BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027B22

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO42760.1|  hypothetical protein CISIN_1g014592mg                   281   9e-90   Citrus sinensis [apfelsine]
gb|KDO42759.1|  hypothetical protein CISIN_1g014592mg                   281   1e-89   Citrus sinensis [apfelsine]
ref|XP_006441587.1|  hypothetical protein CICLE_v10020303mg             281   2e-89   Citrus clementina [clementine]
ref|XP_007041181.1|  Elongation factor 1-gamma 3 isoform 1              280   8e-89   Theobroma cacao [chocolate]
gb|AFK34308.1|  unknown                                                 279   1e-88   Medicago truncatula
ref|XP_003592901.1|  Elongation factor 1-gamma                          278   2e-88   Medicago truncatula
ref|XP_010683294.1|  PREDICTED: elongation factor 1-gamma 2-like        278   2e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003592902.1|  Elongation factor 1-gamma                          278   2e-88   
ref|XP_010686883.1|  PREDICTED: elongation factor 1-gamma-like          278   2e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH34076.1|  translation elongation factor EF1B, gamma chain         277   7e-88   Medicago truncatula
ref|XP_010030200.1|  PREDICTED: elongation factor 1-gamma               277   7e-88   Eucalyptus grandis [rose gum]
ref|XP_004485430.1|  PREDICTED: elongation factor 1-gamma-like is...    277   8e-88   Cicer arietinum [garbanzo]
gb|ACU24330.1|  unknown                                                 271   9e-88   Glycine max [soybeans]
ref|XP_009774942.1|  PREDICTED: elongation factor 1-gamma 2-like ...    276   1e-87   Nicotiana sylvestris
ref|XP_009610260.1|  PREDICTED: elongation factor 1-gamma 2-like ...    276   2e-87   Nicotiana tomentosiformis
ref|XP_009610261.1|  PREDICTED: elongation factor 1-gamma 2-like ...    276   2e-87   Nicotiana tomentosiformis
ref|XP_009774948.1|  PREDICTED: elongation factor 1-gamma 2-like ...    276   2e-87   Nicotiana sylvestris
ref|XP_006478210.1|  PREDICTED: elongation factor 1-gamma-like          276   2e-87   Citrus sinensis [apfelsine]
ref|XP_002264400.1|  PREDICTED: elongation factor 1-gamma-like          276   2e-87   Vitis vinifera
ref|XP_007222556.1|  hypothetical protein PRUPE_ppa006233mg             276   2e-87   
dbj|BAP19108.1|  elongation factor 1 gamma-like protein                 267   2e-87   Ipomoea nil [qian niu]
ref|XP_010553691.1|  PREDICTED: probable elongation factor 1-gamma 2    275   3e-87   Tarenaya hassleriana [spider flower]
gb|ACB72462.1|  elongation factor 1 gamma-like protein                  275   3e-87   Nicotiana tabacum [American tobacco]
ref|XP_008219063.1|  PREDICTED: elongation factor 1-gamma-like          275   3e-87   Prunus mume [ume]
ref|XP_002526432.1|  elongation factor 1 gamma, putative                271   4e-87   Ricinus communis
ref|XP_010544111.1|  PREDICTED: probable elongation factor 1-gamma 2    275   4e-87   Tarenaya hassleriana [spider flower]
ref|XP_008456982.1|  PREDICTED: elongation factor 1-gamma-like          275   5e-87   Cucumis melo [Oriental melon]
ref|XP_011047878.1|  PREDICTED: elongation factor 1-gamma               275   5e-87   Populus euphratica
ref|XP_009759974.1|  PREDICTED: elongation factor 1-gamma 2-like ...    275   5e-87   Nicotiana sylvestris
ref|XP_009759973.1|  PREDICTED: elongation factor 1-gamma 2-like ...    275   6e-87   Nicotiana sylvestris
ref|XP_007153909.1|  hypothetical protein PHAVU_003G075200g             275   6e-87   Phaseolus vulgaris [French bean]
emb|CDP10743.1|  unnamed protein product                                274   9e-87   Coffea canephora [robusta coffee]
gb|ADB11388.1|  gamma class glutathione transferase EF1Bgamma3          274   9e-87   Populus trichocarpa [western balsam poplar]
ref|XP_007148576.1|  hypothetical protein PHAVU_006G220100g             274   9e-87   Phaseolus vulgaris [French bean]
emb|CAN75785.1|  hypothetical protein VITISV_021574                     274   1e-86   Vitis vinifera
ref|XP_008378997.1|  PREDICTED: elongation factor 1-gamma               265   1e-86   
gb|KJB47884.1|  hypothetical protein B456_008G046300                    268   1e-86   Gossypium raimondii
ref|XP_006600242.1|  PREDICTED: elongation factor 1-gamma isoform X1    274   1e-86   
gb|AHZ94964.1|  elongation factor 1                                     273   1e-86   Lilium regale
gb|ACA50518.1|  elongation factor 1-gamma                               273   2e-86   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ85171.1|  unknown                                                 273   2e-86   Medicago truncatula
ref|NP_001046318.1|  Os02g0220600                                       273   2e-86   
ref|XP_010272551.1|  PREDICTED: elongation factor 1-gamma-like is...    273   2e-86   Nelumbo nucifera [Indian lotus]
gb|KEH32761.1|  translation elongation factor EF1B, gamma chain         271   3e-86   Medicago truncatula
gb|KJB47885.1|  hypothetical protein B456_008G046300                    270   3e-86   Gossypium raimondii
