: 60S ribosomal protein L13               183   2e-53    
ref|XP_005608561.1|  PREDICTED: 60S ribosomal protein L13               183   2e-53    
ref|XP_004878310.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    183   2e-53    
gb|ADD38054.1|  60S ribosomal protein L13                               183   2e-53    
ref|XP_009561513.1|  PREDICTED: 60S ribosomal protein L13               184   2e-53    
ref|XP_005360630.1|  PREDICTED: 60S ribosomal protein L13-like is...    183   2e-53    
ref|XP_004377825.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     183   2e-53    
ref|XP_001092801.1|  PREDICTED: 60S ribosomal protein L13-like is...    182   2e-53    
ref|XP_008774860.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    182   2e-53    
ref|XP_007234286.1|  PREDICTED: 60S ribosomal protein L13               182   2e-53    
gb|AAX29381.1|  ribosomal protein L13                                   182   3e-53    
ref|XP_005892455.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    182   3e-53    
ref|NP_001015543.1|  60S ribosomal protein L13                          182   3e-53    
ref|XP_007937363.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    182   3e-53    
ref|XP_002065688.1|  GK15580                                            182   3e-53    
ref|XP_005956611.1|  PREDICTED: 60S ribosomal protein L13-like is...    182   3e-53    
ref|XP_004471974.1|  PREDICTED: 60S ribosomal protein L13-like          182   3e-53    
ref|XP_010902173.1|  PREDICTED: 60S ribosomal protein L13               182   4e-53    
ref|XP_002057754.1|  GJ17923                                            182   4e-53    
ref|XP_008988818.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    182   4e-53    
ref|XP_007992611.1|  PREDICTED: 60S ribosomal protein L13               182   4e-53    
ref|XP_004280098.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     182   4e-53    
ref|NP_001187042.1|  60S ribosomal protein L13                          182   4e-53    
dbj|BAF98660.1|  ribosomal protein L13                                  182   4e-53    
ref|XP_004437070.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     182   4e-53    
ref|XP_003227488.1|  PREDICTED: 60S ribosomal protein L13               182   5e-53    
ref|XP_003280664.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     182   5e-53    
ref|XP_010625865.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    182   5e-53    
gb|ACQ58287.1|  60S ribosomal protein L13                               181   7e-53    
ref|XP_004666135.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    181   8e-53    
ref|XP_004629406.1|  PREDICTED: 60S ribosomal protein L13-like is...    181   9e-53    
emb|CAA45963.1|  BBC1                                                   181   1e-52    
gb|AEA39508.1|  ribosomal protein L13                                   181   1e-52    
ref|XP_003418096.1|  PREDICTED: 60S ribosomal protein L13               181   1e-52    
gb|ACO12533.1|  60S ribosomal protein L13                               181   2e-52    
gb|AAH41531.1|  Similar to ribosomal protein L13                        180   2e-52    
ref|XP_010968289.1|  PREDICTED: 60S ribosomal protein L13               180   2e-52    
gb|EDL78512.1|  rCG62940                                                180   2e-52    
ref|NP_112363.1|  60S ribosomal protein L13                             180   2e-52    
ref|XP_004645046.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    180   2e-52    
gb|AAA69923.1|  60S ribosomal protein                                   180   2e-52    
ref|NP_989111.1|  60S ribosomal protein L13                             180   2e-52    
ref|XP_006902912.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    180   3e-52    
ref|XP_002002807.1|  GI17580                                            180   3e-52    
emb|CBN08623.1|  small nucleolar RNA, C/D box 68                        179   4e-52    
ref|XP_005343024.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    179   4e-52    
ref|XP_001963023.1|  GF15733                                            179   4e-52    
ref|XP_002952518.1|  ribosomal protein L13 component of cytosolic...    179   4e-52    
ref|XP_005188755.1|  PREDICTED: 60S ribosomal protein L13               179   5e-52    
gb|ETE69154.1|  60S ribosomal protein L13                               179   5e-52    
emb|CCD27757.1|  ribosomal protein l13                                  179   5e-52    
ref|XP_002723646.2|  PREDICTED: 60S ribosomal protein L13               180   5e-52    
ref|NP_001233732.1|  60S ribosomal protein L13                          179   5e-52    
ref|XP_010996322.1|  PREDICTED: 60S ribosomal protein L13               180   6e-52    
ref|XP_007433001.1|  PREDICTED: 60S ribosomal protein L13               179   6e-52    
gb|EGV94062.1|  60S ribosomal protein L13                               178   7e-52    
gb|ACK44340.1|  ribosomal protein L13                                   179   8e-52    
gb|AAI02866.1|  RPL13 protein                                           181   8e-52    
ref|XP_005705644.1|  60S ribosomal protein L13e                         179   9e-52    
gb|KFD48816.1|  hypothetical protein M513_10300                         178   1e-51    
ref|XP_011440919.1|  PREDICTED: 60S ribosomal protein L13-like          178   1e-51    
ref|XP_011191555.1|  PREDICTED: 60S ribosomal protein L13               178   1e-51    
emb|CCD27761.1|  ribosomal protein l13                                  177   2e-51    
ref|XP_001692670.1|  ribosomal protein L13, component of cytosoli...    178   2e-51    
emb|CEG74076.1|  Putative 60S ribosomal protein L13                     177   2e-51    
ref|XP_002604928.1|  hypothetical protein BRAFLDRAFT_279721             177   2e-51    
gb|ABZ04227.1|  ribosomal protein rpl13                                 177   3e-51    
gb|AAS49551.1|  ribosomal protein L13                                   176   3e-51    
emb|CCD27771.1|  ribosomal protein l13                                  177   4e-51    
gb|EPX71322.1|  60S ribosomal protein L13                               177   4e-51    
emb|CEF65706.1|  60S ribosomal protein L13                              177   5e-51    
emb|CCI40738.1|  unnamed protein product                                177   5e-51    
gb|AGH70160.1|  60S ribosomal protein L13                               176   6e-51    
ref|XP_009811475.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    176   7e-51    
ref|XP_006879341.1|  PREDICTED: 60S ribosomal protein L13-like is...    176   7e-51    
ref|XP_009169027.1|  hypothetical protein T265_05694                    176   8e-51    
tpg|DAA20190.1|  TPA: ribosomal protein L13-like                        176   1e-50    
gb|ABM55445.1|  ribosomal protein L13                                   176   1e-50    
gb|AAS49590.1|  ribosomal protein L13                                   175   1e-50    
gb|AIU94834.1|  60S ribosomal protein                                   176   1e-50    
emb|CEG63488.1|  Putative 60S ribosomal protein L13                     176   1e-50    
ref|XP_011201713.1|  PREDICTED: 60S ribosomal protein L13               176   1e-50    
gb|KFV54384.1|  60S ribosomal protein L13                               176   1e-50    
gb|AAS49552.1|  ribosomal protein L13                                   175   1e-50    
dbj|GAA49202.1|  large subunit ribosomal protein L13e                   176   1e-50    
ref|XP_001988257.1|  GH11063                                            175   2e-50    
gb|KFP71303.1|  60S ribosomal protein L13                               174   2e-50    
ref|XP_009080340.1|  PREDICTED: 60S ribosomal protein L13               174   2e-50    
ref|XP_004012492.1|  PREDICTED: 60S ribosomal protein L13-like is...    174   3e-50    
ref|XP_002108220.1|  expressed hypothetical protein                     174   4e-50    
gb|KFM61038.1|  60S ribosomal protein L13                               173   7e-50    
ref|XP_007514005.1|  predicted protein                                  176   7e-50    
gb|AHH02400.1|  putative 60S ribosomal protein L13                      170   8e-50    
gb|AAN73372.1|  ribosomal protein L13                                   172   9e-50    
ref|XP_005956376.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    173   1e-49    
gb|KFV70353.1|  60S ribosomal protein L13                               172   1e-49    
ref|XP_005496541.1|  PREDICTED: 60S ribosomal protein L13               172   1e-49    
gb|KFO63370.1|  60S ribosomal protein L13                               172   1e-49    
emb|CCA14227.1|  60S ribosomal protein L13 putative                     173   1e-49    
ref|XP_005424880.1|  PREDICTED: 60S ribosomal protein L13               172   1e-49    
ref|XP_008959127.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    173   2e-49    
gb|KFW84037.1|  60S ribosomal protein L13                               172   2e-49    
ref|XP_008637418.1|  PREDICTED: 60S ribosomal protein L13               172   2e-49    
ref|XP_009902812.1|  PREDICTED: 60S ribosomal protein L13               172   2e-49    
gb|EFX84971.1|  hypothetical protein DAPPUDRAFT_34614                   172   2e-49    
gb|EPB81665.1|  50S ribosomal protein L13e                              172   3e-49    
ref|XP_006897765.1|  PREDICTED: 60S ribosomal protein L13-like is...    172   3e-49    
ref|XP_009479221.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    171   3e-49    
ref|XP_005714141.1|  60S ribosomal protein L13                          172   4e-49    
gb|KFH63588.1|  50S ribosomal protein L13e                              172   4e-49    
gb|EPY53464.1|  60S ribosomal protein L13                               172   4e-49    
ref|XP_004710007.1|  PREDICTED: 60S ribosomal protein L13-like is...    172   4e-49    
ref|XP_008469641.1|  PREDICTED: 60S ribosomal protein L13-like          172   4e-49    
gb|KGL97501.1|  60S ribosomal protein L13                               171   4e-49    
ref|XP_004584149.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    171   5e-49    
gb|ELU11053.1|  hypothetical protein CAPTEDRAFT_183211                  171   5e-49    
emb|CDQ64746.1|  unnamed protein product                                171   5e-49    
gb|EPB87974.1|  50S ribosomal protein L13e                              172   5e-49    
ref|NP_001284610.1|  60S ribosomal protein L13-like                     172   6e-49    
gb|KFO05986.1|  60S ribosomal protein L13                               170   6e-49    
ref|XP_004534535.1|  PREDICTED: 60S ribosomal protein L13-like          171   6e-49    
ref|XP_009986763.1|  PREDICTED: 60S ribosomal protein L13               170   7e-49    
gb|KFV90589.1|  60S ribosomal protein L13                               170   8e-49    
gb|KFP92957.1|  60S ribosomal protein L13                               170   8e-49    
ref|XP_008925887.1|  PREDICTED: 60S ribosomal protein L13               171   8e-49    
gb|KFR11629.1|  60S ribosomal protein L13                               170   8e-49    
gb|AAX62455.1|  ribosomal protein L13                                   171   8e-49    
ref|XP_009921747.1|  PREDICTED: 60S ribosomal protein L13               170   9e-49    
ref|XP_010156803.1|  PREDICTED: 60S ribosomal protein L13               169   9e-49    
gb|KFU85768.1|  60S ribosomal protein L13                               170   9e-49    
gb|KFP12425.1|  60S ribosomal protein L13                               170   9e-49    
gb|KFQ20632.1|  60S ribosomal protein L13                               170   9e-49    
gb|EDL36150.1|  mCG6146                                                 171   9e-49    
gb|KFV10868.1|  60S ribosomal protein L13                               170   1e-48    
ref|XP_009696518.1|  PREDICTED: 60S ribosomal protein L13               169   1e-48    
gb|EIE83814.1|  hypothetical protein RO3G_08519                         171   1e-48    
gb|KFP57700.1|  60S ribosomal protein L13                               170   1e-48    
gb|KFQ65799.1|  60S ribosomal protein L13                               170   1e-48    
ref|XP_009888632.1|  PREDICTED: 60S ribosomal protein L13               169   1e-48    
emb|CCD74666.1|  putative 60s ribosomal protein L13 (BBC1 protein...    170   1e-48    
ref|XP_009572320.1|  PREDICTED: 60S ribosomal protein L13               170   1e-48    
emb|CDQ62370.1|  unnamed protein product                                171   1e-48    
gb|ABM55560.1|  putative ribosomal protein L13                          171   1e-48    
gb|AII97595.1|  BLTX199                                                 170   1e-48    
gb|KGL81026.1|  60S ribosomal protein L13                               169   2e-48    
ref|XP_008872563.1|  hypothetical protein H310_08544                    170   2e-48    
ref|XP_010306772.1|  PREDICTED: 60S ribosomal protein L13               169   2e-48    
ref|XP_009632868.1|  PREDICTED: 60S ribosomal protein L13               170   2e-48    
gb|KFH62789.1|  50S ribosomal protein L13e                              170   2e-48    
gb|EIE79206.1|  50S ribosomal protein L13e                              170   2e-48    
ref|XP_002710580.1|  PREDICTED: 60S ribosomal protein L13               170   2e-48    
gb|EIE85002.1|  50S ribosomal protein L13e                              170   3e-48    
ref|XP_005504901.1|  PREDICTED: 60S ribosomal protein L13               168   3e-48    
ref|XP_004705772.1|  PREDICTED: 60S ribosomal protein L13-like is...    169   4e-48    
ref|XP_005235556.1|  PREDICTED: 60S ribosomal protein L13               168   4e-48    
ref|XP_009934069.1|  PREDICTED: 60S ribosomal protein L13               169   4e-48    
ref|XP_005432355.1|  PREDICTED: 60S ribosomal protein L13               168   4e-48    
ref|XP_010006756.1|  PREDICTED: 60S ribosomal protein L13               168   4e-48    
ref|XP_009318177.1|  PREDICTED: 60S ribosomal protein L13               169   4e-48    
ref|XP_010218334.1|  PREDICTED: 60S ribosomal protein L13               169   4e-48    
ref|XP_010021886.1|  PREDICTED: 60S ribosomal protein L13               168   5e-48    
gb|KFO31870.1|  Paraplegin                                              181   5e-48    
emb|CEP20112.1|  hypothetical protein                                   169   5e-48    
gb|ETN63436.1|  Ribosomal protein L13                                   169   6e-48    
ref|XP_008063583.1|  PREDICTED: 60S ribosomal protein L13               169   7e-48    
ref|XP_004639156.1|  PREDICTED: 60S ribosomal protein L13-like is...    168   7e-48    
gb|KFQ45063.1|  60S ribosomal protein L13                               168   8e-48    
emb|CAX77649.1|  putative ribosomal protein L13                         168   8e-48    
emb|CCD27769.1|  ribosomal protein l13                                  168   8e-48    
emb|CAX71653.1|  putative ribosomal protein L13                         168   8e-48    
emb|CAX71654.1|  putative ribosomal protein L13                         168   8e-48    
emb|CAX77642.1|  putative ribosomal protein L13                         168   8e-48    
gb|EIE87092.1|  hypothetical protein RO3G_11803                         168   1e-47    
gb|KGB37304.1|  60S ribosomal protein L13                               167   2e-47    
ref|XP_009839630.1|  hypothetical protein H257_13700                    167   3e-47    
ref|XP_006677706.1|  hypothetical protein BATDEDRAFT_6028               167   3e-47    
gb|EPQ05393.1|  60S ribosomal protein L13                               168   3e-47    
ref|XP_005537717.1|  60S ribosomal protein L13                          167   4e-47    
ref|XP_006055879.1|  PREDICTED: 60S ribosomal protein L13-like is...    166   4e-47    
gb|EYB89261.1|  hypothetical protein Y032_0234g3156                     166   4e-47    
ref|XP_004639245.1|  PREDICTED: 60S ribosomal protein L13-like is...    166   5e-47    
gb|EHH31953.1|  hypothetical protein EGK_13125                          165   5e-47    
gb|ABX75438.1|  60S ribosomal protein l13                               166   5e-47    
emb|CBY23126.1|  unnamed protein product                                166   6e-47    
gb|AAF97844.1|  breast basic conserved protein                          165   1e-46    
ref|XP_008552884.1|  PREDICTED: 60S ribosomal protein L13-like          166   1e-46    
sp|Q95043.1|RL13_SCHMA  RecName: Full=60S ribosomal protein L13; ...    164   1e-46    
gb|AAO53449.2|  breast basic conserved protein                          165   1e-46    
ref|XP_011301440.1|  PREDICTED: 60S ribosomal protein L13               165   2e-46    
ref|XP_001607329.1|  PREDICTED: 60S ribosomal protein L13               165   2e-46    
gb|AAH85493.1|  Rpl13 protein                                           165   2e-46    
ref|XP_004878313.1|  PREDICTED: 60S ribosomal protein L13 isoform X4    164   2e-46    
ref|XP_009013211.1|  hypothetical protein HELRODRAFT_105042             165   2e-46    
gb|KFP28000.1|  60S ribosomal protein L13                               163   3e-46    
ref|XP_010203210.1|  PREDICTED: 60S ribosomal protein L13               163   3e-46    
ref|XP_004339252.1|  ribosomal protein L13e, putative                   164   4e-46    
gb|ERG83884.1|  60s ribosomal protein l13                               164   4e-46    
ref|XP_004639497.1|  PREDICTED: 60S ribosomal protein L13-like is...    163   5e-46    
emb|CCG83902.1|  protein of unknown function                            164   6e-46    
ref|XP_008613112.1|  50S ribosomal protein L13e                         163   7e-46    
gb|AEL28872.1|  ribosomal protein L13                                   164   7e-46    
ref|XP_321255.2|  AGAP001805-PA                                         164   7e-46    
gb|KDO24006.1|  50S ribosomal protein L13e                              163   7e-46    
ref|XP_008973172.1|  PREDICTED: 60S ribosomal protein L13               164   7e-46    
tpg|DAA32723.1|  TPA: ribosomal protein L13-like                        163   7e-46    
ref|XP_003400747.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     164   8e-46    
emb|CDW83808.1|  60s ribosomal protein l13                              163   8e-46    
emb|CDS10828.1|  Putative 60S ribosomal protein L13                     163   9e-46    
emb|CDS05093.1|  Putative 60S ribosomal protein L13                     163   9e-46    
gb|KIH58992.1|  ribosomal protein L13e                                  163   1e-45    
dbj|BAJ99030.1|  predicted protein                                      163   1e-45    
ref|NP_001156206.1|  ribosomal protein L13-like                         163   1e-45    
ref|XP_008187640.1|  PREDICTED: ribosomal protein L13-like isofor...    163   1e-45    
gb|ACY95361.1|  ribosomal protein L13                                   163   1e-45    



>ref|XP_011084605.1| PREDICTED: 60S ribosomal protein L13-1 [Sesamum indicum]
Length=207