ref|XP_006647077.1|  PREDICTED: elongation factor 1-gamma 2-like        273   3e-86   Oryza brachyantha
gb|KEH32762.1|  translation elongation factor EF1B, gamma chain         273   4e-86   Medicago truncatula
ref|XP_008452240.1|  PREDICTED: elongation factor 1-gamma-like          272   4e-86   Cucumis melo [Oriental melon]
ref|XP_004155227.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    272   4e-86   
gb|ABA81876.1|  unknown                                                 272   5e-86   Solanum tuberosum [potatoes]
ref|NP_001046317.1|  Os02g0220500                                       272   5e-86   
sp|Q6YW46.2|EF1G2_ORYSJ  RecName: Full=Elongation factor 1-gamma ...    272   5e-86   Oryza sativa Japonica Group [Japonica rice]
gb|KHN39680.1|  Elongation factor 1-gamma                               269   5e-86   Glycine soja [wild soybean]
ref|XP_008452241.1|  PREDICTED: elongation factor 1-gamma-like          272   6e-86   Cucumis melo [Oriental melon]
ref|XP_010242290.1|  PREDICTED: elongation factor 1-gamma-like          272   7e-86   Nelumbo nucifera [Indian lotus]
gb|AAO72574.1|  elongation factor 1 gamma-like protein                  271   7e-86   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010272550.1|  PREDICTED: elongation factor 1-gamma-like is...    274   8e-86   Nelumbo nucifera [Indian lotus]
gb|KHN03584.1|  Elongation factor 1-gamma                               272   8e-86   Glycine soja [wild soybean]
ref|NP_001274793.1|  elongation factor 1-gamma 2-like                   271   9e-86   Solanum tuberosum [potatoes]
gb|EEE56572.1|  hypothetical protein OsJ_05923                          273   9e-86   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72757.1|  hypothetical protein OsI_06402                          273   9e-86   Oryza sativa Indica Group [Indian rice]
gb|KJB47897.1|  hypothetical protein B456_008G046200                    271   9e-86   Gossypium raimondii
gb|AIZ68134.1|  translation elongation factor 1-gamma                   271   1e-85   Ornithogalum longebracteatum [sea-onion]
ref|XP_010928857.1|  PREDICTED: elongation factor 1-gamma 2             271   1e-85   Elaeis guineensis
ref|XP_006339362.1|  PREDICTED: elongation factor 1-gamma 2-like ...    271   1e-85   Solanum tuberosum [potatoes]
ref|XP_004133719.1|  PREDICTED: elongation factor 1-gamma-like          271   1e-85   
ref|XP_006339363.1|  PREDICTED: elongation factor 1-gamma 2-like ...    271   1e-85   Solanum tuberosum [potatoes]
ref|XP_006385057.1|  elongation factor 1-gamma 1 family protein         271   1e-85   Populus trichocarpa [western balsam poplar]
ref|XP_010907209.1|  PREDICTED: elongation factor 1-gamma 2-like        271   1e-85   Elaeis guineensis
gb|KHG12420.1|  hypothetical protein F383_17048                         271   1e-85   Gossypium arboreum [tree cotton]
ref|XP_002325529.1|  hypothetical protein POPTR_0019s10560g             271   1e-85   Populus trichocarpa [western balsam poplar]
gb|KJB47883.1|  hypothetical protein B456_008G046300                    271   1e-85   Gossypium raimondii
ref|NP_001242737.1|  uncharacterized protein LOC100810452               271   2e-85   
gb|KHN40193.1|  Elongation factor 1-gamma                               271   2e-85   Glycine soja [wild soybean]
ref|XP_006389499.1|  elongation factor 1-gamma 1 family protein         271   2e-85   
gb|KHG04277.1|  hypothetical protein F383_29497                         271   2e-85   Gossypium arboreum [tree cotton]
emb|CBI29690.3|  unnamed protein product                                271   2e-85   Vitis vinifera
ref|XP_008789740.1|  PREDICTED: elongation factor 1-gamma 1 isofo...    270   2e-85   
ref|XP_011028370.1|  PREDICTED: elongation factor 1-gamma 2-like        271   2e-85   Populus euphratica
ref|XP_011031541.1|  PREDICTED: elongation factor 1-gamma-like          271   2e-85   Populus euphratica
gb|KDO40980.1|  hypothetical protein CISIN_1g021153mg                   266   2e-85   Citrus sinensis [apfelsine]
gb|AFW71312.1|  hypothetical protein ZEAMMB73_547198                    267   2e-85   
ref|XP_011074970.1|  PREDICTED: elongation factor 1-gamma-like          271   2e-85   Sesamum indicum [beniseed]
ref|NP_001241223.1|  uncharacterized protein LOC100787125               271   2e-85   Glycine max [soybeans]
ref|XP_008789739.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    271   2e-85   Phoenix dactylifera
gb|ADR70876.1|  eukaryotic translation elongation factor 1B gamma...    270   3e-85   Hevea brasiliensis [jebe]
gb|EYU22759.1|  hypothetical protein MIMGU_mgv1a007114mg                270   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_008804357.1|  PREDICTED: elongation factor 1-gamma 2-like        271   3e-85   Phoenix dactylifera
gb|KDO40983.1|  hypothetical protein CISIN_1g021153mg                   265   4e-85   Citrus sinensis [apfelsine]
ref|XP_004240589.1|  PREDICTED: elongation factor 1-gamma 2-like        270   5e-85   Solanum lycopersicum
ref|XP_004294500.1|  PREDICTED: elongation factor 1-gamma-like          270   5e-85   Fragaria vesca subsp. vesca