 Score =   312 bits (799),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRRRN SLEG Q NVQRLKTYKAKLVVFPRR RKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLEGFQTNVQRLKTYKAKLVVFPRRVRKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV+GPYLPI+REK +VE VKVT+DMKSFKAYDKLRLERTNERH+G
Sbjct  134  KAGDSTPEELATATQVSGPYLPIVREKPTVELVKVTEDMKSFKAYDKLRLERTNERHVG  192



>ref|XP_011075827.1| PREDICTED: 60S ribosomal protein L13-1-like [Sesamum indicum]
Length=207

 Score =   308 bits (788),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRRRN SLEG Q NVQRLKTYKAKLVVFPRR RKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLEGFQTNVQRLKTYKAKLVVFPRRVRKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV+GPYLPI+REK +VE VKVTD+MKSFKAY+KLRLERTNERH+G
Sbjct  134  KAGDSTAEELATATQVSGPYLPIVREKPTVELVKVTDEMKSFKAYNKLRLERTNERHVG  192



>ref|XP_004146887.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146888.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004164245.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004164246.1| PREDICTED: 60S ribosomal protein L13-2-like isoform 2 [Cucumis 
sativus]
 gb|KGN53190.1| hypothetical protein Csa_4G025200 [Cucumis sativus]
Length=206

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  13   RKHWQNYVRTWFNQPARKTRRRNARQEKAVKNFPRPTAGPLRPVVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRRRN SLE LQANVQRLKTYKAK+VVFPRRARKF
Sbjct  73   GFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESLQANVQRLKTYKAKVVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV GPYLPI REKASVE VKVT++MKSFKAYDKLR+ERTN RH+G
Sbjct  133  KAGDSTPEELANATQVQGPYLPIGREKASVELVKVTEEMKSFKAYDKLRVERTNARHVG  191



>gb|KJB08613.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
 gb|KJB08614.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
 gb|KJB08615.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
Length=207

 Score =   304 bits (779),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHGQTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EELATATQV GPY+PI REK SVE VKVTDDMKSFKAY+KLR+ERTNERHIG
Sbjct  134  KAGDSPAEELATATQVQGPYMPISREKPSVELVKVTDDMKSFKAYNKLRVERTNERHIG  192



>ref|XP_008453835.1| PREDICTED: 60S ribosomal protein L13-3 [Cucumis melo]
Length=206

 Score =   304 bits (778),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  13   RKHWQNYVRTWFNQPARKTRRRNARQEKAVKNFPRPTAGPLRPVVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKAK+VVFPRRARKF
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKVVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV GPYLPI REKASVE VKVT+DMKSFKAYDKLR+ER N RH+G
Sbjct  133  KAGDSTPEELANATQVQGPYLPIGREKASVELVKVTEDMKSFKAYDKLRVERMNARHVG  191



>gb|KDP21801.1| hypothetical protein JCGZ_00588 [Jatropha curcas]
Length=206

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQQKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ N+QRLKTYKAKLVVFPRRARKF
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNIQRLKTYKAKLVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G Y+PI+REK SV+ VKVT++MKSFKAYDKLR+ER NERHIG
Sbjct  133  KAGDSAPEELATATQVQGQYMPIVREKPSVDLVKVTEEMKSFKAYDKLRVERMNERHIG  191



>emb|CDP17844.1| unnamed protein product [Coffea canephora]
 emb|CDP08129.1| unnamed protein product [Coffea canephora]
 emb|CDP04953.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKA KIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRNARQKKAAKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKL PTIG+SVDHRR+N SLEG QANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFTLEELKAAGIPKKLGPTIGVSVDHRRKNRSLEGFQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G YLPI+ EK  VE VKVT++MKSFKAYDKLRLERTNERHIG
Sbjct  134  KAGDSAPEELATATQVQGAYLPIVCEKPCVELVKVTEEMKSFKAYDKLRLERTNERHIG  192



>gb|KHG24237.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR +RQKKAV+IFPRPTAG LRPIVHGQTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKARRRISRQKKAVRIFPRPTAGPLRPIVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV GPY+ I REK SVE VKVT+DMKSFKAY+KLR+ER NERHIG
Sbjct  134  KAGDSTAEELATATQVQGPYMRISREKPSVELVKVTEDMKSFKAYNKLRVERANERHIG  192



>gb|KDP38855.1| hypothetical protein JCGZ_05012 [Jatropha curcas]
Length=206

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G YLPI RE+ S+E VKVT++MKSFKAYDKLR+ER N RHIG
Sbjct  133  KAGDSAPEELATATQVQGEYLPIARERPSIELVKVTEEMKSFKAYDKLRVERMNTRHIG  191



>ref|XP_008238048.1| PREDICTED: 60S ribosomal protein L13-1 [Prunus mume]
Length=207

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPT+G LRPIVHGQTLKYNMKVR+GR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRKARQEKAVKIFPRPTSGPLRPIVHGQTLKYNMKVRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEELA ATQ+ GPY+PI+REK +VE VKVT+DMK+FKAYDKLR+ER NERH+G
Sbjct  134  KAGDSSPEELANATQIQGPYMPIVREKPTVELVKVTNDMKAFKAYDKLRVERMNERHVG  192



>gb|KHG03134.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHGQTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGTLRPIVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFP+RARKF
Sbjct  74   GFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYKAKLVVFPKRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV G Y+PI REK SVE VKVT++MKSFKAY+KLR+ERTNERHIG
Sbjct  134  KAGDSTAEELATATQVQGSYMPISREKPSVELVKVTEEMKSFKAYNKLRVERTNERHIG  192



>gb|KJB42885.1| hypothetical protein B456_007G172400 [Gossypium raimondii]
 gb|KJB42886.1| hypothetical protein B456_007G172400 [Gossypium raimondii]
Length=207

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHGQTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGPLRPIVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV G Y+PI REK SVE VKVT++MKSFKAY+KLR+ERTNERHIG
Sbjct  134  KAGDSTAEELATATQVQGSYMPISREKPSVELVKVTEEMKSFKAYNKLRVERTNERHIG  192



>ref|XP_007158142.1| hypothetical protein PHAVU_002G127900g [Phaseolus vulgaris]
 gb|ESW30136.1| hypothetical protein PHAVU_002G127900g [Phaseolus vulgaris]
Length=207

 Score =   299 bits (766),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRRRN SLE +Q+NVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESMQSNVQRLKTYKAKLVVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI REKA VE VK+TDDMK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIAREKAPVELVKITDDMKAFKAYYKLRLERTNKRHFG  192



>gb|AGV54370.1| 60S ribosomal protein L13-2-like protein [Phaseolus vulgaris]
Length=207

 Score =   299 bits (766),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRRRN SLE +Q+NVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESMQSNVQRLKTYKAKLVVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI REKA VE VK+TDDMK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIAREKAPVELVKITDDMKAFKAYYKLRLERTNKRHFG  192



>ref|XP_007209605.1| hypothetical protein PRUPE_ppa011506mg [Prunus persica]
 gb|EMJ10804.1| hypothetical protein PRUPE_ppa011506mg [Prunus persica]
Length=207

 Score =   299 bits (765),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPT+G LRPIVHGQTLKYNMKVR+GR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRKARQEKAVKIFPRPTSGPLRPIVHGQTLKYNMKVRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFTLEELKTAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEELA ATQ+ GPY+PI+REK +VE VKVT+DMK+FKAYDKLR+ER NERH+G
Sbjct  134  KAGDSSPEELANATQIQGPYMPIVREKPTVELVKVTNDMKAFKAYDKLRVERMNERHVG  192



>ref|XP_006478303.1| PREDICTED: 60S ribosomal protein L13-1-like [Citrus sinensis]
Length=206

 Score =   298 bits (764),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMK+RAGR
Sbjct  13   KKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKLRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRRARKF
Sbjct  73   GFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI  EK +VE VKVT DMKSFKAYDKLR+ER NERH G
Sbjct  133  KAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKLRIERVNERHFG  191



>ref|XP_007049063.1| 60S ribosomal protein L13 [Theobroma cacao]
 gb|EOX93220.1| 60S ribosomal protein L13 [Theobroma cacao]
Length=207

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHGQTLKYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGPLRPIVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFTLEELKAAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV GPY+PI  EK SVE VKVT++MKSFKAY+KLR+ER NERHIG
Sbjct  134  KAGDSTAEELATATQVQGPYMPISLEKPSVELVKVTEEMKSFKAYNKLRVERMNERHIG  192



>ref|XP_006441816.1| hypothetical protein CICLE_v10022283mg [Citrus clementina]
 gb|ESR55056.1| hypothetical protein CICLE_v10022283mg [Citrus clementina]
Length=206

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMK+RAGR
Sbjct  13   KKHWQNYVKTWFNQPARKSRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKLRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRRARKF
Sbjct  73   GFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI  E+ +VE VKVT DMKSFKAYDKLR+ER NERH G
Sbjct  133  KAGDSAPEELATATQVQGPYMPIAPERPTVELVKVTQDMKSFKAYDKLRIERVNERHFG  191



>ref|XP_010269352.1| PREDICTED: 60S ribosomal protein L13-1-like [Nelumbo nucifera]
Length=207

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV GPY+ I REK S+E VKVTDDMKSFKAY KLR+ER N+R +G
Sbjct  134  KAGDSSAEELATATQVQGPYMCIEREKPSIELVKVTDDMKSFKAYAKLRVERMNQRQVG  192



>ref|XP_006451725.1| hypothetical protein CICLE_v10009507mg [Citrus clementina]
 gb|ESR64965.1| hypothetical protein CICLE_v10009507mg [Citrus clementina]
Length=206

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMK+RAGR
Sbjct  13   KKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKLRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRRARKF
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI  EK +V+ VKVT DMKSFKAYDKLR+ER NERH G
Sbjct  133  KAGDSAPEELATATQVQGPYMPITLEKPTVDLVKVTQDMKSFKAYDKLRIERANERHFG  191



>gb|KJB22724.1| hypothetical protein B456_004G062900 [Gossypium raimondii]
 gb|KJB22725.1| hypothetical protein B456_004G062900 [Gossypium raimondii]
Length=207

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHGQTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFTLEELKAAGISKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKS  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQ+ GPY+PI REK SVE VKVT++MKSFKAY+KLR+ERTN RHIG
Sbjct  134  KAGDSTAEELATATQMQGPYMPIYREKPSVELVKVTEEMKSFKAYNKLRVERTNARHIG  192



>ref|XP_003626150.1| 60S ribosomal protein L13 [Medicago truncatula]
 gb|AES82368.1| 60S ribosomal L13-like protein [Medicago truncatula]
 gb|AFK42534.1| unknown [Medicago truncatula]
Length=207

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTQKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYKLRLERTNKRHLG  192



>ref|XP_006485662.1| PREDICTED: 60S ribosomal protein L13-1-like [Citrus sinensis]
 gb|KDO48329.1| hypothetical protein CISIN_1g028624mg [Citrus sinensis]
Length=206

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMK+RAGR
Sbjct  13   KKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKLRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRRARKF
Sbjct  73   GFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI  EK +V+ VKVT DMKSFKAYDKLR+ER NERH G
Sbjct  133  KAGDSAPEELATATQVQGPYMPITLEKPTVDLVKVTQDMKSFKAYDKLRIERANERHFG  191



>gb|ACJ83949.1| unknown [Medicago truncatula]
 gb|AFK42168.1| unknown [Medicago truncatula]
 gb|KEH40126.1| 60S ribosomal L13-like protein [Medicago truncatula]
Length=207

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTAKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+FKAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYKLRLERTNKRHLG  192



>ref|XP_002529265.1| 60S ribosomal protein L13, putative [Ricinus communis]
 gb|EEF33097.1| 60S ribosomal protein L13, putative [Ricinus communis]
Length=207

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMK+RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKLRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKS  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G Y+PI+REK SVE VKVT++MKSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSAPEELATATQVQGKYMPIVREKPSVELVKVTEEMKSFKAYDKLRVERMNQRHLG  192



>ref|XP_011028035.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011028036.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEG+QAN++RL TYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGIQANIRRLNTYKAKLVVFPRRARKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G +LPI+REKASVE VKVT++MKSFKAYDKLR ERTN RH+G
Sbjct  134  KAGDSAPEELATATQVQGQFLPIVREKASVELVKVTEEMKSFKAYDKLRAERTNARHVG  192



>ref|XP_007218412.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 ref|XP_007218413.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 ref|XP_007218414.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19611.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19612.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19613.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
Length=207

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMK+RAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKIRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA KF
Sbjct  74   GFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAGKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELA ATQ+ G YLPI REK SVE VKVTDD+KSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSAPEELANATQLQGSYLPIAREKPSVELVKVTDDLKSFKAYDKLRVERMNQRHVG  192



>ref|XP_009795347.1| PREDICTED: 60S ribosomal protein L13-1 [Nicotiana sylvestris]
Length=206

 Score =   297 bits (760),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVR+GR
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGTLRPIVHGQTLKYNMKVRSGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLVVFPRRARK 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVVFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV+G Y+PI REK SV+ VKVT++MKSF AY KLR+ERTNERHIG
Sbjct  133  KAGDSAPEELATATQVHGAYMPIAREKPSVDLVKVTEEMKSFNAYGKLRVERTNERHIG  191



>ref|XP_002304378.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|ABK93509.1| unknown [Populus trichocarpa]
 gb|EEE79357.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEG+QAN++RL TYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGIQANIRRLNTYKAKLVVFPRRARKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G ++PI+REKASVE VKVT++MKSFKAYDKLR ERTN RH+G
Sbjct  134  KAGDSAPEELATATQVQGQFMPIVREKASVELVKVTEEMKSFKAYDKLRAERTNARHVG  192



>ref|XP_006368290.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|ERP64859.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   296 bits (759),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVVFPRRARKS  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G ++PI+REK SVE VKVT++MKSF+AYDKLR ERTN RH+G
Sbjct  134  KAGDSAPEELATATQVQGHFMPIVREKPSVELVKVTEEMKSFRAYDKLRAERTNARHVG  192



>ref|XP_011023520.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011023521.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011013522.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011013523.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G  +PI+ EK SVE VKVT++MKSF+AYDKLR+ERT+ RH+G
Sbjct  134  KAGDSAPEELATATQVQGQIMPIVLEKPSVELVKVTEEMKSFRAYDKLRVERTSARHVG  192



>emb|CDP19062.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAV IFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRNARQKKAVAIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI  KLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRA+K 
Sbjct  74   GFSLEELKAAGIPTKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRAKKI  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K+GDS+PEELATATQV G Y+PI REK +VE VKVT +MKSFKAYDKLRLERTN RH+G
Sbjct  134  KSGDSSPEELATATQVQGSYMPITREKPTVELVKVTQEMKSFKAYDKLRLERTNARHVG  192



>ref|XP_003522855.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X1 [Glycine 
max]
 ref|XP_006578380.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X2 [Glycine 
max]
 gb|KHN06098.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   296 bits (759),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYKAKLVVFPRRA+K 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRAQKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G +LPI+REK +VE VKVTDDMK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGSFLPIVREKPTVELVKVTDDMKAFKAYYKLRLERTNKRHYG  192



>ref|XP_011018407.1| PREDICTED: 60S ribosomal protein L13-1 [Populus euphratica]
Length=207

 Score =   296 bits (758),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVVFPRRARKS  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G ++PI+REK SVE VKVT +MKSFKAYDKLR ERTN RH+G
Sbjct  134  KAGDSAPEELATATQVQGHFMPIVREKPSVELVKVTAEMKSFKAYDKLRAERTNARHVG  192



>gb|KHG21579.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   296 bits (758),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHGQTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFTLEELKAAGISKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKS  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV GPY+PI REK SVE VKVT++MKSFKAY+KLR+ERTN R+IG
Sbjct  134  KAGDSTAEELATATQVQGPYMPISREKPSVELVKVTEEMKSFKAYNKLRVERTNARYIG  192



>gb|AFK45847.1| unknown [Medicago truncatula]
 gb|AES95552.2| 60S ribosomal L13-like protein [Medicago truncatula]
Length=207

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTQKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+ EK SVE VK+TD+MK+FKAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYKLRLERTNKRHLG  192



>ref|XP_002519996.1| 60S ribosomal protein L13, putative [Ricinus communis]
 gb|EEF42320.1| 60S ribosomal protein L13, putative [Ricinus communis]
Length=207

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPTAG LRPIVHGQTLKYNMK+RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKLRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EELATATQV G Y+PI REK SVE VKVT++MKSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSAAEELATATQVQGQYMPIAREKPSVELVKVTEEMKSFKAYDKLRVERMNQRHLG  192



>ref|XP_004245965.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum lycopersicum]
Length=206

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPRRA+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRRAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV GPYLPI RE+ +V+FVKVTD+MKSFKAY KLR+ERTN RH+G
Sbjct  133  KAGDSSAEELATATQVQGPYLPITREQPAVDFVKVTDEMKSFKAYGKLRIERTNARHMG  191



>ref|XP_009619310.1| PREDICTED: 60S ribosomal protein L13-1 [Nicotiana tomentosiformis]
Length=206

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVR+GR
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGTLRPIVHGQTLKYNMKVRSGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLVVFPRRAR+ 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVVFPRRARQV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV+G Y+PI REK SV+ VKVT++MKSF AY KLR+ERTNERHIG
Sbjct  133  KAGDSAPEELATATQVHGAYMPIAREKPSVDLVKVTEEMKSFNAYGKLRVERTNERHIG  191



>gb|AFK47578.1| unknown [Medicago truncatula]
Length=207

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTAKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+ KAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKALKAYYKLRLERTNKRHLG  192



>gb|AAQ96375.1| 60S ribosomal protein L13 [Solanum palustre]
Length=200

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPRRA+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRRAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV GPYLPI RE+ +V+FVKVTD+MKSF AY KLR+ERTN RH+G
Sbjct  133  KAGDSSAEELATATQVQGPYLPITREQPAVDFVKVTDEMKSFXAYGKLRIERTNARHVG  191



>ref|XP_010243468.1| PREDICTED: 60S ribosomal protein L13-1 [Nelumbo nucifera]
Length=207

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV G Y+PI REK S+E VKVTD+MKSFKAY KLR+ER N R +G
Sbjct  134  KAGDSSAEELATATQVQGAYMPIEREKPSIELVKVTDEMKSFKAYAKLRVERMNTRQVG  192



>gb|AFK39980.1| unknown [Lotus japonicus]
Length=207

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRP+VHGQTLKYNMKVRAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGSLRPMVHGQTLKYNMKVRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI +KLAPTIGISVDHRRRN SLEGLQANV RLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPRKLAPTIGISVDHRRRNRSLEGLQANVHRLKTYKAKLVVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
            KAGDSTPEELA ATQV G YLPI+RE+ SVE VKVTD+MK FKAY KLRLERTN+RH
Sbjct  134  KAGDSTPEELANATQVQGTYLPIVRERPSVELVKVTDEMKEFKAYYKLRLERTNKRH  190



>ref|XP_008234598.1| PREDICTED: 60S ribosomal protein L13-3-like [Prunus mume]
 ref|XP_008234599.1| PREDICTED: 60S ribosomal protein L13-3-like [Prunus mume]
Length=207

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMK+RAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKIRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA KF
Sbjct  74   GFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAGKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELA ATQ+ G YLPI REK SVE VKVT+D+KSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSAPEELANATQLQGSYLPIAREKPSVELVKVTEDLKSFKAYDKLRVERMNQRHVG  192



>ref|XP_008467320.1| PREDICTED: 60S ribosomal protein L13-3-like [Cucumis melo]
Length=206

 Score =   295 bits (755),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  13   RKHWQNYVRTWFNQPARKTRRRNARQEKAVKAFPRPTAGPLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KK APTIGI+VDHRRRN SLE LQANVQRLKTYKAK+VVFPRRARKF
Sbjct  73   GFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKVVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI  EK SVE VKVT+DMKSFKAYDKLR+ER N RH+G
Sbjct  133  KAGDSTPEELATATQVQGSYMPIGLEKPSVELVKVTEDMKSFKAYDKLRVERANARHVG  191



>ref|XP_002319032.1| hypothetical protein POPTR_0013s02860g [Populus trichocarpa]
 ref|XP_006375784.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|EEE94955.1| hypothetical protein POPTR_0013s02860g [Populus trichocarpa]
 gb|ERP53581.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   295 bits (755),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G  +PI+ EK  VE VKVT++MKSF+AYDKLR+ERT+ RH+G
Sbjct  134  KAGDSAPEELATATQVQGQIMPIVLEKPCVELVKVTEEMKSFRAYDKLRVERTSARHVG  192



>emb|CAN80613.1| hypothetical protein VITISV_025451 [Vitis vinifera]
Length=207

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRP+VHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTVGPLRPLVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEEL TATQV G Y+P+++EK  VE VKVTD+MKSFKAY KLR+ER NERH+G
Sbjct  134  KAGDSAPEELGTATQVQGQYMPVVQEKPXVELVKVTDEMKSFKAYGKLRVERMNERHVG  192



>gb|ACJ83987.1| unknown [Medicago truncatula]
Length=207

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTAKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKT KAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTCKAKLVVFPRRARKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+FKAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYKLRLERTNKRHLG  192



>ref|XP_004143667.1| PREDICTED: 60S ribosomal protein L13-1-like [Cucumis sativus]
 ref|XP_004158113.1| PREDICTED: 60S ribosomal protein L13-1-like [Cucumis sativus]
 gb|KGN50340.1| hypothetical protein Csa_5G168780 [Cucumis sativus]
Length=206

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  13   RKHWQNYVRTWFNQPARKTRRRNARQEKAVKAFPRPTAGPLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KK APTIGI+VDHRRRN SLE LQANVQRLKTYKAK+VVFPRRARKF
Sbjct  73   GFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKVVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI  EK SVE VK+T+DMKSFKAYDKLR+ER N RH+G
Sbjct  133  KAGDSTPEELATATQVQGSYMPIGLEKPSVELVKITEDMKSFKAYDKLRVERANARHVG  191



>ref|XP_002322840.2| hypothetical protein POPTR_0016s08310g [Populus trichocarpa]
 gb|EEF04601.2| hypothetical protein POPTR_0016s08310g [Populus trichocarpa]
Length=207

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYKAKLVVFPR ARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNHSLEGLQANIQRLKTYKAKLVVFPRHARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G  +PI  EK SVE VKVT++MKSFKAYDKLR+ERTN RH+G
Sbjct  134  KAGDSAPEELATATQVQGHIMPIACEKPSVELVKVTEEMKSFKAYDKLRVERTNARHVG  192



>ref|XP_010054042.1| PREDICTED: 60S ribosomal protein L13-2 [Eucalyptus grandis]
 gb|KCW78426.1| hypothetical protein EUGRSUZ_D02588 [Eucalyptus grandis]
Length=206

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQTLKYNMKVRAG+
Sbjct  13   RKHWQNYVKTWFNQPARKSRRRQARQQKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  73   GFSLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA+ATQV G Y+PI+REK +VE VKVT++MKSF AY KLR+ER N RH+G
Sbjct  133  KAGDSTAEELASATQVQGSYMPIVREKPAVELVKVTEEMKSFNAYAKLRVERMNTRHVG  191



>gb|AFK36916.1| unknown [Medicago truncatula]
Length=207

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTAKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK +V  VKVTD+MK+FKAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVREKPTVGLVKVTDEMKAFKAYYKLRLERTNKRHLG  192



>ref|XP_002274000.1| PREDICTED: 60S ribosomal protein L13-1 [Vitis vinifera]
 emb|CBI29087.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRP+VHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTVGPLRPLVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEEL TATQV G Y+P+++EK  VE VKVTD+MKSFKAY KLR+ER NERH+G
Sbjct  134  KAGDSAPEELGTATQVQGQYMPVVQEKPVVELVKVTDEMKSFKAYGKLRVERMNERHVG  192



>ref|XP_003612594.1| 60S ribosomal protein L13 [Medicago truncatula]
Length=240

 Score =   295 bits (756),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  47   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTQKYNMKLRAGK  106

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  107  GFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKV  166

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+ EK SVE VK+TD+MK+FKAY KLRLERTN+RH+G
Sbjct  167  KAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYKLRLERTNKRHLG  225



>ref|XP_010503548.1| PREDICTED: 60S ribosomal protein L13-1 [Camelina sativa]
 ref|XP_010515238.1| PREDICTED: 60S ribosomal protein L13-1 [Camelina sativa]
Length=206

 Score =   293 bits (751),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI+REK ++E VK+T DMKSFKAYDKLRLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVREKPTMELVKLTSDMKSFKAYDKLRLERTNKRHAG  191



>emb|CAN84167.1| hypothetical protein VITISV_018882 [Vitis vinifera]
Length=207

 Score =   293 bits (751),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKAKLVVFPRR RKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKLVVFPRRTRKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV G Y+PI+REK +VE VKVTD+MKSFKAY KLR+ER N+RH+G
Sbjct  134  KAGDSSVEELATATQVQGLYMPIVREKPTVELVKVTDEMKSFKAYGKLRVERMNQRHVG  192



>ref|XP_011048445.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011048446.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   293 bits (751),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYKAKLVVFPRRA KF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNHSLEGLQANIQRLKTYKAKLVVFPRRAHKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G  +PI  EK SVE VKVT++MKSFKAYDKLR ERTN RH+G
Sbjct  134  KAGDSAPEELATATQVQGHIMPIACEKPSVELVKVTEEMKSFKAYDKLRAERTNARHVG  192



>ref|XP_004499145.1| PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum]
Length=207

 Score =   293 bits (751),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPLVHGQTAKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI++DHRRRN SLEGLQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAIDHRRRNRSLEGLQANVQRLKTYKAKLVVFPRRARKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLP++REK +VE VK+TD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGSYLPVVREKPTVELVKITDEMKAFKAYYKLRLERTNKRHYG  192



>ref|NP_001275203.1| 60S ribosomal protein L13 [Solanum tuberosum]
 ref|XP_006364452.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum tuberosum]
 gb|ABA46764.1| unknown [Solanum tuberosum]
 gb|AFW90558.1| 60S ribosomal protein L13 [Solanum tuberosum]
Length=206

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPRRA+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRRAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV G YLPI RE+ +V+FVKVTD+MKSFKAY KLR+ERTN RH+G
Sbjct  133  KAGDSSAEELATATQVQGSYLPITREQPAVDFVKVTDEMKSFKAYGKLRIERTNARHMG  191



>gb|KHG20106.1| 60S ribosomal L13-1 [Gossypium arboreum]
Length=207

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRP+VHGQTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPVVHGQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPR ARKF
Sbjct  74   GFTLEELKAAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRCARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV G Y+PI REK SV+ VKVT++MKSFKAY+KLR+ER NERHIG
Sbjct  134  KAGDSTAEELATATQVQGSYMPISREKPSVDLVKVTEEMKSFKAYNKLRVERMNERHIG  192



>ref|XP_010269338.1| PREDICTED: 60S ribosomal protein L13-1-like [Nelumbo nucifera]
Length=207

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKAKLVVFPRRA KF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKAKLVVFPRRACKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV G Y+PI REK SVE VKVTDDMKSFKAY KLR+ER N+R +G
Sbjct  134  KAGDSSAEELATATQVQGLYMPIEREKPSVELVKVTDDMKSFKAYAKLRVERMNQRQVG  192



>ref|XP_003534321.1| PREDICTED: 60S ribosomal protein L13-1 isoformX1 [Glycine max]
 ref|XP_006587640.1| PREDICTED: 60S ribosomal protein L13-1 isoform X2 [Glycine max]
 gb|KHN11825.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   293 bits (750),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVR GR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRGGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYKAKLVVFPRRA K 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G +LPI+REK +VE VKVTDDMK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGAFLPIVREKPTVELVKVTDDMKAFKAYYKLRLERTNKRHHG  192



>ref|XP_009348808.1| PREDICTED: 60S ribosomal protein L13-1-like [Pyrus x bretschneideri]
Length=207

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA++F
Sbjct  74   GFTLEELKSAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKQF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EE+A ATQ++GPYLPI REK +VE VKVTD++KSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSPAEEIANATQLHGPYLPIAREKPTVELVKVTDELKSFKAYDKLRVERMNKRHVG  192



>ref|XP_003547825.1| PREDICTED: 60S ribosomal protein L13-1-like [Glycine max]
 gb|KHM99443.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVFPRRA K 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSSLEELANATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERTNKRHHG  192



>gb|AFK40501.1| unknown [Medicago truncatula]
Length=207

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQK+AVKIFPRPT G LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKRAVKIFPRPTVGPLRPIVHGQTQKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYKAKL VFPRRARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYKAKLAVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+ EK SVE VK+TD+MK+FKAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYKLRLERTNKRHLG  192



>ref|XP_009382822.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK R+GR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRR RKF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRTRKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEELATATQV GPYLPI+RE+ SVE VKVTD+MKSFKAY KLR+ER NER +G
Sbjct  134  KAGDSSPEELATATQVQGPYLPIVREQPSVELVKVTDEMKSFKAYAKLRVERMNERQVG  192



>ref|XP_002277094.1| PREDICTED: 60S ribosomal protein L13-1 [Vitis vinifera]
 emb|CBI33499.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK AGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKAKLVVFPRR RKF
Sbjct  74   GFSLEELKVAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKLVVFPRRTRKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV G Y+PI+REK +VE VKVTD+MKSFKAY KLR+ER N+RH+G
Sbjct  134  KAGDSSVEELATATQVQGLYMPIVREKPTVELVKVTDEMKSFKAYGKLRVERMNQRHVG  192



>ref|XP_008369022.1| PREDICTED: 60S ribosomal protein L13-1-like [Malus domestica]
Length=207

 Score =   291 bits (746),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA++F
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKQF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EELA ATQ++ PYLPI REK +VE VKVTD++KSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSPAEELANATQLHAPYLPIAREKPTVELVKVTDELKSFKAYDKLRVERMNKRHVG  192



>gb|ACJ86119.1| unknown [Medicago truncatula]
Length=207

 Score =   291 bits (745),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKH QNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHSQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTAKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKL+VFPRRARK 
Sbjct  74   GFSLEELKTAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLIVFPRRARKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+FKAY KLRLERTN+RH+G
Sbjct  134  KAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYKLRLERTNKRHLG  192



>gb|AES82369.2| 60S ribosomal L13-like protein [Medicago truncatula]
Length=205

 Score =   291 bits (744),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 2/179 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMK+RAG+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTQKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRAR  
Sbjct  74   GFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAR--  131

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY KLRLERTN+RH+G
Sbjct  132  KAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYKLRLERTNKRHLG  190



>ref|XP_006394649.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 ref|XP_006394650.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 ref|XP_006394651.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31935.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31936.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31937.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
Length=206

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMK+RAG+
Sbjct  13   RKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKLRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAA I KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+RK 
Sbjct  73   GFTLEELKAACIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI REKA ++ VKVT DMK+FKAYDK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYMPIAREKAPMDLVKVTADMKAFKAYDKIRLERTNQRHAG  191



>ref|XP_010940804.1| PREDICTED: 60S ribosomal protein L13-1 [Elaeis guineensis]
 ref|XP_010940805.1| PREDICTED: 60S ribosomal protein L13-1 [Elaeis guineensis]
Length=207

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARKF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+P++REK +VE VKVTD+MKSF+AY KLR+ER NER +G
Sbjct  134  KAGDSAPEELATATQVQGPYMPVVREKPTVELVKVTDEMKSFRAYAKLRVERMNERQVG  192



>ref|NP_001276322.1| 60S ribosomal protein L13-1-like [Glycine max]
 gb|ACU14467.1| unknown [Glycine max]
Length=231

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVFPRRA K 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSSLEELANATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERTNKRHHG  192



>gb|AFK44824.1| unknown [Lotus japonicus]
Length=207

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFP+PTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPKPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAG+ +KLAPTIGISVDHRRRN SLE LQANVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAAGVPRKLAPTIGISVDHRRRNRSLESLQANVQRLKTYKAKLVVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEE A ATQV G YLPI++E+  VE VK+TD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSSPEERANATQVQGQYLPIVKERPPVELVKITDEMKAFKAYYKLRLERTNQRHFG  192



>ref|XP_010056172.1| PREDICTED: 60S ribosomal protein L13-1-like [Eucalyptus grandis]
 ref|XP_010056173.1| PREDICTED: 60S ribosomal protein L13-1-like [Eucalyptus grandis]
 gb|KCW72772.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72773.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72774.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72775.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
Length=207

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRP+VHGQT+KYNMKVRAG+
Sbjct  14   RKHWQNYVKTWFNQPARKARRRLARQKKAVRIFPRPTAGPLRPVVHGQTVKYNMKVRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTY+AKLVVFPR ARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANMQRLKTYRAKLVVFPRHARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MKSF AY KLR+ER N RH+G
Sbjct  134  KAGDSTPEELANATQVQGTYLPIVREKPAVELVKVTDEMKSFNAYAKLRVERMNIRHVG  192



>gb|KHN27522.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVR+GR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKL PTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVFPRRA K 
Sbjct  74   GFSLEELKAAGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G +LPI+REK +V+ +KVTD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGSFLPIVREKPTVDLIKVTDEMKAFKAYYKLRLERTNKRHYG  192



>ref|XP_008386691.1| PREDICTED: 60S ribosomal protein L13-1 [Malus domestica]
Length=207

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA++F
Sbjct  74   GFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKQF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDS  EELA ATQ++GPYLPI REK +VE VKVTD++KSFKAYDKLR+ER N+RH+G
Sbjct  134  KXGDSPAEELANATQLHGPYLPIAREKPTVELVKVTDELKSFKAYDKLRVERMNKRHVG  192



>ref|XP_004512380.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004512381.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X2 [Cicer 
arietinum]
Length=207

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMKVR G+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTAKYNMKVRDGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKAKLVVFPRRA K 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKLVVFPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLP +REK SVE VK+TD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVTGSYLPTVREKPSVELVKITDEMKAFKAYYKLRLERTNKRHYG  192



>gb|ACU23653.1| unknown [Glycine max]
Length=207

 Score =   290 bits (742),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK  RR ARQKKAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTGRRLARQKKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYKAKLVV PRRA K 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVLPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSSLEELANATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERTNKRHHG  192



>ref|XP_010426404.1| PREDICTED: 60S ribosomal protein L13-1-like [Camelina sativa]
Length=206

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI+REK ++E VK+T +M SFKAYDKLRLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVREKPTMELVKLTSEMTSFKAYDKLRLERTNKRHAG  191



>ref|XP_009595065.1| PREDICTED: 60S ribosomal protein L13-2 [Nicotiana tomentosiformis]
Length=206

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPRRA+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRRAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV G Y+PI RE+ +V+ VKVTD+MKSF AY KLR+ERTN RHIG
Sbjct  133  KAGDSSAEELATATQVQGSYMPITREQPAVDLVKVTDEMKSFNAYGKLRIERTNARHIG  191



>ref|XP_009335726.1| PREDICTED: 60S ribosomal protein L13-3-like [Pyrus x bretschneideri]
Length=207

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRR ++F
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRTKQF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EELA ATQ++ PYLPI REK +VE VKVTD++KSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSPAEELANATQLHAPYLPIAREKPTVELVKVTDELKSFKAYDKLRVERMNKRHVG  192



>ref|XP_010906706.1| PREDICTED: 60S ribosomal protein L13-1-like [Elaeis guineensis]
Length=207

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARKF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI+ EK SVE VKVTD+MKSF+AY KLR+ER N+R +G
Sbjct  134  KAGDSAPEELATATQVQGPYMPIVCEKPSVELVKVTDEMKSFRAYAKLRVERMNQRQVG  192



>ref|XP_009351877.1| PREDICTED: 60S ribosomal protein L13-1 [Pyrus x bretschneideri]
 ref|XP_009351878.1| PREDICTED: 60S ribosomal protein L13-1 [Pyrus x bretschneideri]
Length=207

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA+  
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKHI  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQ+  PYLPI REK +VE VK+TD++KSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSSAEELANATQLQAPYLPIAREKPTVELVKITDELKSFKAYDKLRVERMNQRHVG  192



>dbj|BAM64854.1| RPL13 protein [Beta vulgaris]
Length=207

 Score =   289 bits (740),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK +RR ARQKKAVKIFPRPTAG LRP+VH QTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKTKRRVARQKKAVKIFPRPTAGPLRPVVHAQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G ++PI+RE+   E VKVTD+MKSF AY KLRLERTNERH+G
Sbjct  134  KAGDSAPEELATATQVQGDFMPIVRERPISELVKVTDEMKSFNAYAKLRLERTNERHMG  192



>ref|XP_008376874.1| PREDICTED: 60S ribosomal protein L13-3 [Malus domestica]
Length=207