gb|KDO40981.1|  hypothetical protein CISIN_1g021153mg                   266   5e-85   Citrus sinensis [apfelsine]
ref|XP_004966044.1|  PREDICTED: elongation factor 1-gamma 3-like        269   6e-85   Setaria italica
ref|XP_002278756.2|  PREDICTED: elongation factor 1-gamma               270   6e-85   Vitis vinifera
ref|XP_004966045.1|  PREDICTED: elongation factor 1-gamma 3-like        269   6e-85   Setaria italica
ref|XP_004250641.1|  PREDICTED: elongation factor 1-gamma 2-like ...    269   8e-85   Solanum lycopersicum
ref|XP_008677347.1|  PREDICTED: elongation factor 1-gamma 2 isofo...    269   8e-85   
ref|XP_006392372.1|  hypothetical protein EUTSA_v10023493mg             267   8e-85   
ref|NP_001131533.1|  uncharacterized protein LOC100192872               265   8e-85   
ref|XP_004951452.1|  PREDICTED: elongation factor 1-gamma 2-like        269   9e-85   Setaria italica
ref|XP_004250642.1|  PREDICTED: elongation factor 1-gamma 2-like ...    269   9e-85   Solanum lycopersicum
ref|XP_003540135.1|  PREDICTED: elongation factor 1-gamma-like          269   1e-84   
ref|XP_008643919.1|  PREDICTED: uncharacterized protein LOC100381...    268   1e-84   
ref|XP_008352808.1|  PREDICTED: elongation factor 1-gamma-like          269   1e-84   
gb|KDP42461.1|  hypothetical protein JCGZ_00258                         269   1e-84   Jatropha curcas
ref|XP_002451782.1|  hypothetical protein SORBIDRAFT_04g007760          268   2e-84   Sorghum bicolor [broomcorn]
ref|XP_009355338.1|  PREDICTED: elongation factor 1-gamma               268   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_006392370.1|  hypothetical protein EUTSA_v10023493mg             268   3e-84   Eutrema salsugineum [saltwater cress]
ref|XP_009353791.1|  PREDICTED: elongation factor 1-gamma               268   3e-84   Pyrus x bretschneideri [bai li]
ref|XP_009362385.1|  PREDICTED: elongation factor 1-gamma-like          268   3e-84   Pyrus x bretschneideri [bai li]
gb|AFW76477.1|  elongation factor gamma1                                263   3e-84   
ref|XP_006431568.1|  hypothetical protein CICLE_v10003566mg             268   3e-84   Citrus clementina [clementine]
ref|XP_009417204.1|  PREDICTED: elongation factor 1-gamma 2-like        267   4e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84953.1|  unknown                                                 258   4e-84   Medicago truncatula
ref|XP_008365322.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    267   5e-84   
ref|XP_006494223.1|  PREDICTED: elongation factor 1-gamma 3-like ...    267   5e-84   Citrus sinensis [apfelsine]
ref|XP_010101278.1|  Elongation factor 1-gamma                          268   6e-84   
gb|ACU24584.1|  unknown                                                 267   6e-84   Glycine max [soybeans]
gb|AFW87006.1|  hypothetical protein ZEAMMB73_710904                    266   6e-84   
ref|XP_002438602.1|  hypothetical protein SORBIDRAFT_10g022570          267   6e-84   Sorghum bicolor [broomcorn]
gb|AFW76480.1|  elongation factor gamma1                                266   7e-84   
ref|NP_001151229.1|  elongation factor 1-gamma 2                        266   8e-84   Zea mays [maize]
ref|XP_004300001.1|  PREDICTED: elongation factor 1-gamma-like          266   9e-84   Fragaria vesca subsp. vesca
ref|NP_001148829.1|  elongation factor 1-gamma 3                        266   9e-84   Zea mays [maize]
ref|XP_006845799.1|  hypothetical protein AMTR_s00019p00255470          267   9e-84   
dbj|BAD94347.1|  hypothetical protein                                   257   1e-83   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22629.1|  BnaC08g42630D                                          266   1e-83   Brassica napus [oilseed rape]
emb|CDY31074.1|  BnaA08g26240D                                          266   1e-83   Brassica napus [oilseed rape]
ref|XP_008647353.1|  PREDICTED: uncharacterized protein LOC100192...    266   1e-83   
ref|XP_008218698.1|  PREDICTED: elongation factor 1-gamma-like          266   2e-83   Prunus mume [ume]
gb|ACG36145.1|  elongation factor 1-gamma 3                             266   2e-83   Zea mays [maize]
ref|XP_004308137.1|  PREDICTED: elongation factor 1-gamma-like is...    266   2e-83   Fragaria vesca subsp. vesca
emb|CDX93494.1|  BnaA06g05540D                                          265   2e-83   
ref|XP_008218696.1|  PREDICTED: elongation factor 1-gamma               266   2e-83   Prunus mume [ume]
ref|XP_009110814.1|  PREDICTED: probable elongation factor 1-gamma 1    265   2e-83   Brassica rapa
ref|XP_009418787.1|  PREDICTED: elongation factor 1-gamma 2-like        266   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67955.1|  elongation factor 1 gamma-like protein                  266   2e-83   Genlisea aurea
ref|XP_006417552.1|  hypothetical protein EUTSA_v10007759mg             265   3e-83   Eutrema salsugineum [saltwater cress]
ref|XP_009148264.1|  PREDICTED: probable elongation factor 1-gamma 1    265   5e-83   Brassica rapa