 Score =   289 bits (740),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA+  
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKHI  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EE+A ATQ+ GPYLPI REK +VE VKVTD++KSFKAYDKLR+ER N RHIG
Sbjct  134  KAGDSPAEEIANATQLQGPYLPIAREKPTVELVKVTDELKSFKAYDKLRVERMNTRHIG  192



>ref|XP_006598706.1| PREDICTED: uncharacterized protein LOC100499935 isoform X1 [Glycine 
max]
Length=207

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVR+GR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKA GI KKL PTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVFPRRA K 
Sbjct  74   GFSLEELKAVGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVFPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G +LPI+REK +V+ VKVTD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGSFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERTNKRHYG  192



>gb|EYU19728.1| hypothetical protein MIMGU_mgv1a013902mg [Erythranthe guttata]
Length=207

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRP AG LRP VHGQTLKYNMK+R+G+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPPAGPLRPTVHGQTLKYNMKLRSGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPT+GISVDHRRRN SLEG Q NVQRLKTYKAKLVVFPRR  KF
Sbjct  74   GFSLEELKAAGIPKKLAPTVGISVDHRRRNRSLEGFQTNVQRLKTYKAKLVVFPRRNGKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV+GP LPI+ EK SVE VKVT+++KSF+AYDKLRLERTN RH+G
Sbjct  134  KAGDSTPEELATATQVSGPILPIVHEKPSVELVKVTEELKSFRAYDKLRLERTNARHVG  192



>ref|XP_008381780.1| PREDICTED: 60S ribosomal protein L13-3-like [Malus domestica]
 ref|XP_008381788.1| PREDICTED: 60S ribosomal protein L13-3-like [Malus domestica]
Length=207

 Score =   289 bits (739),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA+  
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKHT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQ++ PYLPI REK +VE VK+TD++KSFKAYDKLR+ER N+RH+G
Sbjct  134  KAGDSSAEELANATQLHAPYLPIAREKPTVELVKITDELKSFKAYDKLRVERMNQRHVG  192



>ref|XP_007156319.1| hypothetical protein PHAVU_003G276400g [Phaseolus vulgaris]
 ref|XP_007156320.1| hypothetical protein PHAVU_003G276500g [Phaseolus vulgaris]
 gb|ESW28313.1| hypothetical protein PHAVU_003G276400g [Phaseolus vulgaris]
 gb|ESW28314.1| hypothetical protein PHAVU_003G276500g [Phaseolus vulgaris]
Length=206

 Score =   289 bits (739),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMK+RAGR
Sbjct  13   RKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKIRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKAKLVVFPR+ARK 
Sbjct  73   GFSLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQGNVQRLKTYKAKLVVFPRQARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDS+ EELA+ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY KLRLERTN+RH G
Sbjct  133  KTGDSSAEELASATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERTNQRHYG  191



>ref|XP_010278804.1| PREDICTED: 60S ribosomal protein L13-2-like [Nelumbo nucifera]
Length=207

 Score =   289 bits (739),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR  RQKKAVKIFPRPTAG LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRIDRQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYKAKL+VFPRRA +F
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYKAKLIVFPRRACEF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EELATATQV GPY+PI REK S++ VKVTD+MKSF AY KLR+ER N+R +G
Sbjct  134  KAGDSGAEELATATQVQGPYMPIEREKPSIDLVKVTDEMKSFNAYAKLRVERMNQRQVG  192



>ref|XP_010519493.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
 ref|XP_010519494.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
 ref|XP_010519495.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
Length=206

 Score =   288 bits (738),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLK YKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKMYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELA ATQV G ++PI+REK + E VKVT+ MKSFKAYDK+RLERTN+RH+G
Sbjct  133  KAGDSAPEELANATQVQGEHMPIVREKPASELVKVTEAMKSFKAYDKIRLERTNQRHVG  191



>ref|XP_009335696.1| PREDICTED: 60S ribosomal protein L13-1-like [Pyrus x bretschneideri]
Length=207

 Score =   288 bits (738),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA++F
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKQF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EELA ATQ++ PYLPI REK +VE VKVTD++KSFKAYDKL +ER N+RH+G
Sbjct  134  KAGDSPAEELANATQLHAPYLPIAREKPTVELVKVTDELKSFKAYDKLCVERMNKRHVG  192



>ref|XP_009773597.1| PREDICTED: 60S ribosomal protein L13-2-like [Nicotiana sylvestris]
Length=206

 Score =   288 bits (738),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPRRA+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRRAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQV G Y+PI RE+ +V+ VKVTD+MKSF AY KLR+ERTN RHIG
Sbjct  133  KAGDSSAEELAIATQVQGSYMPITREQPAVDLVKVTDEMKSFNAYGKLRIERTNARHIG  191



>ref|XP_010671181.1| PREDICTED: 60S ribosomal protein L13-1 [Beta vulgaris subsp. 
vulgaris]
Length=207

 Score =   288 bits (738),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK +RR ARQKKAVKIFPRPTAG LRP+VH QTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKTKRRVARQKKAVKIFPRPTAGPLRPVVHAQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G ++PI+RE    E VKVTD+MKSF AY KLRLERTNERH+G
Sbjct  134  KAGDSAPEELATATQVQGDFMPIVREAPISELVKVTDEMKSFNAYAKLRLERTNERHMG  192



>ref|XP_002877641.1| ATBBC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53900.1| ATBBC1 [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   288 bits (738),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK KLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKTKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSFKAYDK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAYDKIRLERTNKRHAG  191



>ref|XP_009361223.1| PREDICTED: 60S ribosomal protein L13-3-like [Pyrus x bretschneideri]
Length=207

 Score =   288 bits (738),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHGQTLKYNMKVRAGR
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHGQTLKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRA+  
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRAKLI  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EE+A ATQ++GPYLPI REK +VE VKVTD++KSFKAYDKLR+ER N RHIG
Sbjct  134  KAGDSPAEEIANATQLHGPYLPIAREKPTVELVKVTDELKSFKAYDKLRVERMNTRHIG  192



>gb|EYU45361.1| hypothetical protein MIMGU_mgv1a013891mg [Erythranthe guttata]
Length=207

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVK WFNQPARK RRRAARQKKAVKIFPRPT G LRP+VH QTLKYNMKVR+G+
Sbjct  14   RKHWQNYVKCWFNQPARKTRRRAARQKKAVKIFPRPTDGRLRPVVHCQTLKYNMKVRSGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPT+GISVDHRRRN SLEG Q NVQRLKTYKA+LVVFPRR  KF
Sbjct  74   GFSLEELKAAGIPKKLAPTVGISVDHRRRNRSLEGFQTNVQRLKTYKAQLVVFPRRNNKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPE+LATATQV+GP LPI+ EK SVE VKVT +MKSFKAYDKLRLERTN RH+G
Sbjct  134  KAGDSTPEQLATATQVSGPILPIVHEKPSVELVKVTSEMKSFKAYDKLRLERTNARHVG  192



>ref|XP_010677493.1| PREDICTED: 60S ribosomal protein L13-1-like [Beta vulgaris subsp. 
vulgaris]
Length=207

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VH QTLKYNMKVRAG+
Sbjct  14   KKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHCQTLKYNMKVRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEEL AAGI KKLAPTIGI+VDHRRRNSSLEGLQ NVQRLKTYKAKLVVFPR ARKF
Sbjct  74   GFSLEELAAAGIPKKLAPTIGIAVDHRRRNSSLEGLQTNVQRLKTYKAKLVVFPRHARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G +LPI  EKA VE +KVT+DMKSF AY KLRLERTN+RH G
Sbjct  134  KAGDSTPEELANATQVQGEFLPIKSEKAPVEVIKVTEDMKSFNAYSKLRLERTNKRHQG  192



>dbj|BAM64815.1| RPL13 [Beta vulgaris]
Length=207

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK +R+ ARQKKAVKIFPRPTAG LRP+VH QTLKYNMK+RAG+
Sbjct  14   KKHWQNYVKTWFNQPARKTKRKVARQKKAVKIFPRPTAGPLRPVVHAQTLKYNMKLRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G ++PI+RE    E VKVTD+MKSF AY KLRLERTNERH+G
Sbjct  134  KAGDSAPEELATATQVQGDFMPIVREAPIPELVKVTDEMKSFNAYAKLRLERTNERHMG  192



>ref|XP_006655721.1| PREDICTED: 60S ribosomal protein L13-1-like [Oryza brachyantha]
Length=208

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MKSFKAY KLR+ER N+RH+G
Sbjct  134  KAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKSFKAYAKLRVERMNQRHVG  193



>gb|KJB10376.1| hypothetical protein B456_001G197800 [Gossypium raimondii]
Length=207

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG +RP+VHGQTLKYNMK+RAG 
Sbjct  14   KKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPIRPVVHGQTLKYNMKLRAGN  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI+KKLAPTI I+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPR ARKF
Sbjct  74   GFTLEELKAAGISKKLAPTIAIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRCARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST +ELATATQV G Y+PI REK SV+ VKVT++MKSFKAY+KLR+ER NERHIG
Sbjct  134  KAGDSTAKELATATQVQGSYMPISREKPSVDLVKVTEEMKSFKAYNKLRVERMNERHIG  192



>ref|XP_009395324.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395325.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395326.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395327.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+V  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKI  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G Y+PI+REK +VE VKVTD+MKSFKAY KLR+ER NER +G
Sbjct  134  KAGDSAPEELATATQVQGQYMPIVREKPTVELVKVTDEMKSFKAYAKLRVERMNERQVG  192



>ref|XP_006291856.1| hypothetical protein CARUB_v10018032mg [Capsella rubella]
 gb|EOA24754.1| hypothetical protein CARUB_v10018032mg [Capsella rubella]
Length=206

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G +RP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPIRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI+RE+ ++E VK+T +MKSFKAYDK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVREQPTMELVKLTSEMKSFKAYDKIRLERTNKRHAG  191



>ref|XP_008785029.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK R GR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKPRVGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYKAKLV+FPRRARKF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANIQRLKTYKAKLVIFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI+ EK SVE VKVTD+MKSF+AY KLR+ER N+R +G
Sbjct  134  KAGDSAPEELATATQVQGPYMPIVHEKPSVELVKVTDEMKSFRAYAKLRVERMNQRQVG  192



>ref|XP_006342488.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum tuberosum]
Length=206

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRRAARQKKA  IFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRAARQKKAATIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPR A+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRHAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQV GPYLPI+R++ +VE VKVTD+MKSFKAY KLR+ERTN RH+G
Sbjct  133  KAGDSSAEELANATQVQGPYLPIVRDQPAVELVKVTDEMKSFKAYGKLRIERTNARHVG  191



>ref|XP_008776365.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
 ref|XP_008776366.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+V  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARKF
Sbjct  74   GFTLEELKAAGIRKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI+ EK +VE VKVTD MKSF+AY KLR+ER N+R +G
Sbjct  134  KAGDSAPEELATATQVQGPYMPIVHEKPTVELVKVTDQMKSFRAYAKLRVERMNQRQVG  192



>gb|EPS71909.1| hypothetical protein M569_02849 [Genlisea aurea]
Length=207

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQ+YVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VH QT KYNMKVRAG+
Sbjct  14   RKHWQDYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHCQTRKYNMKVRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLVVFPRRARKF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVVFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA+ATQV+GP LPI+ EK +VE VKVT+++KSF+AYDKLR+ER N+RH G
Sbjct  134  KAGDSTAEELASATQVSGPVLPIVGEKPNVELVKVTEELKSFRAYDKLRVERMNKRHAG  192



>ref|XP_009792303.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana sylvestris]
Length=206

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRR ARQKKA  IFPRPTAG LRPIVHGQTLKYNMKVR+GR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRIARQKKAATIFPRPTAGPLRPIVHGQTLKYNMKVRSGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPR A+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRHAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEELATATQV G Y+PI RE+ ++E VKVTD+MKSF AY KLR+ERTN RHIG
Sbjct  133  KAGDSSPEELATATQVQGTYMPITREQPTIELVKVTDEMKSFNAYGKLRIERTNARHIG  191



>ref|XP_006659160.1| PREDICTED: 60S ribosomal protein L13-1-like [Oryza brachyantha]
Length=208

 Score =   286 bits (732),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MKSFKAY KLR+ER N+RH+G
Sbjct  134  KAGDSTPEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKSFKAYAKLRVERMNQRHVG  193



>ref|XP_009624483.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana tomentosiformis]
 ref|XP_009624484.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana tomentosiformis]
Length=206

 Score =   286 bits (731),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRR ARQKKA  IFPRPTAG LRPIVHGQTLKYNMKVR+GR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRIARQKKAATIFPRPTAGPLRPIVHGQTLKYNMKVRSGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPR A+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRHAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEELATATQV G Y+PI RE+ ++E VKVTD+MKSF AY KLR+ERTN RHIG
Sbjct  133  KAGDSSPEELATATQVQGTYMPITREQPAIELVKVTDEMKSFNAYGKLRIERTNARHIG  191



>ref|XP_006404190.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
 gb|ESQ45643.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
Length=206

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGL +NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLNSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELA ATQV G Y+PI+REK +   VK+T DMKSFKAYDK+RLERTN+RH G
Sbjct  133  KAGDSAPEELANATQVQGDYMPIVREKPTTSLVKLTADMKSFKAYDKIRLERTNKRHAG  191



>ref|NP_001056613.1| Os06g0115500 [Oryza sativa Japonica Group]
 dbj|BAA92738.1| putative 60S ribosomal protein L13E [Oryza sativa Japonica Group]
 dbj|BAC22205.1| putative 60S ribosomal protein L13E [Oryza sativa Japonica Group]
 dbj|BAF18527.1| Os06g0115500 [Oryza sativa Japonica Group]
 gb|EAY99411.1| hypothetical protein OsI_21382 [Oryza sativa Indica Group]
 gb|EAZ35612.1| hypothetical protein OsJ_19902 [Oryza sativa Japonica Group]
 gb|ABR25544.1| 60S ribosomal protein l13-2 [Oryza sativa Indica Group]
 dbj|BAG92251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKFAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK SVE VKVTDDMK+FKAY KLR+ER N+RHIG
Sbjct  134  KAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDDMKAFKAYAKLRVERMNQRHIG  193



>ref|XP_010918091.1| PREDICTED: 60S ribosomal protein L13-1-like [Elaeis guineensis]
Length=207

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPR ARKF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRHARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATA+QV GPY+PI+ EK SVE VKVTD+MKSF+AY KLR+ER N+R +G
Sbjct  134  KAGDSAPEELATASQVQGPYMPIVHEKPSVELVKVTDEMKSFRAYAKLRVERMNQRQVG  192



>emb|CDY66119.1| BnaC01g42370D [Brassica napus]
Length=206

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA ATQV G Y+PI+REK ++E VK+T +MKS KA+DK+RLERTN+RH G
Sbjct  133  KAGDSTAEELANATQVQGDYMPIVREKPTMELVKLTSEMKSVKAFDKIRLERTNKRHAG  191



>ref|XP_010102662.1| 60S ribosomal protein L13-2 [Morus notabilis]
 gb|EXB93844.1| 60S ribosomal protein L13-2 [Morus notabilis]
Length=207

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKV AGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVGAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN QRLKTYKAKLVVFPRR  KF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANAQRLKTYKAKLVVFPRRPHKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA+ATQV G  LPI+REK +VE VKVT++++SFKAYDKLR+ERTN+R +G
Sbjct  134  KAGDSTPEELASATQVQGELLPIVREKPTVELVKVTNELRSFKAYDKLRVERTNQRRLG  192



>ref|XP_009150164.1| PREDICTED: 60S ribosomal protein L13-2 [Brassica rapa]
 emb|CDY37902.1| BnaA06g19150D [Brassica napus]
Length=206

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+RLERTN+RH G
Sbjct  133  KAGDSTAEELANATQVQGDYMPIVREKQATELVKLTSEMKSVNAYDKIRLERTNKRHAG  191



>ref|NP_190470.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 ref|NP_850672.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 ref|NP_001030831.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 sp|P41127.1|RL131_ARATH RecName: Full=60S ribosomal protein L13-1; AltName: Full=Protein 
BBC1 homolog [Arabidopsis thaliana]
 gb|AAL16152.1|AF428384_1 AT3g49010/T2J13_150 [Arabidopsis thaliana]
 emb|CAA53005.1| BBC1 protein [Arabidopsis thaliana]
 emb|CAB62009.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 gb|AAK92791.1| putative 60S ribosomal protein L13, BBC1 protein [Arabidopsis 
thaliana]
 gb|AAL38313.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 gb|AAL85112.1| putative 60S ribosomal protein L13, BBC1 protein [Arabidopsis 
thaliana]
 gb|AAM10157.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 dbj|BAH19771.1| AT3G49010 [Arabidopsis thaliana]
 gb|AEE78482.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78483.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78484.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
Length=206

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK KLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKTKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSFKA+DK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAFDKIRLERTNKRHAG  191



>ref|XP_009149775.1| PREDICTED: 60S ribosomal protein L13-1-like [Brassica rapa]
 emb|CDY08101.1| BnaA06g16250D [Brassica napus]
Length=206

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVREKHATELVKLTTEMKSVNAYDKIRLERTNKRHAG  191



>ref|XP_006847908.1| hypothetical protein AMTR_s00029p00111280 [Amborella trichopoda]
 gb|ERN09489.1| hypothetical protein AMTR_s00029p00111280 [Amborella trichopoda]
Length=207

 Score =   285 bits (730),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIVHGQTLKYNMK+RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVHGQTLKYNMKLRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKAKLVVFPRR +KF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKAKLVVFPRRPKKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDS+ EELATATQVNG ++PI  EK +VE V++TD+MK+FKAYDKLR+ER N+R +G
Sbjct  134  KGGDSSAEELATATQVNGEFMPITHEKPTVEMVRITDEMKAFKAYDKLRVERMNQRQLG  192



>ref|XP_009386549.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI R+K +VE VKVTD+MKSFKAY  LR+ER N+R +G
Sbjct  134  KAGDSAPEELATATQVQGPYMPIARQKPTVELVKVTDEMKSFKAYATLRVERMNKRQVG  192



>ref|XP_008775606.1| PREDICTED: 60S ribosomal protein L13-1 [Phoenix dactylifera]
 ref|XP_008775608.1| PREDICTED: 60S ribosomal protein L13-1 [Phoenix dactylifera]
Length=207

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+V  QTLKYNMK R GR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVQCQTLKYNMKSRVGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARKF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPY+PI+REK +VE VKVTD+MKSF+AY KLR+E+ N+R  G
Sbjct  134  KAGDSAPEELATATQVQGPYMPIVREKPTVELVKVTDEMKSFRAYAKLRVEQMNKRQAG  192