ref|XP_008339412.1|  PREDICTED: elongation factor 1-gamma               265   5e-83   
ref|XP_011470423.1|  PREDICTED: elongation factor 1-gamma-like is...    266   5e-83   Fragaria vesca subsp. vesca
gb|AAL87298.1|  unknown protein                                         262   6e-83   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06365.1|  BnaA09g48380D                                          264   7e-83   
emb|CDY50887.1|  BnaCnng19790D                                          264   7e-83   Brassica napus [oilseed rape]
ref|XP_009118302.1|  PREDICTED: probable elongation factor 1-gamma 1    264   8e-83   Brassica rapa
gb|AAO72563.1|  elongation factor 1 gamma-like protein                  264   1e-82   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057916.1|  Os06g0571400                                       263   1e-82   
ref|XP_006302321.1|  hypothetical protein CARUB_v10020374mg             263   1e-82   Capsella rubella
gb|EYU28215.1|  hypothetical protein MIMGU_mgv1a007176mg                263   1e-82   Erythranthe guttata [common monkey flower]
sp|Q9FUM1.1|EF1G_PRUAV  RecName: Full=Elongation factor 1-gamma; ...    263   1e-82   Prunus avium [gean]
ref|XP_010511351.1|  PREDICTED: probable elongation factor 1-gamma 2    263   1e-82   Camelina sativa [gold-of-pleasure]
ref|NP_563848.1|  elongation factor EF-1 gamma subunit                  263   1e-82   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ37421.1|  hypothetical protein OsJ_21756                          264   2e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010470318.1|  PREDICTED: probable elongation factor 1-gamma 2    263   2e-82   Camelina sativa [gold-of-pleasure]
ref|XP_007222927.1|  hypothetical protein PRUPE_ppa005220mg             265   2e-82   Prunus persica
ref|XP_006307657.1|  hypothetical protein CARUB_v10009284mg             263   2e-82   Capsella rubella
ref|XP_010490215.1|  PREDICTED: probable elongation factor 1-gamma 1    263   2e-82   Camelina sativa [gold-of-pleasure]
ref|XP_006656177.1|  PREDICTED: elongation factor 1-gamma 3-like        263   2e-82   
ref|NP_176084.1|  elongation factor EF-1 gamma subunit                  263   2e-82   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59587.1|  putative elongation factor 1B gamma                     263   2e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892012.1|  hypothetical protein ARALYDRAFT_474857             262   3e-82   
emb|CBI29691.3|  unnamed protein product                                253   3e-82   Vitis vinifera
ref|XP_002889762.1|  hypothetical protein ARALYDRAFT_471063             262   5e-82   
ref|XP_010475805.1|  PREDICTED: probable elongation factor 1-gamm...    262   7e-82   
gb|AGC13144.1|  EF1Bgamma class glutathione S-transferase               260   2e-81   Pinus tabuliformis [southern Chinese pine]
ref|XP_003563720.1|  PREDICTED: elongation factor 1-gamma 3             260   3e-81   Brachypodium distachyon [annual false brome]
ref|XP_010475804.1|  PREDICTED: probable elongation factor 1-gamm...    259   4e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010458260.1|  PREDICTED: probable elongation factor 1-gamma 1    258   1e-80   Camelina sativa [gold-of-pleasure]
gb|AHC03515.1|  gamma class glutathione S-transferase                   258   1e-80   Larix kaempferi [karamatsu]
emb|CDY20681.1|  BnaC08g13770D                                          261   2e-80   Brassica napus [oilseed rape]
ref|XP_003571724.1|  PREDICTED: elongation factor 1-gamma 2             257   3e-80   Brachypodium distachyon [annual false brome]
gb|ABK25057.1|  unknown                                                 256   9e-80   Picea sitchensis
ref|NP_001235707.1|  elongation factor 1-gamma                          256   1e-79   
gb|EMT01475.1|  Elongation factor 1-gamma 2                             259   4e-79   
gb|KGN56266.1|  hypothetical protein Csa_3G110630                       252   3e-78   
gb|EMS60520.1|  Elongation factor 1-gamma 2                             245   2e-75   Triticum urartu
gb|EMT20600.1|  Elongation factor 1-gamma 2                             244   3e-75   
gb|AIW07751.1|  elongation factor subfamily 1b subunit gamma            236   3e-75   Pinus krempfii
gb|AIW07759.1|  elongation factor subfamily 1b subunit gamma            236   4e-75   Pinus krempfii
gb|EEC80835.1|  hypothetical protein OsI_23436                          244   1e-74   Oryza sativa Indica Group [Indian rice]
gb|AIW07777.1|  elongation factor subfamily 1b subunit gamma            235   1e-74   Pinus krempfii
dbj|BAH56923.1|  AT1G57720                                              213   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099002.1|  PREDICTED: elongation factor 1-gamma 2-like        211   2e-62   Sesamum indicum [beniseed]
ref|XP_002973046.1|  hypothetical protein SELMODRAFT_98733              211   3e-62   
ref|XP_002984514.1|  hypothetical protein SELMODRAFT_156635             210   6e-62   Selaginella moellendorffii
gb|AFP90271.1|  elongation factor 1-gamma 1                             200   8e-62   Pinus yunnanensis [Yunnan pine]
gb|AFP90278.1|  elongation factor 1-gamma 1                             200   9e-62   Pinus yunnanensis [Yunnan pine]
gb|AFP90281.1|  elongation factor 1-gamma 1                             199   2e-61   Pinus yunnanensis [Yunnan pine]
gb|AFP90241.1|  elongation factor 1-gamma 1                             199   2e-61   Pinus tabuliformis [southern Chinese pine]
gb|AFP90247.1|  elongation factor 1-gamma 1                             199   2e-61   Pinus tabuliformis [southern Chinese pine]
gb|AFP90268.1|  elongation factor 1-gamma 1                             198   4e-61   Pinus densata
gb|AFP90255.1|  elongation factor 1-gamma 1                             198   5e-61   Pinus tabuliformis [southern Chinese pine]
gb|AFP90265.1|  elongation factor 1-gamma 1                             198   6e-61   Pinus densata
gb|AFP90276.1|  elongation factor 1-gamma 1                             197   7e-61   Pinus densata
gb|AFP90258.1|  elongation factor 1-gamma 1                             197   1e-60   Pinus densata
gb|AFP90264.1|  elongation factor 1-gamma 1                             196   2e-60   Pinus densata
gb|AFP90253.1|  elongation factor 1-gamma 1                             196   2e-60   Pinus tabuliformis [southern Chinese pine]
gb|AFP90244.1|  elongation factor 1-gamma 1                             196   3e-60   Pinus densata
gb|AFP90275.1|  elongation factor 1-gamma 1                             196   4e-60   Pinus densata
gb|AFP90254.1|  elongation factor 1-gamma 1                             196   4e-60   Pinus tabuliformis [southern Chinese pine]
gb|AFP90246.1|  elongation factor 1-gamma 1                             196   4e-60   Pinus densata
gb|AFP90282.1|  elongation factor 1-gamma 1                             195   6e-60   Pinus densata
ref|XP_001771013.1|  predicted protein                                  204   1e-59   
ref|XP_001758671.1|  predicted protein                                  202   7e-59   
ref|XP_001774148.1|  predicted protein                                  202   7e-59   
ref|XP_004172027.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    199   2e-58   
gb|KGN56265.1|  hypothetical protein Csa_3G110620                       194   4e-56   
ref|XP_004134257.1|  PREDICTED: elongation factor 1-gamma-like          187   7e-54   
dbj|BAD94101.1|  hypothetical protein                                   170   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001167773.1|  hypothetical protein                               165   2e-48   
gb|ABR25394.1|  elongation factor 1-gamma 3                             156   4e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_007041191.1|  Elongation factor 1-gamma 3, putative              145   5e-39   
ref|XP_005645852.1|  glutathione S-transferase                          138   1e-34   Coccomyxa subellipsoidea C-169
ref|XP_004341586.1|  elongation factor 1-gamma family protein           124   6e-30   Acanthamoeba castellanii str. Neff
gb|ETL96568.1|  hypothetical protein L917_05966                         115   1e-28   Phytophthora parasitica
gb|EXX52334.1|  Tef4p                                                   117   6e-28   Rhizophagus irregularis DAOM 197198w
gb|ETM49712.1|  hypothetical protein L914_06089                         115   8e-28   Phytophthora parasitica
ref|NP_001184949.1|  elongation factor EF-1 gamma subunit               116   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ESA05922.1|  hypothetical protein GLOINDRAFT_349960                  118   1e-27   
gb|ETK89973.1|  hypothetical protein L915_06156                         114   3e-27   Phytophthora parasitica
emb|CBK20805.2|  unnamed protein product                                113   1e-26   Blastocystis hominis
emb|CCI44608.1|  unnamed protein product                                115   2e-26   Albugo candida
ref|XP_008867564.1|  hypothetical protein H310_04829                    114   3e-26   Aphanomyces invadans
gb|ETK89994.1|  hypothetical protein L915_06152                         114   3e-26   Phytophthora parasitica
ref|XP_008891718.1|  hypothetical protein PPTG_02398                    114   3e-26   Phytophthora parasitica INRA-310
gb|ETP19871.1|  hypothetical protein F441_06281                         114   3e-26   Phytophthora parasitica CJ01A1
ref|XP_002901767.1|  elongation factor 1-gamma, putative                114   3e-26   Phytophthora infestans T30-4
emb|CDH60277.1|  elongation factor 1 gamma domain-containingprotein     113   7e-26   Lichtheimia corymbifera JMRC:FSU:9682
emb|CBK21757.2|  unnamed protein product                                113   7e-26   Blastocystis hominis
ref|XP_002901771.1|  elongation factor 1-gamma, putative                112   1e-25   Phytophthora infestans T30-4
emb|CCA15330.1|  calciumdependent protein 1 putative                    112   1e-25   Albugo laibachii Nc14
ref|XP_009519315.1|  hypothetical protein PHYSODRAFT_284839             112   1e-25   Phytophthora sojae