>ref|XP_004509537.1| PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum]
Length=207

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFP+PTAG LRPIVHGQT+KYNMK+R+G+
Sbjct  14   RKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPKPTAGPLRPIVHGQTVKYNMKLRSGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAA I KKLAPTIGI+VDHRRRN SLE LQ NVQRLKTYKAKLVVFPRRARK 
Sbjct  74   GFSLEELKAANIPKKLAPTIGIAVDHRRRNRSLESLQTNVQRLKTYKAKLVVFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEE A ATQV G YLPI+ EK SVE VKVTD+MK+FKAY KLRLERTN+RH G
Sbjct  134  KAGDSSPEERANATQVQGSYLPIVTEKPSVELVKVTDEMKAFKAYYKLRLERTNQRHFG  192



>ref|XP_004253080.1| PREDICTED: 60S ribosomal protein L13-1 [Solanum lycopersicum]
 ref|XP_010314813.1| PREDICTED: 60S ribosomal protein L13-1 [Solanum lycopersicum]
Length=206

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRRAARQKKA  IFPRPTAG+LRPIVHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVRTWFNQPARKTRRRAARQKKAATIFPRPTAGSLRPIVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLV+FPR A+K 
Sbjct  73   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVIFPRHAKKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELA ATQV GPYLPI+R++ ++E VK+TD+MKSFKAY KLR+ERTN RH G
Sbjct  133  KAGDSSAEELANATQVQGPYLPIVRDQPAIELVKITDEMKSFKAYGKLRIERTNARHFG  191



>emb|CDY16871.1| BnaA09g05110D [Brassica napus]
Length=206

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRPT+G+LRP+VHGQT+KYNMKVRAG+
Sbjct  13   RKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPTSGSLRPVVHGQTIKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLA TIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+R  
Sbjct  73   GFTLEELKAAGIAKKLASTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRVV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA ATQ+ G Y+PI REK ++E V VT DMKSFKAYDK+RLERTN+RH G
Sbjct  133  KAGDSTSEELANATQMQGEYMPIAREKVAMELVNVTSDMKSFKAYDKIRLERTNKRHAG  191



>ref|XP_002874151.1| 60S ribosomal protein L13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50410.1| 60S ribosomal protein L13 [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVRAG+
Sbjct  13   RKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+RK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTN  206
            KAGDSTPEELA ATQV G Y+PI  EKA++E VK+T DMK+FKAYDK+RLERTN
Sbjct  133  KAGDSTPEELANATQVQGDYMPIASEKAAMELVKLTADMKAFKAYDKIRLERTN  186



>ref|XP_010421197.1| PREDICTED: 60S ribosomal protein L13-3 [Camelina sativa]
Length=206

 Score =   285 bits (728),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQTLKYNMKVRAG+
Sbjct  13   RKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+RK 
Sbjct  73   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTN  206
            KAGDSTPEELA ATQV G Y+PI+ +KA++E VKV+ DMK+FKAYDKLRLERTN
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVSQKAAMELVKVSADMKAFKAYDKLRLERTN  186



>ref|NP_001288976.1| 60S ribosomal protein L13-2 [Brassica rapa]
 gb|ABL97945.1| cold induced protein [Brassica rapa]
Length=206

 Score =   285 bits (728),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+RLERTN+RH G
Sbjct  133  KAGDSTAEELAYATQVQGDYMPIVREKQATELVKLTSEMKSVNAYDKIRLERTNKRHAG  191



>sp|P41129.1|RL132_BRANA RecName: Full=60S ribosomal protein L13-2; AltName: Full=Cold-induced 
protein C24B [Brassica napus]
 emb|CAA80343.1| cold induced protein (BnC24B) [Brassica napus]
 emb|CDX86997.1| BnaC03g52670D [Brassica napus]
Length=206

 Score =   285 bits (728),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA ATQV G Y+PI+REK ++E VK+T +MKS  AYDK+RLERTN+RH G
Sbjct  133  KAGDSTAEELANATQVQGDYMPIVREKQAMELVKLTSEMKSVNAYDKIRLERTNKRHAG  191



>emb|CDX87152.1| BnaC09g04670D [Brassica napus]
Length=206

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRP +G+LRP+VHGQT+KYNMKVRAG+
Sbjct  13   RKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPASGSLRPVVHGQTIKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLA TIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+R  
Sbjct  73   GFTLEELKAAGIAKKLASTIGISVDHRRKNHSLEGLQSNVQRLKTYKAKLVVFPRRSRVV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI  EK ++E VKVT DMK+FKAYDK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYMPIAGEKVAMELVKVTSDMKAFKAYDKIRLERTNKRHAG  191



>emb|CDY05893.1| BnaC08g20700D [Brassica napus]
Length=206

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPT+G LRP+VHGQTLKYNMK+R G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKLRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVREKHATELVKLTTEMKSVNAYDKIRLERTNKRHAG  191



>ref|XP_002456870.1| hypothetical protein SORBIDRAFT_03g044290 [Sorghum bicolor]
 gb|EES01990.1| hypothetical protein SORBIDRAFT_03g044290 [Sorghum bicolor]
Length=208

 Score =   284 bits (726),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MK F AY KLRLER N++H+G
Sbjct  134  KAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKEFAAYGKLRLERMNKKHLG  193



>ref|XP_004969597.1| PREDICTED: 60S ribosomal protein L13-1-like [Setaria italica]
Length=208

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MK+F AY KLRLER N++H+G
Sbjct  134  KAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKTFAAYGKLRLERMNKKHLG  193



>ref|NP_001152730.1| LOC100286371 [Zea mays]
 gb|ACG49179.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACR37981.1| unknown [Zea mays]
 gb|AFW77302.1| 60S ribosomal protein L13 isoform 1 [Zea mays]
 gb|AFW77303.1| 60S ribosomal protein L13 isoform 2 [Zea mays]
Length=208

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRARKA  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
             AGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MKSF AY KLRLER N++H+G
Sbjct  134  NAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKSFAAYGKLRLERMNKKHLG  193



>gb|AAM61490.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
Length=206

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK KLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKTKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSF A+DK+RLERTN+RH G
Sbjct  133  KAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFMAFDKIRLERTNKRHAG  191



>ref|XP_010493519.1| PREDICTED: 60S ribosomal protein L13-3-like [Camelina sativa]
Length=206

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQTLKYNMKVRAG+
Sbjct  13   RKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRL TYKAKLVVFPRR+RK 
Sbjct  73   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLNTYKAKLVVFPRRSRKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTN  206
            KAGDSTPEELA ATQV G Y+PI+ +KA++E VKV+ DMK+FKAYDKLRLERTN
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVSQKAAMELVKVSADMKAFKAYDKLRLERTN  186



>ref|XP_009141778.1| PREDICTED: 60S ribosomal protein L13-3 [Brassica rapa]
 ref|XP_009141788.1| PREDICTED: 60S ribosomal protein L13-3 [Brassica rapa]
Length=206

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRPT+G+LRP+VHGQT+KYNMKVRAG+
Sbjct  13   RKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPTSGSLRPVVHGQTIKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KK+A TIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+R  
Sbjct  73   GFTLEELKAAGIAKKMASTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRVV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA ATQ+ G Y+PI REK +++ V VT DMKSFKAYDK+RLERTN+RH G
Sbjct  133  KAGDSTSEELANATQMQGEYMPIAREKVAMKLVNVTSDMKSFKAYDKIRLERTNKRHAG  191



>ref|XP_006288673.1| hypothetical protein CARUB_v10001981mg [Capsella rubella]
 gb|EOA21571.1| hypothetical protein CARUB_v10001981mg [Capsella rubella]
Length=206

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VH QTLKYNMKVRAG+
Sbjct  13   RKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHAQTLKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+R+ 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRQV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTN  206
            KAGDSTPEELA ATQV G Y+PI+ +KA++E VKVT DMK+FKAYDK+RLERTN
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVSQKAAMELVKVTADMKAFKAYDKIRLERTN  186



>sp|P41128.1|RL131_BRANA RecName: Full=60S ribosomal protein L13-1; AltName: Full=Cold-induced 
protein C24A [Brassica napus]
 emb|CAA80341.1| cold induced protein (BnC24A) [Brassica napus]
 emb|CDX83063.1| BnaA01g20630D [Brassica napus]
Length=206

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS KA+DK+RLERTN+RH G
Sbjct  133  KAGDSTAEELANATQVQGDYMPIVREKHATELVKLTTEMKSVKAFDKIRLERTNKRHAG  191



>ref|XP_009151668.1| PREDICTED: 60S ribosomal protein L13-1 [Brassica rapa]
Length=206

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDST EELA ATQV G Y+PI+REK + E VK+T +MKS KA+DK+RLERTN+RH G
Sbjct  133  KPGDSTAEELANATQVQGDYMPIVREKHATELVKLTTEMKSVKAFDKIRLERTNKRHAG  191



>ref|XP_009392764.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK R+GR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV G Y+PI+REK S+E VKVTD+M+SFKAY KLR+ER N   +G
Sbjct  134  KAGDSAPEELATATQVQGQYMPIVREKPSIELVKVTDEMRSFKAYAKLRVERMNRCQVG  192



>ref|XP_010233707.1| PREDICTED: 60S ribosomal protein L13-1-like [Brachypodium distachyon]
Length=208

 Score =   282 bits (721),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKARAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEG+Q+NVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGMQSNVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK S+E VKVTD+MK+FKAY KLR+ER N+R +G
Sbjct  134  KAGDSTPEELATATQVQGEYMPITRGEKRSIEVVKVTDEMKAFKAYGKLRVERMNQRQVG  193



>ref|XP_004969592.1| PREDICTED: 60S ribosomal protein L13-1-like [Setaria italica]
Length=208

 Score =   281 bits (720),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK SVE VKVT++MK+F AY KLRLER N++H+G
Sbjct  134  KAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTEEMKTFAAYGKLRLERMNKKHLG  193



>ref|XP_010545924.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS  EELA ATQV G ++ I REK +V+ VK+T D+KSFKAY K+RLERTNERH+G
Sbjct  133  KAGDSAAEELANATQVQGDHMLIAREKPAVDLVKITQDLKSFKAYGKIRLERTNERHVG  191



>gb|ABK25466.1| unknown [Picea sitchensis]
Length=207

 Score =   281 bits (719),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTAGPLRPIVHGQTQKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKAKLVVFPR ARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKLVVFPRTARKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEELATATQV G Y+ I +EK S+E VKVTD+MK+FKAY KLR+ER N+R +G
Sbjct  134  KAGDSSPEELATATQVQGKYMTITQEKPSLELVKVTDEMKNFKAYAKLRVERMNKRLVG  192



>ref|NP_001148638.1| 60S ribosomal protein L13-2 [Zea mays]
 ref|XP_008654954.1| PREDICTED: 60S ribosomal protein L13-2 isoform X1 [Zea mays]
 gb|ACG32335.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACG35809.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACG48210.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|AFW84112.1| 60S ribosomal protein L13 [Zea mays]
Length=208

 Score =   281 bits (719),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRA K 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRAHKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+P  R EK SVE VKVTD+MKSF AY KLRLER N++H+G
Sbjct  134  KAGDSTPEELATATQVQGDYMPFTRGEKRSVEVVKVTDEMKSFAAYGKLRLERMNKKHLG  193



>emb|CAC27142.1| 60S ribosomal protein L13E [Picea abies]
Length=207

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPTAG LRPIVHGQT KYNMKVRAGR
Sbjct  14   KKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTAGPLRPIVHGQTQKYNMKVRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKAKLVVFPR ARK 
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKAKLVVFPRTARKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+PEELATATQV G Y+ I +EK S+E VKVTD+MK+FKAY KLR+ER N+R +G
Sbjct  134  KAGDSSPEELATATQVQGKYMTITQEKPSLELVKVTDEMKNFKAYAKLRVERMNKRLVG  192



>ref|XP_010454674.1| PREDICTED: 60S ribosomal protein L13-3-like [Camelina sativa]
Length=206

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQTLKYNMKVRAG+
Sbjct  13   RKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+ EELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+RK 
Sbjct  73   GFTREELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTN  206
            KAGDSTPEELA ATQV G Y+PI+ +KA++E VK++ DMK+FKAYDKLRLERTN
Sbjct  133  KAGDSTPEELANATQVQGDYMPIVSQKAAMELVKLSADMKAFKAYDKLRLERTN  186



>ref|XP_003573442.1| PREDICTED: 60S ribosomal protein L13-1-like [Brachypodium distachyon]
Length=208

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKARAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEG+Q+NVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGMQSNVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G ++PI R EK SVE VKVTD+MK+FKAY KLR+ER N+R +G
Sbjct  134  KAGDSTPEELATATQVQGDFMPIARGEKRSVEVVKVTDEMKAFKAYGKLRVERMNQRQVG  193



>ref|XP_008800008.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+V  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVQCQTLKYNMKPRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KK APTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPR A K+
Sbjct  74   GFTLEELKAAGIPKKFAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRHAHKY  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELATATQV GPYLPI+ EK SVE VKVTD+MKSF+AY KLR+ER N+R +G
Sbjct  134  KAGDSAPEELATATQVQGPYLPIVCEKPSVELVKVTDEMKSFRAYAKLRVERMNQRQVG  192



>ref|NP_001050537.1| Os03g0576700 [Oryza sativa Japonica Group]
 pdb|3J61|L Chain L, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 emb|CAC81268.1| putative cold-induced protein [Oryza sativa Indica Group]
 gb|AAP85547.1| ribosomal protein large subunit 13 [Oryza sativa Japonica Group]
 gb|AAR10856.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 gb|ABF97254.1| 60S ribosomal protein L13-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12451.1| Os03g0576700 [Oryza sativa Japonica Group]
 gb|EAY90745.1| hypothetical protein OsI_12345 [Oryza sativa Indica Group]
 gb|EAZ27573.1| hypothetical protein OsJ_11521 [Oryza sativa Japonica Group]
 dbj|BAG91910.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97015.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY KLR+ER N+RH+G
Sbjct  134  KAGDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYAKLRVERMNQRHVG  193



>ref|XP_002440279.1| hypothetical protein SORBIDRAFT_09g028960 [Sorghum bicolor]
 gb|EES18709.1| hypothetical protein SORBIDRAFT_09g028960 [Sorghum bicolor]
Length=208

 Score =   280 bits (715),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELATATQV G Y+PI R EK SVE VKVT++MKSF AY KLRLER N++H+G
Sbjct  134  KAGDSTAEELATATQVQGDYMPITRGEKRSVEVVKVTEEMKSFAAYGKLRLERMNKKHLG  193



>ref|NP_001078260.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78485.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
Length=204

 Score =   279 bits (714),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 2/179 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK KLV+FPRRAR  
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKTKLVIFPRRAR--  130

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSFKA+DK+RLERTN+RH G
Sbjct  131  KAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAFDKIRLERTNKRHAG  189



>ref|XP_006404189.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
 gb|ESQ45642.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
Length=204

 Score =   279 bits (713),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 160/179 (89%), Gaps = 2/179 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQTLKYNMKVR G+
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRTGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGL +NVQRLKTYKAKLV+FPRRAR  
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLNSNVQRLKTYKAKLVIFPRRAR--  130

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELA ATQV G Y+PI+REK +   VK+T DMKSFKAYDK+RLERTN+RH G
Sbjct  131  KAGDSAPEELANATQVQGDYMPIVREKPTTSLVKLTADMKSFKAYDKIRLERTNKRHAG  189



>ref|XP_002439380.1| hypothetical protein SORBIDRAFT_09g005460 [Sorghum bicolor]
 gb|EES17810.1| hypothetical protein SORBIDRAFT_09g005460 [Sorghum bicolor]
Length=208

 Score =   278 bits (712),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EELAT TQV G Y+PI R EK SVE VKVTD+MKSF AY KLRLER N++H G
Sbjct  134  KAGDSTVEELATVTQVQGDYMPITRGEKRSVEVVKVTDEMKSFAAYGKLRLERMNKKHQG  193



>ref|NP_001155192.1| 60S ribosomal protein L13 isoform 1 [Zea mays]
 gb|ACF86560.2| unknown [Zea mays]
 tpg|DAA56068.1| TPA: 60S ribosomal protein L13 isoform 1 [Zea mays]
 tpg|DAA56069.1| TPA: 60S ribosomal protein L13 isoform 2 [Zea mays]
 tpg|DAA56070.1| TPA: 60S ribosomal protein L13 isoform 3 [Zea mays]
Length=208

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI K+LAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKAAGIPKRLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDST EEL TATQV G Y+PI R EK SVE VKVTD+MK+F AY KLRLER N++H+G
Sbjct  134  KAGDSTLEELTTATQVQGDYMPITRGEKRSVEVVKVTDEMKAFAAYGKLRLERMNKKHLG  193



>ref|XP_010550553.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+V GQTLKYNMKVRAGR
Sbjct  13   KKHWQNYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVRGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ N+QRLKTYKAKLV+FPRRARKF
Sbjct  73   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNIQRLKTYKAKLVIFPRRARKF  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELA  TQV G ++ I REK +V+ VKVT+DMKS  AY K+RLERTN+RH+G
Sbjct  133  KAGDSAPEELANTTQVQGDHMRIGREKVAVDLVKVTEDMKSSMAYGKIRLERTNQRHVG  191



>ref|NP_197778.1| 60S ribosomal protein L13-3 [Arabidopsis thaliana]
 sp|Q9FF90.1|RL133_ARATH RecName: Full=60S ribosomal protein L13-3 [Arabidopsis thaliana]
 gb|AAK55698.1|AF378895_1 AT5g23900/MRO11_6 [Arabidopsis thaliana]
 dbj|BAB10063.1| 60S ribosomal protein L13 [Arabidopsis thaliana]
 gb|AAK96460.1| AT5g23900/MRO11_6 [Arabidopsis thaliana]
 gb|AED93230.1| 60S ribosomal protein L13-3 [Arabidopsis thaliana]
Length=206

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQTLKYNMKVRAG+
Sbjct  13   RKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQTLKYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRR+R+ 
Sbjct  73   GFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRSRQV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTN  206
            KAGDSTPEELA ATQV G Y+PI   KA++E VK+T D+K+FKAYDK+RLERTN
Sbjct  133  KAGDSTPEELANATQVQGDYMPIASVKAAMELVKLTADLKAFKAYDKIRLERTN  186