ref|XP_006680023.1|  hypothetical protein BATDEDRAFT_37118              112   1e-25   Batrachochytrium dendrobatidis JAM81
ref|XP_009519320.1|  hypothetical protein PHYSODRAFT_359164             112   2e-25   Phytophthora sojae
emb|CDS05969.1|  hypothetical protein LRAMOSA08497                      111   3e-25   Lichtheimia ramosa
ref|XP_001562716.1|  elongation factor-1 gamma                          110   5e-25   Leishmania braziliensis MHOM/BR/75/M2904
gb|EPY23706.1|  elongation factor 1-gamma                               107   2e-24   Strigomonas culicis
emb|CEP19706.1|  hypothetical protein                                   108   3e-24   Parasitella parasitica
gb|EPY29488.1|  elongation factor 1-gamma                               108   5e-24   Strigomonas culicis
ref|XP_003872780.1|  elongation factor-1 gamma                          107   6e-24   Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_010704334.1|  elongation factor-1 gamma                          107   6e-24   Leishmania panamensis
gb|EPY20606.1|  elongation factor 1-gamma                               108   6e-24   Strigomonas culicis
gb|AAS55635.1|  elongation factor 1B gamma 2                            105   2e-23   Crithidia fasciculata
emb|CCC95849.1|  unnamed protein product                                105   3e-23   Trypanosoma congolense IL3000
gb|KEQ85130.1|  eEF1-gamma domain-containing protein                    105   3e-23   Aureobasidium pullulans EXF-150
emb|CAC35543.1|  elongation factor-1 gamma                              105   3e-23   Leishmania infantum
ref|XP_001463560.1|  elongation factor-1 gamma                          105   4e-23   Leishmania infantum JPCM5
ref|XP_003858781.1|  elongation factor-1 gamma                          105   4e-23   Leishmania donovani
emb|CDS12960.1|  hypothetical protein LRAMOSA05144                      105   4e-23   Lichtheimia ramosa
ref|XP_001463559.1|  elongation factor-1 gamma                          105   5e-23   Leishmania infantum JPCM5
emb|CCC95841.1|  unnamed protein product                                105   5e-23   Trypanosoma congolense IL3000
ref|XP_001681271.1|  elongation factor-1 gamma                          104   6e-23   Leishmania major strain Friedlin
gb|KEQ58308.1|  eEF1-gamma domain-containing protein                    104   7e-23   Aureobasidium melanogenum CBS 110374
sp|P34715.1|EF1G_TRYCR  RecName: Full=Elongation factor 1-gamma; ...    104   9e-23   Trypanosoma cruzi
emb|CAF94681.1|  unnamed protein product                                101   9e-23   Tetraodon nigroviridis
emb|CDO76003.1|  hypothetical protein BN946_scf184780.g10               104   1e-22   Trametes cinnabarina
gb|EPY38232.1|  elongation factor 1-gamma                               103   1e-22   Angomonas deanei
ref|XP_009825362.1|  hypothetical protein H257_03107                    103   2e-22   Aphanomyces astaci
gb|EPB91935.1|  hypothetical protein HMPREF1544_01229                   103   2e-22   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004353907.1|  glutathione S-transferase domain-containing ...    103   2e-22   Cavenderia fasciculata
gb|EPY35420.1|  elongation factor 1-gamma                               103   2e-22   Angomonas deanei
gb|EPY35413.1|  elongation factor 1-gamma                               103   2e-22   Angomonas deanei
ref|XP_007367152.1|  elongation factor 1-gamma                          103   2e-22   Dichomitus squalens LYAD-421 SS1
gb|EPY28959.1|  elongation factor 1-gamma                               103   2e-22   Angomonas deanei
gb|EFA79702.1|  glutathione S-transferase domain-containing protein     103   2e-22   Heterostelium album PN500
gb|EKG02410.1|  elongation factor 1-gamma (EF-1-gamma), putative        103   3e-22   Trypanosoma cruzi
ref|XP_806964.1|  elongation factor 1-gamma (EF-1-gamma)                103   3e-22   Trypanosoma cruzi strain CL Brener
emb|CDH55788.1|  elongation factor 1-gamma                              102   3e-22   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009040775.1|  hypothetical protein AURANDRAFT_70385              102   3e-22   Aureococcus anophagefferens
emb|CBJ27519.1|  eukaryotic elongation factor-1 B gamma                 102   5e-22   Ectocarpus siliculosus
emb|CEG74026.1|  hypothetical protein RMATCC62417_09299                 102   5e-22   Rhizopus microsporus
emb|CEI89465.1|  hypothetical protein RMCBS344292_03820                 102   5e-22   Rhizopus microsporus
emb|CEI97373.1|  hypothetical protein RMCBS344292_11508                 102   5e-22   Rhizopus microsporus
ref|XP_009041108.1|  hypothetical protein AURANDRAFT_39051              102   5e-22   Aureococcus anophagefferens
gb|EXX52333.1|  Tef4p                                                   101   5e-22   Rhizophagus irregularis DAOM 197198w
gb|EKF26874.1|  elongation factor 1-gamma (EF-1-gamma), putative      99.4    6e-22   Trypanosoma cruzi marinkellei
gb|EIE88418.1|  hypothetical protein RO3G_13129                         102   6e-22   Rhizopus delemar RA 99-880
ref|XP_002371737.1|  elongation factor 1-gamma, putative                102   6e-22   Toxoplasma gondii ME49
gb|ELU41062.1|  elongation factor 1-gamma                               104   6e-22   Rhizoctonia solani AG-1 IA
ref|XP_829366.1|  elongation factor 1 gamma                             102   6e-22   
emb|CBH18353.1|  elongation factor 1 gamma, putative                    101   7e-22   
gb|ESL05599.1|  elongation factor 1-gamma                               102   7e-22   
dbj|GAM21220.1|  hypothetical protein SAMD00019534_043950               102   7e-22   
emb|CCW66695.1|  unnamed protein product                                101   7e-22   
ref|XP_008888397.1|  elongation factor 1-gamma, putative                101   8e-22   
ref|XP_003677986.1|  hypothetical protein NCAS_0H03290                  101   8e-22   
emb|CDH55787.1|  elongation factor 1-gamma                              102   8e-22   
ref|XP_008365338.1|  PREDICTED: elongation factor 1-gamma-like          101   8e-22   
ref|XP_009314156.1|  putative elongation factor 1-gamma (EF-1-gamma)    101   8e-22   
ref|XP_003675590.1|  hypothetical protein NCAS_0C02340                  101   9e-22   
emb|CCW64576.1|  unnamed protein product                                101   1e-21   
gb|AAD54312.1|  elongation factor eEF1 gamma chain                    95.1    1e-21   
gb|AAS55634.1|  elongation factor 1B gamma 1                            100   1e-21   
gb|EPB85278.1|  hypothetical protein HMPREF1544_07959                   100   1e-21   
emb|CBH18338.1|  elongation factor 1 gamma, putative                    101   1e-21   
ref|XP_007736285.1|  elongation factor 1-gamma                          100   1e-21   
gb|EIE85200.1|  hypothetical protein RO3G_09910                         100   2e-21   
ref|XP_009157113.1|  elongation factor EF-1 gamma subunit               100   2e-21   
ref|XP_003679479.1|  elongation factor 1 gamma domain-containing ...    100   2e-21   
emb|CCC53922.1|  putative elongation factor 1 gamma                     100   2e-21   
ref|XP_829376.1|  elongation factor 1 gamma                             101   2e-21   
ref|XP_007727684.1|  elongation factor 1-gamma                          100   3e-21   
ref|XP_007375336.1|  hypothetical protein SPAPADRAFT_61149              100   3e-21   
gb|KEQ93378.1|  hypothetical protein AUEXF2481DRAFT_42115               100   3e-21   
ref|XP_007755740.1|  elongation factor 1-gamma                        99.8    4e-21   
ref|XP_002419498.1|  elongation factor 1 gamma domain-containing ...  99.8    4e-21   
gb|KEQ75846.1|  eEF1-gamma domain-containing protein                  99.8    4e-21   
gb|KIW17213.1|  hypothetical protein PV08_04404                       99.4    5e-21   
ref|XP_007387562.1|  elongation factor 1-gamma                        99.4    5e-21   
ref|XP_002420602.1|  elongation factor 1 gamma domain-containing ...  99.0    7e-21   
gb|KGR09240.1|  elongation factor 1-gamma                             99.0    7e-21   
gb|EEQ44636.1|  elongation factor 1-gamma 1                           99.0    7e-21   
ref|XP_001382613.1|  elongation factor 1 gamma domain-containing ...  99.0    7e-21   
gb|ABG88953.1|  elongation factor-1 gamma                             99.0    8e-21   
ref|XP_001524775.1|  conserved hypothetical protein                   99.0    8e-21   
ref|XP_001526253.1|  elongation factor 1-gamma 1                      98.6    9e-21   
emb|CDH55790.1|  glutathione s-transferase                            97.8    9e-21   
gb|KGR05763.1|  elongation factor 1-gamma                             98.6    9e-21   
gb|KGU06197.1|  elongation factor 1-gamma                             98.6    9e-21   
gb|ABG88954.1|  elongation factor-1 gamma                             99.0    9e-21   
ref|XP_712054.1|  potential translation elongation factor Cam1p       98.6    1e-20   
gb|KGQ91245.1|  elongation factor 1-gamma                             98.6    1e-20   
gb|KGU26884.1|  elongation factor 1-gamma                             98.6    1e-20   
gb|KGU06273.1|  elongation factor 1-gamma                             98.6    1e-20   
gb|KHC32906.1|  elongation factor 1-gamma                             98.6    1e-20   
gb|KGR11185.1|  elongation factor 1-gamma                             98.6    1e-20   
gb|KGQ84572.1|  elongation factor 1-gamma                             98.6    1e-20   
gb|KHC32837.1|  elongation factor 1-gamma                             98.6    1e-20   
gb|EEQ46357.1|  conserved hypothetical protein                        98.6    1e-20   
ref|XP_002618567.1|  conserved hypothetical protein                   97.8    1e-20   
emb|CAK42245.1|  unnamed protein product                              95.1    1e-20   
ref|XP_003970321.1|  PREDICTED: elongation factor 1-gamma-like        99.0    1e-20   
gb|EPS96197.1|  hypothetical protein FOMPIDRAFT_1025472               98.6    1e-20   
ref|XP_003886058.1|  hypothetical protein NCLIV_064580                98.2    1e-20   