>gb|ABK24025.1| unknown [Picea sitchensis]
 gb|ABK27069.1| unknown [Picea sitchensis]
Length=209

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 162/181 (90%), Gaps = 2/181 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPT+G LRPIVHGQT KYNMK+RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTSGPLRPIVHGQTQKYNMKIRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPR--RAR  374
            GFSLEELKAAGI KK APTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLVVFPR  RAR
Sbjct  74   GFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVVFPRSARAR  133

Query  373  KFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHI  194
            K KAGDS+ EELATATQ+ G Y+PI +EK SVE +KVTD+MK+FKAY KLR+ER N+R +
Sbjct  134  KLKAGDSSKEELATATQIQGTYMPISQEKPSVEIIKVTDEMKNFKAYAKLRVERMNKRLV  193

Query  193  G  191
            G
Sbjct  194  G  194



>gb|AFW84113.1| hypothetical protein ZEAMMB73_641905 [Zea mays]
Length=206

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 160/180 (89%), Gaps = 3/180 (2%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRA   
Sbjct  74   GFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYKAKLVIFPRRA--H  131

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+P  R EK SVE VKVTD+MKSF AY KLRLER N++H+G
Sbjct  132  KAGDSTPEELATATQVQGDYMPFTRGEKRSVEVVKVTDEMKSFAAYGKLRLERMNKKHLG  191



>ref|XP_006850159.1| hypothetical protein AMTR_s00022p00239970 [Amborella trichopoda]
 gb|ERN11740.1| hypothetical protein AMTR_s00022p00239970 [Amborella trichopoda]
Length=207

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 156/179 (87%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYV+TWFNQPARK RRR AR KKAVKIFPRP AG LRPIVHGQTLKYNMK+RAGR
Sbjct  14   KKHWQNYVRTWFNQPARKVRRRIARTKKAVKIFPRPVAGPLRPIVHGQTLKYNMKLRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKA LVVFPRR  KF
Sbjct  74   GFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKANLVVFPRRPSKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDS PEEL  A+QV   Y+ I REK  VE VK+T++MKSFKAYDKLR+ERTN+RH G
Sbjct  134  KVGDSGPEELVNASQVLDKYMAITREKPGVEMVKITEEMKSFKAYDKLRIERTNKRHFG  192



>ref|XP_009396207.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   274 bits (701),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWF+QPARK RRR ARQKKAVKIFPRPT+G L PIV  QTLKYNMK RAGR
Sbjct  14   KKHWQNYVKTWFSQPARKTRRRIARQKKAVKIFPRPTSGPLCPIVQCQTLKYNMKSRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKAKLV+FPRR  KF
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRVCKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEEL  ATQV G Y+PI+ EK SVE VKVTD+MKSFKAY KLR+ER NER +G
Sbjct  134  KAGDSAPEELTAATQVTGQYMPIVHEKPSVELVKVTDEMKSFKAYAKLRVERMNERLVG  192



>gb|EMT28307.1| 60S ribosomal protein L13-1 [Aegilops tauschii]
Length=208

 Score =   274 bits (701),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QT KYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTRKYNMKARAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK SVE +KVT++MK+FKAY KLR+ER N+R +G
Sbjct  134  KAGDSTPEELATATQVQGDYMPITRGEKRSVELMKVTEEMKAFKAYGKLRVERMNQRQLG  193



>gb|ABR18061.1| unknown [Picea sitchensis]
Length=207

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPT+G LRPIVHGQT KYNMK+RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTSGPLRPIVHGQTQKYNMKIRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KK APTIGI+VDHRRRN SLEGLQ NVQRLKTYKAKLVVFPR A K 
Sbjct  74   GFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKAKLVVFPRSAGKL  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EELATATQV G Y+PI +EK SV+ +KVTD+MK+FKAY KLR+ER N+R +G
Sbjct  134  KAGDSSQEELATATQVQGTYMPISQEKPSVDIIKVTDEMKNFKAYAKLRVERMNKRLVG  192



>gb|ABF97255.1| 60S ribosomal protein L13-2, putative, expressed [Oryza sativa 
Japonica Group]
Length=196

 Score =   273 bits (699),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            KH  NYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGRG
Sbjct  3    KHNNNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKSRAGRG  62

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK K
Sbjct  63   FTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKVK  122

Query  364  AGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            AGDST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY KLR+ER N+RH+G
Sbjct  123  AGDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYAKLRVERMNQRHVG  181



>ref|XP_004982044.1| PREDICTED: 60S ribosomal protein L13-2-like isoform X1 [Setaria 
italica]
 ref|XP_004982045.1| PREDICTED: 60S ribosomal protein L13-2-like isoform X2 [Setaria 
italica]
Length=207

 Score =   273 bits (699),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  Q+ KYNMK RAGR
Sbjct  13   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQSRKYNMKSRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKAKLV+FPRRARK 
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKAKLVIFPRRARKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELATATQV G Y+PI R EK S+E VKVTD+MK   AY KLRLER N+RH G
Sbjct  133  KAGDSTPEELATATQVQGEYMPITRGEKRSIEVVKVTDEMKESGAYKKLRLERMNKRHQG  192



>gb|EMT10064.1| 60S ribosomal protein L13-1 [Aegilops tauschii]
Length=225

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QT KYNMK RAGR
Sbjct  31   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTRKYNMKARAGR  90

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+FPRRARK 
Sbjct  91   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIFPRRARKV  150

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY KLR+ER N+R +G
Sbjct  151  KAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYGKLRVERMNQRQLG  210



>dbj|BAJ99213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=208

 Score =   272 bits (695),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QT KYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTRKYNMKARAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+FPRRARK 
Sbjct  74   GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIFPRRARKV  133

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY KLR+ER N+R +G
Sbjct  134  KAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYGKLRVERMNQRQLG  193



>gb|EMS50076.1| 60S ribosomal protein L13-1 [Triticum urartu]
Length=267

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 160/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QT KYNMK RAGR
Sbjct  73   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTRKYNMKARAGR  132

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+FPRRARK 
Sbjct  133  GFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIFPRRARKV  192

Query  367  KAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY KLR+ER N+R +G
Sbjct  193  KAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYGKLRVERMNQRQLG  252



>gb|AIZ68174.1| 60S ribosomal protein L13-1-like protein [Ornithogalum saundersiae]
Length=207

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQ+YV+TWF+QPARK RRR ARQKKAVK FPRPTAG LRP+VH QTLKYNMK+RAGR
Sbjct  14   KKHWQDYVRTWFDQPARKTRRRIARQKKAVKEFPRPTAGPLRPVVHCQTLKYNMKLRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KK APTIGI++DHRR+N SLEGLQANVQRLKTY AKLV+FPRRA KF
Sbjct  74   GFSLEELKAAGIPKKWAPTIGIAIDHRRKNRSLEGLQANVQRLKTYMAKLVIFPRRAGKF  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS PEELA ATQV+G Y+PI +EK SV  VKVTD+MK+F+AY KLR+ER N R IG
Sbjct  134  KAGDSPPEELANATQVHGEYMPIQQEKPSVNLVKVTDEMKAFRAYAKLRVERMNARQIG  192



>ref|XP_007040896.1| 60S ribosomal protein L13 [Theobroma cacao]
 gb|EOY25397.1| 60S ribosomal protein L13 [Theobroma cacao]
Length=197

 Score =   266 bits (679),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 155/179 (87%), Gaps = 10/179 (6%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRP+AG LRPIVHGQTLKYNMK+RAGR
Sbjct  14   RKHWQNYVKTWFNQPARKARRRLARQKKAVKIFPRPSAGHLRPIVHGQTLKYNMKLRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI+KKLAPTI  +VDHRR+N SLE LQANVQRLKT KAKLV         
Sbjct  74   GFSLEELKAAGISKKLAPTIDTAVDHRRKNRSLESLQANVQRLKTCKAKLV---------  124

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
             AGDSTPEELATATQV GPY+PI  +K SVE VKVT++MKSFKAY+KLR+ER NERHIG
Sbjct  125  -AGDSTPEELATATQVQGPYIPIAGDKPSVELVKVTEEMKSFKAYNKLRVERMNERHIG  182



>gb|EMS59514.1| 60S ribosomal protein L13-1 [Triticum urartu]
Length=215

 Score =   265 bits (677),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 161/187 (86%), Gaps = 8/187 (4%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QT KYNMK RAGR
Sbjct  14   KKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTRKYNMKARAGR  73

Query  547  GFSLEELK-------AAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            GF+LEELK       +AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+F
Sbjct  74   GFTLEELKLLSCVFLSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIF  133

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLER  212
            PR ARK KAGDSTPEELATATQV G YLPI R EK SVE +KVT++MK+FKAY KLR+ER
Sbjct  134  PRCARKVKAGDSTPEELATATQVQGDYLPITRGEKRSVELMKVTEEMKAFKAYGKLRVER  193

Query  211  TNERHIG  191
             N+R +G
Sbjct  194  MNQRQLG  200



>ref|XP_010539934.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQ+YVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQTLKYNMKVRAGR
Sbjct  13   KKHWQHYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVHGQTLKYNMKVRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEEL AAG+ KKLAPTIGI VDHRR+N SLEGLQ NVQRLKTYKAKLV+FP   RK 
Sbjct  73   GFTLEELMAAGVPKKLAPTIGIVVDHRRKNRSLEGLQTNVQRLKTYKAKLVIFPHCTRKV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHI  194
             AGDS  EELA  +Q+   Y+PI+REK ++EFVKV + M SFKAYDK+RLERT ERH+
Sbjct  133  NAGDSAAEELANTSQMQEVYMPIVREKPALEFVKVAEGMTSFKAYDKVRLERTIERHV  190



>ref|NP_190465.1| putative 60S ribosomal protein L13-2 [Arabidopsis thaliana]
 sp|Q9SMT4.1|RL132_ARATH RecName: Full=Putative 60S ribosomal protein L13-2 [Arabidopsis 
thaliana]
 emb|CAB62014.1| 60S ribosomal protein L13 (BBC1)-like [Arabidopsis thaliana]
 gb|AEE78477.1| putative 60S ribosomal protein L13-2 [Arabidopsis thaliana]
Length=206

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K W+NYVKT FNQPA K RRR ARQ KAVKIFPRPTAG +RP+VH QTL YNMKVRAG+
Sbjct  13   KKKWENYVKTSFNQPAMKTRRRIARQNKAVKIFPRPTAGPIRPVVHAQTLTYNMKVRAGK  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGISVDH R+N SLEG Q NVQRLKTYKAKLV+FPR AR  
Sbjct  73   GFTLEELKAAGIPKKLAPTIGISVDHHRKNRSLEGFQTNVQRLKTYKAKLVIFPRCARTV  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDS  +ELA ATQV   ++PI+RE  ++E VK+T DMK F AYDK+RLE  N+RH G
Sbjct  133  KVGDSAQQELANATQVQVDHMPIVREMPTMELVKLTSDMKLFNAYDKIRLEGINKRHAG  191



>sp|P49627.1|RL13_TOBAC RecName: Full=60S ribosomal protein L13; AltName: Full=Clone 
6.2.1 protein [Nicotiana tabacum]
 gb|AAA72054.1| unnamed protein product [Nicotiana tabacum]
Length=202

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 146/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQNYVKTWFNQPARK RRR ARQKKAVKI PRPTAG LRPIVHGQTLKYNMKVR+GR
Sbjct  9    KKHWQNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVHGQTLKYNMKVRSGR  68

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRL+  + +LVVFPRRA + 
Sbjct  69   GFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRRASRS  128

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            +     P    TATQV+G Y+PI REK  +   KV   MKSF AY KLR+ERTNERHIG
Sbjct  129  RLVILPPRNCLTATQVHGAYMPIEREKHQLILSKVLKKMKSFNAYAKLRVERTNERHIG  187



>ref|XP_001770513.1| predicted protein [Physcomitrella patens]
 gb|EDQ64682.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K WQNYV+TWFNQPARK+RRR ARQKKAV +FPRPTAG LRP+VH QTLKYN K+R+GR
Sbjct  14   KKDWQNYVRTWFNQPARKKRRRTARQKKAVAVFPRPTAGPLRPVVHSQTLKYNSKIRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+AKLVVFPRR++K 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYRAKLVVFPRRSKKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGDS+ EEL++ TQV GP LPI++ + +V+ V +TD+MKS K Y KLR ER NER +G
Sbjct  134  KAGDSSAEELSSFTQVIGPVLPIVKPRPTVDIVSITDEMKSQKGYYKLRQERMNERLVG  192



>ref|XP_001762920.1| predicted protein [Physcomitrella patens]
 gb|EDQ72125.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   241 bits (615),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K WQNYV+TWFNQPARK+RRR ARQKKAV +FPRPTAG LRP+VH QTLKYN K+R+GR
Sbjct  14   KKDWQNYVRTWFNQPARKKRRRTARQKKAVAVFPRPTAGPLRPVVHSQTLKYNSKIRSGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ N+ RL TY+AKLVVFPRR++K 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENINRLNTYRAKLVVFPRRSKKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGD+T EEL++ TQ+  P LPI++ + + E V +TD+MKS K Y KLRLER NER +G
Sbjct  134  KAGDATAEELSSVTQLTRPVLPIVKPQPTAEIVSITDEMKSQKGYYKLRLERMNERLVG  192



>ref|XP_001756184.1| predicted protein [Physcomitrella patens]
 gb|EDQ79050.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   240 bits (613),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K WQNYV+TWFNQPARK+RRR ARQKKA  +FPRPTAG LRP+VH QTL+YN K+RAGR
Sbjct  14   KKDWQNYVRTWFNQPARKKRRRTARQKKAAAVFPRPTAGPLRPVVHSQTLRYNAKIRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+L+ELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+AKLVVFPRRARK 
Sbjct  74   GFTLDELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYRAKLVVFPRRARKS  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGD+T EEL++ATQV    LPI++ + +VE V VTD+MKS K Y KLR ER NER +G
Sbjct  134  KAGDATAEELSSATQVTRSVLPIVKPRPTVEIVSVTDEMKSQKGYYKLRQERMNERLVG  192



>ref|XP_001761309.1| predicted protein [Physcomitrella patens]
 gb|EDQ74031.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K WQNYV+TWFNQPARK+RRR ARQKK+V +FPRPTAG LRP+VH QTLKYN K+RAGR
Sbjct  14   KKDWQNYVRTWFNQPARKKRRRTARQKKSVAVFPRPTAGPLRPVVHSQTLKYNAKIRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAG+ KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+AKLVVFPR ++K 
Sbjct  74   GFTLEELKAAGVPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYRAKLVVFPRLSKKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGD++ EEL++ TQ  G +LPI++ + S E V +TD+MKS + Y KLR ER NER +G
Sbjct  134  KAGDASAEELSSVTQATGEFLPIVKPRPSAEIVSITDEMKSQRGYYKLRQERMNERLVG  192



>ref|XP_001785308.1| predicted protein [Physcomitrella patens]
 gb|EDQ49876.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   235 bits (600),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K WQNYV+TWFNQPARK+RRR ARQ+KAV +FPRPTAG LRP+VH QTL+YN K+RAGR
Sbjct  14   KKDWQNYVRTWFNQPARKKRRRTARQRKAVAVFPRPTAGPLRPVVHSQTLRYNAKIRAGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL  Y+AKLVVFPRR++K 
Sbjct  74   GFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNMYRAKLVVFPRRSKKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGD++ EEL++ TQV G  LPI++ + S E V +TD+MK+   Y KLR ER NER +G
Sbjct  134  KAGDASAEELSSVTQVTGDVLPIVKSRPSAEIVSITDEMKAQMGYYKLRQERMNERLVG  192



>gb|AAT08722.1| cold-induced protein [Hyacinthus orientalis]
Length=185

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -2

Query  640  VKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRR  461
            VKIFPRPTAG LRP+VH QTLKYNMK RAGRGFSLEELK AGI KK APT+GI+VDHRRR
Sbjct  33   VKIFPRPTAGPLRPVVHCQTLKYNMKTRAGRGFSLEELKMAGIPKKWAPTVGIAVDHRRR  92

Query  460  NSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKAS  281
            N SLEGLQANVQRLK YKAKLV+FPRR  KFK+GDS+ EELA+ TQV G Y+P+++EK  
Sbjct  93   NRSLEGLQANVQRLKEYKAKLVIFPRRPGKFKSGDSSAEELASITQVQGEYMPLVKEKPV  152

Query  280  VEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            V  VKVT +M +FKAY KL +ERTNERH+G
Sbjct  153  VNLVKVTAEMNAFKAYHKLPVERTNERHLG  182



>emb|CDP02021.1| unnamed protein product [Coffea canephora]
Length=141

 Score =   223 bits (569),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  568  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            MKVRAGRGF+LEELKAAGI KKL PTIG+SVDHRR+N SLEG QANVQRLKTYKAKLVVF
Sbjct  1    MKVRAGRGFTLEELKAAGIPKKLGPTIGVSVDHRRKNRSLEGFQANVQRLKTYKAKLVVF  60

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  209
            PRRARKFKAGDS PEELATATQV G YLPI+ EK  VE VKVT++MKSFKAYDKLRLERT
Sbjct  61   PRRARKFKAGDSAPEELATATQVQGAYLPIVCEKPCVELVKVTEEMKSFKAYDKLRLERT  120

Query  208  NERHIG  191
            NERHIG
Sbjct  121  NERHIG  126



>ref|XP_002962809.1| hypothetical protein SELMODRAFT_266648 [Selaginella moellendorffii]
 gb|EFJ36272.1| hypothetical protein SELMODRAFT_266648 [Selaginella moellendorffii]
Length=208

 Score =   225 bits (573),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 142/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K W+  V+TWFNQPARK RRR AR  KA KIFPRP +G LRP+VH  T+KYN KV+ GR
Sbjct  14   KKDWEKLVRTWFNQPARKVRRRKARSIKAAKIFPRPPSGPLRPVVHCPTVKYNSKVKYGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK AGI+KKLA TIGI++DHRR+N SLE LQ NVQRL TYK KL+VFPR+A+K 
Sbjct  74   GFSLEELKEAGISKKLARTIGIALDHRRKNRSLESLQTNVQRLNTYKTKLIVFPRKAKKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDS PE L+TATQ  GP LPI+ +K  V  V VTD+MK+ KAY KLR+E+TN+R +G
Sbjct  134  KMGDSQPEVLSTATQFQGPVLPIVPKKPEVGIVTVTDEMKAVKAYQKLRIEQTNKRLVG  192



>ref|XP_002962473.1| hypothetical protein SELMODRAFT_165483 [Selaginella moellendorffii]
 gb|EFJ35936.1| hypothetical protein SELMODRAFT_165483 [Selaginella moellendorffii]
Length=208

 Score =   223 bits (568),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K W+  V+TWFNQPARK RRR AR  KA KIFPRP +G LRP+VH  T+KYN KV+ GR
Sbjct  14   KKDWEKLVRTWFNQPARKVRRRKARSIKAAKIFPRPPSGPLRPVVHCPTVKYNSKVKYGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSLEELK AGI+K LA TIGI++DHRR+N SLE LQ NVQRL TYK KL+VFPR+A+K 
Sbjct  74   GFSLEELKEAGISKNLARTIGIALDHRRKNRSLESLQTNVQRLNTYKTKLIVFPRKAKKT  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            K GDS PE L+TATQ  GP LPI+ +K  V  V VTD+MK+ KAY KLR+E+TN+R +G
Sbjct  134  KMGDSQPEVLSTATQFQGPVLPIVPKKPEVGIVTVTDEMKAVKAYQKLRIEQTNKRLVG  192



>ref|XP_003626151.1| 60S ribosomal protein L13 [Medicago truncatula]
Length=141

 Score =   220 bits (561),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  568  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            MK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVF
Sbjct  1    MKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVF  60

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  209
            PRRARK KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY KLRLERT
Sbjct  61   PRRARKVKAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYKLRLERT  120

Query  208  NERHIG  191
            N+RH+G
Sbjct  121  NKRHLG  126



>ref|XP_003626152.1| 60S ribosomal protein L13 [Medicago truncatula]
Length=139

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 2/126 (2%)
 Frame = -2

Query  568  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            MK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVF
Sbjct  1    MKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVF  60

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  209
            PRRAR  KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY KLRLERT
Sbjct  61   PRRAR--KAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYKLRLERT  118

Query  208  NERHIG  191
            N+RH+G
Sbjct  119  NKRHLG  124



>ref|XP_011395748.1| 60S ribosomal protein L13-2 [Auxenochlorella protothecoides]
 gb|KFM22882.1| 60S ribosomal protein L13-2 [Auxenochlorella protothecoides]
Length=208

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RK WQ  V+TWFNQPARK RRR AR +KA  +FPRPTAG LRPIVH QT+KYN K R GR
Sbjct  14   RKKWQTNVRTWFNQPARKLRRRQARAEKAKTVFPRPTAGPLRPIVHSQTVKYNRKKRTGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK AGI+ KLAPT+GI+VDHRRRN SLEGLQ NV RLK YKA LV+FPRRA K 
Sbjct  74   GFTLEELKEAGISAKLAPTVGIAVDHRRRNRSLEGLQENVARLKAYKANLVLFPRRAGKP  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            +AG+++ EELA   Q+ GP LP+   K  +E VK+T + K+  AY  LRLER N R  G
Sbjct  134  RAGEASAEELAAVAQLTGPVLPLTHTKPKLELVKLTAEQKAATAYATLRLERMNVRMAG  192



>ref|XP_005646484.1| ribosomal protein L13e [Coccomyxa subellipsoidea C-169]
 gb|EIE21940.1| ribosomal protein L13e [Coccomyxa subellipsoidea C-169]
Length=217

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 138/186 (74%), Gaps = 7/186 (4%)
 Frame = -2

Query  727  RKHWQ-------NYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYN  569
            +KHW        +YV+TWFNQPARK RR  AR +KA K+FPRP AG LRPIVHGQT+KYN
Sbjct  14   KKHWHGGKNGKGSYVRTWFNQPARKHRRATARIEKAKKVFPRPAAGPLRPIVHGQTIKYN  73

Query  568  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            +K R GRGF+LEELK AGI  KLAPTIGI+VDHRR N SLE LQ N  RLK YKAKLV+F
Sbjct  74   LKKRLGRGFTLEELKEAGIAVKLAPTIGIAVDHRRHNRSLESLQENAARLKAYKAKLVIF  133

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  209
            P R+   K+GDST EEL  A Q  GP LP++     +E VK+TD++K+ KAY KLRLERT
Sbjct  134  PTRSNMPKSGDSTAEELKVAQQHKGPLLPLVHAAHKLESVKLTDELKAEKAYYKLRLERT  193

Query  208  NERHIG  191
            N + +G
Sbjct  194  NAKLVG  199



>ref|NP_001238240.1| uncharacterized protein LOC100499935 [Glycine max]
 gb|ACU14254.1| unknown [Glycine max]
Length=141

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  568  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            MKVR+GRGFSLEELKA GI KKL PTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVF
Sbjct  1    MKVRSGRGFSLEELKAVGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVF  60

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  209
            PRRA K KAGDSTPEELA ATQV G +LPI+REK +V+ VKVTD+MK+FKAY KLRLERT
Sbjct  61   PRRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERT  120

Query  208  NERHIG  191
            N+RH G
Sbjct  121  NKRHYG  126



>ref|XP_001633643.1| predicted protein [Nematostella vectensis]
 gb|EDO41580.1| predicted protein [Nematostella vectensis]
Length=211

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ YVKTWF+QP RK+RRR ARQ KA KI PRP AG+LRPIV   T KYN KVRAGRG
Sbjct  16   KDWQRYVKTWFDQPGRKKRRRVARQTKAAKIAPRPVAGSLRPIVRCPTFKYNTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+L+ELKAAGI +K+APTIGI+VDHRR+N S E LQANVQRLK YK+KL+VFPR+A K K
Sbjct  76   FTLDELKAAGIPRKVAPTIGIAVDHRRKNRSAESLQANVQRLKEYKSKLIVFPRKANKPK  135

Query  364  AGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
             GDS   +LA A Q+ GP +PI +E   ++   +T+D K F  +  +R+ER N R IG
Sbjct  136  QGDSEAADLANAVQLQGPVMPIPQESVPIKARPITEDEKKFSVFKTMRIERANARLIG  193



>dbj|BAB71993.1| BBC1-like protein [Oryza sativa Japonica Group]
Length=142

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -2

Query  568  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            MK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+F
Sbjct  1    MKSRAGRGFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIF  60

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLER  212
            PRRARK KA DST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY KLR+ER
Sbjct  61   PRRARKVKAXDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYAKLRVER  120

Query  211  TNERHIG  191
             N+RH+G
Sbjct  121  MNQRHVG  127



>ref|XP_005843532.1| hypothetical protein CHLNCDRAFT_33026 [Chlorella variabilis]
 gb|EFN51430.1| hypothetical protein CHLNCDRAFT_33026 [Chlorella variabilis]
Length=207

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 133/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RK WQ+ V TWFNQPARK+RRRAAR +KA ++ PRP AG LRP+V GQT+KYN K RAGR
Sbjct  13   RKKWQDKVVTWFNQPARKERRRAARAEKATRVAPRPVAGLLRPVVSGQTVKYNTKKRAGR  72

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+LEELK AGI  KLAPTIGI+VDHRR N SLE LQ N  RLK YKA LVVFPRRA K 
Sbjct  73   GFTLEELKEAGIPAKLAPTIGIAVDHRRTNRSLESLQENANRLKAYKANLVVFPRRAGKP  132

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGD++  EL TA Q+ G  LP +   A+VE V VT DMK   AY  LRLER N+R  G
Sbjct  133  KAGDASAAELGTAQQLKGALLPFVPTAAAVEKVAVTADMKKESAYGVLRLERMNKRMAG  191



>gb|AAL93210.1|AF487458_1 BBC1-like protein [Triticum aestivum]
Length=142

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -2

Query  568  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  389
            MK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+F
Sbjct  1    MKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIF  60

Query  388  PRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLER  212
            PRRARK KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY KLR+ER
Sbjct  61   PRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYGKLRVER  120

Query  211  TNERHIG  191
             N+R +G
Sbjct  121  MNQRQLG  127



>gb|KDD76767.1| ribosomal protein L13e [Helicosporidium sp. ATCC 50920]
Length=212

 Score =   204 bits (520),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 133/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K WQ  V+TWFNQPARK RR+ AR  KA   FPRPTAG LRP+VH  T+KYN +VRAG+
Sbjct  14   KKKWQFNVRTWFNQPARKLRRKNARVAKARSTFPRPTAGPLRPVVHCPTVKYNRRVRAGK  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFSL ELK AGI  KLAPTIGI+VDHRRRN SLEGLQANVQRLK YKA+LV+FPR+A+  
Sbjct  74   GFSLAELKEAGIAAKLAPTIGIAVDHRRRNKSLEGLQANVQRLKAYKAQLVLFPRKAKSP  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KAGD++ EE+A ATQ  G  +PI      VE VK+T +M+   AY  LR  R++ R  G
Sbjct  134  KAGDASAEEVAAATQHKGYVMPIKTVHPEVEMVKITKEMQEASAYATLRKARSDARLAG  192



>gb|KDO51401.1| hypothetical protein CISIN_1g041207mg, partial [Citrus sinensis]
Length=126

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  523  AAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTPE  344
            AAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRRARKFKAGDS PE
Sbjct  1    AAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPE  60

Query  343  ELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            ELATATQV GPY+PI  E+ +VE VKVT DMKSFKAYDKLR+ER NERH G
Sbjct  61   ELATATQVQGPYMPIAPERPTVELVKVTQDMKSFKAYDKLRIERVNERHFG  111



>ref|XP_002502525.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63783.1| predicted protein [Micromonas sp. RCC299]
Length=220

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = -2

Query  727  RKHWQNY-----VKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMK  563
            +K WQ       V+TWFNQ  RK+ RR AR+KKA  IFPRPTAGALRP+V   T +YN K
Sbjct  14   KKDWQGNAGACRVRTWFNQAGRKKSRRIAREKKAKAIFPRPTAGALRPVVRPPTQRYNFK  73

Query  562  VRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPR  383
             R GRGF+LEELKAAGI KKLAPTIGI+VDHRRRN S E L  N +RLK YKA L++FPR
Sbjct  74   TRLGRGFTLEELKAAGIPKKLAPTIGIAVDHRRRNRSEESLALNSKRLKEYKASLILFPR  133

Query  382  RARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNE  203
            R  K KAGDS   ELA A Q  G  +PI +E   +E V VT++MK F AY KLR ER N 
Sbjct  134  RTAKPKAGDSDAGELAMAKQFKGALMPITKEDKPLEMVSVTEEMKGFNAYQKLRTERMNV  193

Query  202  RHIG  191
            R +G
Sbjct  194  RQVG  197



>emb|CCQ18590.1| 60S ribosomal protein L13 [Sycon ciliatum]
Length=208

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 132/178 (74%), Gaps = 0/178 (0%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K W   VK WF+QP RK RRR AR+KKA+++ PRP AG+LRP+V  QT KYN KVRAGRG
Sbjct  13   KDWDKRVKCWFDQPGRKSRRRQAREKKALRVAPRPVAGSLRPVVRCQTFKYNTKVRAGRG  72

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI++K+APTIGI+VDHRRRN S E LQANVQRLK Y++KL+VFPR+  K K
Sbjct  73   FTLEELKAAGISRKVAPTIGITVDHRRRNRSSESLQANVQRLKEYRSKLIVFPRKLSKPK  132

Query  364  AGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
             GDS   EL  A+Q+ GP LPI +   +++   +TD+ K+   +  +R+ R N R +G
Sbjct  133  RGDSDAAELKVASQLAGPILPIRQVHPTIKARAITDEEKTTSVFRSMRIARANARLVG  190



>emb|CAD28610.1| 60S ribosomal protein L13 [Polytomella sp. Pringsheim 198.80]
Length=207

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +K WQ YVKTWFNQ ARK RRR+AR +KA K+FPRP AG+L+PIVHGQT+KYN K+R GR
Sbjct  14   KKKWQFYVKTWFNQAARKLRRRSARAEKAKKVFPRPVAGSLKPIVHGQTVKYNSKLRLGR  73

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GF+L ELK AGI  K APTIGISVD+RRRN S+EGLQ N  RLK Y++ LV+FPR  +K 
Sbjct  74   GFTLAELKEAGIPAKFAPTIGISVDYRRRNKSVEGLQENANRLKAYRSNLVIFPRNVKKP  133

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            KA +++ EE A+A Q  G  LPI R K +VE   +T +MK F AY KLR+ER N R +G
Sbjct  134  KAFEASAEEKASAAQFAGEILPIARCKPTVETAAITAEMKEFNAYAKLRVERMNVRQVG  192



>ref|NP_937786.1| 60S ribosomal protein L13 [Danio rerio]
 ref|XP_005166723.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Danio rerio]
 sp|Q90Z10.3|RL13_DANRE RecName: Full=60S ribosomal protein L13 [Danio rerio]
 gb|AAK63073.1|AF385081_1 60S ribosomal protein L13 [Danio rerio]
 gb|AAS66969.1| ribosomal protein L13 [Danio rerio]
 gb|AAH75977.1| Ribosomal protein L13 [Danio rerio]
Length=211

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 134/182 (74%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP +G LRP+V   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK+A TIGISVD RRRN S E LQANVQRLK Y+ KL++FPR+A K K
Sbjct  76   FTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLIIFPRKAAKPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ+ GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLTGPVMPIKKVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_003056914.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58559.1| predicted protein [Micromonas pusilla CCMP1545]
Length=220

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 127/184 (69%), Gaps = 5/184 (3%)
 Frame = -2

Query  727  RKHWQNY-----VKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMK  563
            +K WQ       VKTWFNQ  RK+ RR AR+KKA  IFPRPTAGALRPIV   T +YN K
Sbjct  14   KKDWQGNAGACRVKTWFNQAGRKKSRRIAREKKAKAIFPRPTAGALRPIVRPPTQRYNFK  73

Query  562  VRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPR  383
             R GRGF+LEELK AGI KKLAPTIGI+VDHRRRN S E L  N +RLK YKA L++FPR
Sbjct  74   TRLGRGFTLEELKVAGIPKKLAPTIGIAVDHRRRNRSEESLALNSKRLKAYKASLILFPR  133

Query  382  RARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNE  203
            R  K K GDS   EL+ A Q+ G  +PI +E   +E V VT +MK FKAY  LR ER N 
Sbjct  134  RTAKPKHGDSEAGELSMAKQLKGKLMPITKETKPLEMVAVTGEMKDFKAYQTLRTERMNV  193

Query  202  RHIG  191
            R +G
Sbjct  194  RQVG  197



>gb|KCW72783.1| hypothetical protein EUGRSUZ_E01232 [Eucalyptus grandis]
Length=154

 Score =   188 bits (477),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 121/168 (72%), Gaps = 31/168 (18%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            RKHWQNY+KT FNQPARK RRR A+QKKAVKIFPRPTA                      
Sbjct  14   RKHWQNYIKTCFNQPARKARRRLAQQKKAVKIFPRPTA----------------------  51

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
                     AGI KKL PTIGI+VDHRR+N SLEGL ANVQRLKTY+AKLVVFP+ ARKF
Sbjct  52   ---------AGIPKKLPPTIGIAVDHRRKNQSLEGLHANVQRLKTYRAKLVVFPKCARKF  102

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  224
            KAG+STPEELA ATQV G YLPI+REK +VE V+VTD+MKSF AY+  
Sbjct  103  KAGNSTPEELANATQVQGTYLPIVREKPAVELVEVTDEMKSFNAYESC  150



>ref|XP_002195773.1| PREDICTED: 60S ribosomal protein L13 isoform 1 [Taeniopygia guttata]
 ref|XP_004176272.1| PREDICTED: 60S ribosomal protein L13 [Taeniopygia guttata]
Length=211

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 128/182 (70%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RR  AR+ K  +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKLRRGKARRNKTRRIAPRPVAGPIRPIVRCPTIRYHKKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y +KL++FPR+    K
Sbjct  76   FSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYHSKLILFPRKPAMPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+PEEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSPEELKMATQLTGPVMPIKNVFKREKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_005052310.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Ficedula albicollis]
 ref|XP_005531944.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Pseudopodoces 
humilis]
 ref|XP_009089034.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Serinus canaria]
Length=211

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 130/182 (71%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKLRRRKARQAKARRIAPRPVAGPIRPIVRCPTIRYHKKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y +KL++FPR+    K
Sbjct  76   FSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYHSKLILFPRKPAMPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+PEEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSPEELKMATQLTGPVMPIKNVFKREKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AEB31272.1| 60S ribosomal protein, partial [Epinephelus bruneus]
Length=211

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLSGPVMPIKTVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_010716479.1| PREDICTED: 60S ribosomal protein L13 [Meleagris gallopavo]
Length=211

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTIRYHKKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+PEEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  LR+ R N R 
Sbjct  136  KGDSSPEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_003382527.1| PREDICTED: 60S ribosomal protein L13-like [Amphimedon queenslandica]
Length=215

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 126/179 (70%), Gaps = 0/179 (0%)
 Frame = -2

Query  727  RKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGR  548
            +KHWQ YVKTWF+QPARK++RR  R KKA K+ PRP  G LRPIVH  T KYNMKVRAG+
Sbjct  15   KKHWQRYVKTWFDQPARKKKRRMNRLKKAAKLAPRPAKGPLRPIVHCPTRKYNMKVRAGK  74

Query  547  GFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKF  368
            GFS EEL+AAGI  ++APTIGISVDHRR N S E LQ NVQRLK YK +L++FPR+ +K 
Sbjct  75   GFSFEELRAAGIPPRVAPTIGISVDHRRHNKSYESLQTNVQRLKEYKTRLILFPRKGKKP  134

Query  367  KAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            +  DS  E    A Q+ GP LPI + +   EF  +TD+ +    ++ LR  + + R +G
Sbjct  135  RKEDSDLEACKLAKQLKGPVLPIRQPRKVFEFRAITDEERKESVFEALRKAKADSRLVG  193



>ref|XP_002154424.1| PREDICTED: 60S ribosomal protein L13-like [Hydra vulgaris]
Length=210

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            KHWQNYV+TWFNQP RK+RRR ARQKKA+ I PRP AG+LRP+V   T KY+ KVR+GRG
Sbjct  14   KHWQNYVRTWFNQPGRKKRRRTARQKKALAIAPRPVAGSLRPVVRCPTFKYHTKVRSGRG  73

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELK A I  + A T+GI+VDHRR+N S E LQANVQRL+ Y++KL++FPR+  K K
Sbjct  74   FTLEELKTAQIKLRFAKTVGIAVDHRRKNKSTESLQANVQRLQEYQSKLIIFPRKQNKPK  133

Query  364  AGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            AGDS    L  ATQ+ GP LPI + K   +   +TD+ +    +  +R+ R N R IG
Sbjct  134  AGDSEASVLTVATQLKGPVLPITQIKTDTKARMITDEERKISVFRSMRVARANARLIG  191



>ref|XP_008286406.1| PREDICTED: 60S ribosomal protein L13 [Stegastes partitus]
Length=211

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLSGPVMPIKTVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>emb|CEF98175.1| Ribosomal protein L13e [Ostreococcus tauri]
Length=221

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 127/176 (72%), Gaps = 1/176 (1%)
 Frame = -2

Query  715  QNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSL  536
            Q  V+TW NQ  RK+ RR AR+ KA K FPRP AGALRPIVH  T +YN K R GRGF+L
Sbjct  24   QCRVRTWLNQAGRKKSRRNARELKAKKTFPRPVAGALRPIVHPPTQRYNFKTRLGRGFTL  83

Query  535  EELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGD  356
            EELKAAGI KKLAPTIGI VDHRRRN S E L  N +RL+ YKAKL++FPR+  K K GD
Sbjct  84   EELKAAGIPKKLAPTIGICVDHRRRNRSEESLALNKKRLEEYKAKLILFPRKNSKPKNGD  143

Query  355  STPEELATATQVNG-PYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            S   +LA ATQ  G   +PI + + +VE V VTD+MK+F AY KLR+ER N R +G
Sbjct  144  SPAADLAAATQHKGQTIMPIEKVEKAVEMVTVTDEMKNFGAYKKLRVERMNVRQVG  199



>ref|NP_990330.1| 60S ribosomal protein L13 [Gallus gallus]
 sp|P41125.2|RL13_CHICK RecName: Full=60S ribosomal protein L13; AltName: Full=Breast 
basic conserved protein 1 [Gallus gallus]
 dbj|BAA05377.1| unnamed protein product [Gallus gallus]
Length=211

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVRYHKKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+PEEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  LR+ R N R 
Sbjct  136  KGDSSPEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_001418121.1| Ribosomal protein L13, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO96414.1| Ribosomal protein L13, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=221

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 1/176 (1%)
 Frame = -2

Query  715  QNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSL  536
            Q  V+TW NQ  RK+ RR AR+ KA K FPRP AG+LRP+VH  T +YN K R GRGF+L
Sbjct  24   QCRVRTWLNQAGRKKSRRNARELKAKKTFPRPVAGSLRPLVHPPTQRYNFKTRLGRGFTL  83

Query  535  EELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGD  356
            EELKAAGI+KK+APTIGI VDHRRRN S E L  N +RL+ YKAKL++FPR+  K K GD
Sbjct  84   EELKAAGISKKMAPTIGICVDHRRRNRSEESLALNKKRLEEYKAKLILFPRKNSKPKHGD  143

Query  355  STPEELATATQVNGP-YLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            S   +LATATQ  G   +PI + + +VE V VTD+MK+F AY KLR+ER N R +G
Sbjct  144  SPAADLATATQHKGSVIMPIEKVEKAVEMVAVTDEMKNFGAYRKLRVERMNVRQVG  199



>emb|CAF99615.1| unnamed protein product [Tetraodon nigroviridis]
Length=211

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPAAGPLRPQVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSEEELKMATQLTGPVMPIKTVHKREKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM90798.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRREARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_004543183.1| PREDICTED: 60S ribosomal protein L13-like isoform X1 [Maylandia 
zebra]
 ref|XP_004543184.1| PREDICTED: 60S ribosomal protein L13-like isoform X2 [Maylandia 
zebra]
 ref|XP_004543185.1| PREDICTED: 60S ribosomal protein L13-like isoform X3 [Maylandia 
zebra]
Length=211

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVR+GRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIRYHTKVRSGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ+ GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLTGPVMPIRTVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_008489456.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Calypte anna]
Length=211

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 130/182 (71%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTIRYHKKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPAMPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSAEELKMATQLTGPIMPIKNVFKREKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM90648.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQQRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM87368.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_009271349.1| PREDICTED: 60S ribosomal protein L13 [Aptenodytes forsteri]
 ref|XP_009475678.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Nipponia nippon]
 ref|XP_010577863.1| PREDICTED: 60S ribosomal protein L13 [Haliaeetus leucocephalus]
 ref|XP_010577864.1| PREDICTED: 60S ribosomal protein L13 [Haliaeetus leucocephalus]
 gb|KFM03354.1| 60S ribosomal protein L13 [Aptenodytes forsteri]
 gb|KFQ93340.1| 60S ribosomal protein L13 [Nipponia nippon]
Length=211

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 130/182 (71%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTIRYHKKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPAMPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSAEELKMATQLTGPVMPIKNVFKREKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_001356321.1| GA18330 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002014440.1| GL18951 [Drosophila persimilis]
 gb|EAL33384.1| GA18330 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW28436.1| GL18951 [Drosophila persimilis]
Length=217

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 128/178 (72%), Gaps = 0/178 (0%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ +VKTWFNQPARK RR   R KKA  +FPRP +GALRP+V   T++Y+ K+R GRG
Sbjct  15   KWWQRHVKTWFNQPARKHRRHENRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRTGRG  74

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELK AG++ K A TIGI+VD RR+N SLE  Q N+QRLK Y++KL++FP   +K +
Sbjct  75   FTLEELKGAGVSAKFAKTIGIAVDFRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR  134

Query  364  AGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
             G+S+ EE   ATQ+ GP +PI  EK  VEF +VT D K FKA+  LR  RT+ R +G
Sbjct  135  KGESSVEECKLATQLRGPIMPIKAEKPVVEFREVTKDEKKFKAFATLRKARTDARLVG  192



>gb|AFM88842.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHAKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM90524.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|NP_001279295.1| ribosomal protein L13 [Callorhinchus milii]
 gb|AFK10534.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85509.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85568.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85759.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85945.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86154.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86270.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86328.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86550.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86703.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86779.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86835.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87213.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87279.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87297.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87356.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87371.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87377.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87462.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87482.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM88692.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89532.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89705.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89736.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89820.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89836.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89903.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89920.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90045.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90135.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90583.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90686.1| 60S ribosomal protein L13 [Callorhinchus milii]
 gb|AFM90856.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM88774.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKRFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_009675145.1| PREDICTED: 60S ribosomal protein L13 [Struthio camelus australis]
Length=204

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  9    KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVRYHTKVRAGRG  68

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  69   FSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  128

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  LR+ R N R 
Sbjct  129  KGDSSAEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFASLRMARANARL  184

Query  196  IG  191
             G
Sbjct  185  FG  186



>ref|XP_005741646.1| PREDICTED: 60S ribosomal protein L13-like [Pundamilia nyererei]
 ref|XP_005929607.1| PREDICTED: 60S ribosomal protein L13-like [Haplochromis burtoni]
Length=211

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ K+R+GRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIRYHTKIRSGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ+ GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLTGPVMPIRTVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_005810478.1| PREDICTED: 60S ribosomal protein L13-like [Xiphophorus maculatus]
 ref|XP_007554204.1| PREDICTED: 60S ribosomal protein L13 [Poecilia formosa]
Length=211

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKVRRRKARQAKARRIAPRPVAGPLRPQVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGI+VD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGIAVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSEEELKMATQLSGPVMPIKTVYKKEKAHV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_006139461.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Pelodiscus sinensis]
Length=211

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP +G +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVSGPIRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEEL+ AGI K +A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELRMAGINKMVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+PEEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSPEELKMATQLSGPVMPIRNVYKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|KFV82308.1| 60S ribosomal protein L13, partial [Struthio camelus australis]
Length=205

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  10   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVRYHTKVRAGRG  69

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  70   FSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  129

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  LR+ R N R 
Sbjct  130  KGDSSAEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFASLRMARANARL  185

Query  196  IG  191
             G
Sbjct  186  FG  187



>ref|XP_001969383.1| GG10074 [Drosophila erecta]
 ref|XP_002036415.1| GM17848 [Drosophila sechellia]
 ref|XP_002089010.1| RpL13 [Drosophila yakuba]
 ref|XP_002078850.1| GD23645 [Drosophila simulans]
 gb|AAR09840.1| similar to Drosophila melanogaster RpL13, partial [Drosophila 
yakuba]
 gb|EDV58442.1| GG10074 [Drosophila erecta]
 gb|EDW52338.1| GM17848 [Drosophila sechellia]
 gb|EDW88722.1| RpL13 [Drosophila yakuba]
 gb|EDX04435.1| GD23645 [Drosophila simulans]
Length=218

 Score =   187 bits (474),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ +VKTWFNQPARK RR A R KKA  +FPRP +GALRP+V   T++Y+ K+RAGRG
Sbjct  15   KWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRAGRG  74

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++KL++FP   +K +
Sbjct  75   FTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR  134

Query  364  AGDSTPEELATATQVNGPYLPILREK-ASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            AG+S+ EE   ATQ+ GP LPI  E+ A VEF +VT D K FKA+  LR  RT+ R +G
Sbjct  135  AGESSLEECKLATQLKGPVLPITNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVG  193



>gb|AFM85620.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86809.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90717.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V F    +D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARVIF----EDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_010743079.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Larimichthys 
crocea]
 ref|XP_010743080.1| PREDICTED: 60S ribosomal protein L13 isoform X2 [Larimichthys 
crocea]
 ref|XP_010743081.1| PREDICTED: 60S ribosomal protein L13 isoform X3 [Larimichthys 
crocea]
Length=211

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP +G LRP V   T++Y+ K RAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPQVRCPTIRYHTKARAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLSGPVMPIKTVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_003442322.1| PREDICTED: 60S ribosomal protein L13-like isoformX1 [Oreochromis 
niloticus]
 ref|XP_005467093.1| PREDICTED: 60S ribosomal protein L13-like isoform X2 [Oreochromis 
niloticus]
 ref|XP_006780193.1| PREDICTED: 60S ribosomal protein L13-like isoform X1 [Neolamprologus 
brichardi]
 ref|XP_006780194.1| PREDICTED: 60S ribosomal protein L13-like isoform X2 [Neolamprologus 
brichardi]
Length=211

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVR+GRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIRYHTKVRSGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EE+  ATQ+ GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEEIKMATQLTGPVMPIRTVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_008403549.1| PREDICTED: 60S ribosomal protein L13 [Poecilia reticulata]
Length=211

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ K+RAGRG
Sbjct  16   KDWQKRVRTWFNQPARKVRRRKARQAKARRIAPRPVAGPLRPQVRCPTIRYHTKIRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGI+VD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGIAVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSEEELKMATQLSGPVMPIKTVYKKEKAHV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|NP_523530.1| ribosomal protein L13, isoform A [Drosophila melanogaster]
 ref|NP_001033891.1| ribosomal protein L13, isoform B [Drosophila melanogaster]
 ref|NP_001260312.1| ribosomal protein L13, isoform C [Drosophila melanogaster]
 sp|P41126.1|RL13_DROME RecName: Full=60S ribosomal protein L13; AltName: Full=BBC1 protein 
homolog [Drosophila melanogaster]
 pdb|3J39|L Chain L, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 emb|CAA54898.1| BBC1 protein [Drosophila melanogaster]
 gb|AAF52842.1| ribosomal protein L13, isoform A [Drosophila melanogaster]
 gb|ABC65888.1| ribosomal protein L13, isoform B [Drosophila melanogaster]
 gb|ACK77643.1| LD24350p [Drosophila melanogaster]
 gb|AEM72508.1| MIP11288p1 [Drosophila melanogaster]
 gb|AGB92847.1| ribosomal protein L13, isoform C [Drosophila melanogaster]
Length=218

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ +VKTWFNQPARK RR A R KKA  +FPRP +GALRP+V   T++Y+ K+RAGRG
Sbjct  15   KWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPTIRYHTKLRAGRG  74

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++KL++FP   +K +
Sbjct  75   FTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSKLILFPINEKKIR  134

Query  364  AGDSTPEELATATQVNGPYLPILREK-ASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
            AG+S+ EE   ATQ+ GP LPI  E+ A VEF +VT D K FKA+  LR  RT+ R +G
Sbjct  135  AGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATLRKARTDARLVG  193



>emb|CDW52162.1| 60S ribosomal protein L13 [Trichuris trichiura]
Length=210

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 124/178 (70%), Gaps = 0/178 (0%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            KHWQ YVKTWFNQP R +RRR  R  KA +I PRP  G LRP+V   T++YN K+R GRG
Sbjct  16   KHWQRYVKTWFNQPMRHRRRRIRRVIKARRIAPRPARGPLRPVVRCPTIRYNQKLRLGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSL+ELKAAGI+KK+APTIGISVDHRRRN SLE +Q NVQRLK Y++KL++FPR+  K +
Sbjct  76   FSLQELKAAGISKKMAPTIGISVDHRRRNKSLESMQQNVQRLKEYRSKLILFPRKMDKPR  135

Query  364  AGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  191
             GDST EE   A Q+ G  +PI R     +   +T   K F AY  +R  R ++R  G
Sbjct  136  KGDSTAEECKLAEQLKGVLMPIKRTIPREKARPITQKEKKFSAYAAVRHARADQRLFG  193



>ref|XP_003970021.1| PREDICTED: 60S ribosomal protein L13-like isoform 1 [Takifugu 
rubripes]
Length=211

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 130/182 (71%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR AR  KA  + PRP AG LRP V   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARLAKARLVAPRPVAGPLRPQVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGI+VD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGIAVDARRRNRSTESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLTGPVMPIKTVHKREKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM87311.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+ FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLITFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_005308237.1| PREDICTED: 60S ribosomal protein L13 [Chrysemys picta bellii]
Length=211

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP +G +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVSGPIRPIVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEEL+ AGI K++A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELRMAGINKRVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+PEEL  ATQ++GP +PI     +EKA V    ++++ K+FKA+  LR+ R N R 
Sbjct  136  KGDSSPEELKMATQLSGPVMPIRNVYKKEKARV----ISEEEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_001366584.1| PREDICTED: 60S ribosomal protein L13 [Monodelphis domestica]
Length=211

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP +G +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ++GP +PI     +EKA V    +T+D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSAEELKLATQLSGPVMPIRNVFKKEKARV----ITEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_008335251.1| PREDICTED: 60S ribosomal protein L13 [Cynoglossus semilaevis]
 ref|XP_008335253.1| PREDICTED: 60S ribosomal protein L13 [Cynoglossus semilaevis]
Length=211

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPIAGPLRPQVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGI+VD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FTLEELKAAGIHKKTARTIGIAVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKTSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLSGPVMPIKTIHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_007059366.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Chelonia mydas]
 gb|EMP36274.1| 60S ribosomal protein L13 [Chelonia mydas]
Length=211

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP +G +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVSGPIRPIVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEEL+ AGI K++A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FTLEELRMAGIHKRVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+PEEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSPEELKMATQLSGPVMPIRNVYKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM86534.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD+ PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDAFPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM89144.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A   LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAIVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|ACH70813.1| ribosomal protein L13 [Salmo salar]
 gb|ACN10085.1| 60S ribosomal protein L13 [Salmo salar]
 gb|ACN12432.1| 60S ribosomal protein L13 [Salmo salar]
Length=211

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++Y+ KVRAGRG
Sbjct  16   KDWQTRVRTWFNQPARKTRRRKARQIKARRIAPRPVAGPLRPQVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            F+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+A   K
Sbjct  76   FTLEELKAAGIHKKTARTIGISVDTRRRNRSSESLQANVQRLKEYRSKLILFPRKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDST EEL  ATQ++G  +PI     +EKA V    +++D K+FKA+  LR+ R N R 
Sbjct  136  KGDSTEEELKMATQLSGAVMPIKNVHKKEKARV----ISEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM87461.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA      +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARA----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM85555.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 132/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ   +TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQKRARTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|NP_001230274.1| ribosomal protein L13 [Sus scrofa]
 pdb|4W20|L Chain L, Structure Of The Mammalian 60s Ribosomal Subunit (this 
Entry Contains The Large Ribosomal Proteins)
 pdb|4W22|L Chain L, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Large Ribosomal Subunit Proteins)
 pdb|4W25|L Chain L, Structure Of The Idle Mammalian Ribosome-sec61 Complex 
(this Entry Contains The Large Ribosomal Subunit Proteins)
 pdb|4W27|L Chain L, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Large Ribosomal Subunit Proteins)
Length=211

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 130/182 (71%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP +G LRP+V   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPLRPVVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEEL+ AGI KK+A TIGISVD RRRN   E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELRVAGIHKKVARTIGISVDPRRRNKCTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ+ GP +PI     REKA V    +TD+ K+FKA+  LR+ R N R 
Sbjct  136  KGDSSAEELKLATQLTGPVMPIRNVYKREKARV----ITDEEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>ref|XP_003758535.1| PREDICTED: 60S ribosomal protein L13 [Sarcophilus harrisii]
Length=211

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP +G +RPIV   T++Y+ KVRAGRG
Sbjct  16   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  76   FSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPSAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ+ GP +PI     +EKA V    +T+D K+FKA+  LR+ R N R 
Sbjct  136  KGDSSAEELKLATQLTGPVMPIRNVFKKEKARV----ITEDEKNFKAFASLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|AFM90194.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K W+  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++Y+ KVRAGRG
Sbjct  16   KDWRKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIRYHTKVRAGRG  75

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL++FP++A   K
Sbjct  76   FSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLIIFPKKASAPK  135

Query  364  AGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  LR+ R N R 
Sbjct  136  KGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVSLRMARANARL  191

Query  196  IG  191
             G
Sbjct  192  FG  193



>gb|KFO77864.1| 60S ribosomal protein L13, partial [Cuculus canorus]
Length=210

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 130/182 (71%), Gaps = 8/182 (4%)
 Frame = -2

Query  724  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  545
            K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++Y+ KVRAGRG
Sbjct  15   KDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTIRYHKKVRAGRG  74

Query  544  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  365
            FSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL++FPR+    K
Sbjct  75   FSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPRKPAMPK  134

Query  364  AGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERH  197
             GDS+ EEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R 
Sbjct  135  KGDSSAEELKLATQLTGPVMPIKNVFKREKARV----ISEDEKNFKAFVSLRMARANARL  190

Query  196  IG  191
             G
Sbjct  191  FG  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455