ref|XP_008716958.1|  hypothetical protein HMPREF1541_04390            98.2    1e-20   
dbj|BAN38538.1|  eukaryotic translation elongation factor 1 gamma...  94.7    2e-20   
gb|KIW71582.1|  hypothetical protein PV04_03729                       98.2    2e-20   
gb|KIK66373.1|  hypothetical protein GYMLUDRAFT_1025824               98.2    2e-20   
ref|XP_651475.1|  eukaryotic translation elongation factor 1 gamma    94.7    2e-20   
gb|ABG88951.1|  elongation factor-1 gamma                             97.8    2e-20   
gb|EWM21126.1|  elongation factor 1                                   98.2    2e-20   
gb|KIW57420.1|  hypothetical protein PV05_05970                       97.8    2e-20   
emb|CCO33107.1|  Elongation factor 1-gamma Short=EF-1-gamma           97.8    2e-20   
ref|XP_004199475.1|  Piso0_001255                                     97.4    3e-20   
gb|KIW37511.1|  hypothetical protein PV06_10164                       97.4    3e-20   
ref|XP_007376481.1|  elongation factor 1-gamma 1                      97.1    3e-20   
gb|EUC62963.1|  elongation factor 1-gamma                             97.1    3e-20   
ref|XP_007743206.1|  elongation factor 1-gamma                        97.1    3e-20   
gb|KEP46305.1|  elongation factor 1-gamma                             97.1    3e-20   
gb|KIW96849.1|  hypothetical protein Z519_02240                       97.1    4e-20   
gb|KFY71067.1|  hypothetical protein V499_08719                       97.1    4e-20   
ref|XP_008727405.1|  hypothetical protein G647_04846                  96.7    4e-20   
gb|AEG78432.1|  elongation factor-1 gamma                             95.1    4e-20   
gb|KIW75623.1|  hypothetical protein Z517_10365                       96.7    5e-20   
gb|KIW26889.1|  hypothetical protein PV07_06682                       96.3    6e-20   
ref|XP_001396615.2|  hypothetical protein ANI_1_1132134               95.1    6e-20   
gb|KFZ04743.1|  hypothetical protein V501_09006                       96.3    6e-20   
emb|CCO33241.1|  Elongation factor 1-gamma Short=EF-1-gamma           96.3    6e-20   
ref|XP_008605170.1|  hypothetical protein SDRG_01423                  96.3    7e-20   
ref|XP_001598134.1|  elongation factor 1 gamma domain-containing ...  96.3    7e-20   
gb|KFX50153.1|  Elongation factor 1-gamma 2                           95.5    7e-20   
emb|CCO33106.1|  Elongation factor 1-gamma-A Short=EF-1-gamma-A       96.3    8e-20   
gb|KFZ07694.1|  hypothetical protein V502_09840                       95.9    8e-20   
ref|XP_007805315.1|  hypothetical protein EPUS_08392                  96.3    8e-20   
ref|XP_005707114.1|  elongation factor EF-1 gamma subunit             98.6    8e-20   
ref|XP_001248928.1|  elongation factor 1 gamma domain-containing ...  95.9    9e-20   
ref|XP_003744624.1|  PREDICTED: elongation factor 1-gamma-like        96.3    9e-20   
gb|EFW16904.1|  elongation factor 1-gamma                             95.9    9e-20   
gb|KIV85484.1|  hypothetical protein PV11_01176                       95.9    1e-19   
ref|XP_002410199.1|  elongation factor 1 gamma, putative              92.0    1e-19   
ref|XP_002153321.1|  elongation factor 1 gamma domain-containing ...  95.5    1e-19   
gb|KGU22970.1|  elongation factor 1-gamma                             95.5    1e-19   
ref|XP_009009109.1|  hypothetical protein HELRODRAFT_105304           95.9    1e-19   
emb|CCO33242.1|  Elongation factor 1-gamma Short=EF-1-gamma           95.1    1e-19   
emb|CCE42133.1|  hypothetical protein CPAR2_806820                    95.5    1e-19   
gb|KIX93645.1|  hypothetical protein Z520_10551                       95.5    1e-19   
emb|CCE41259.1|  hypothetical protein CPAR2_302480                    95.5    1e-19   
emb|CCO33105.1|  Elongation factor 1-gamma Short=EF-1-gamma           95.1    1e-19   
gb|KIV91053.1|  hypothetical protein PV10_05638                       95.1    2e-19   
gb|KFY32718.1|  hypothetical protein V495_08808                       95.1    2e-19   
gb|KFY33526.1|  hypothetical protein V494_07539                       95.1    2e-19   
gb|ETL96579.1|  hypothetical protein L917_05965                       94.7    2e-19   
emb|CDR38853.1|  CYFA0S02e07140g1_1                                   95.1    2e-19   
gb|EHA24459.1|  hypothetical protein ASPNIDRAFT_210029                95.1    2e-19   
gb|KFY07012.1|  hypothetical protein V492_07522                       95.1    2e-19   
ref|XP_004183098.1|  hypothetical protein EIN_469660                  92.0    2e-19   
dbj|GAM40842.1|  Tef4 homolog                                         94.7    2e-19   
gb|KFX87110.1|  hypothetical protein V490_08542                       94.7    2e-19   
gb|KHN78250.1|  putative elongation factor 1-gamma                    96.7    2e-19   
gb|KDO34814.1|  hypothetical protein SPRG_00875                       94.7    2e-19   
ref|XP_009497236.1|  hypothetical protein H696_05111                  91.7    2e-19   
gb|KFX90510.1|  hypothetical protein O988_08171                       94.7    2e-19   
ref|XP_005089146.1|  PREDICTED: elongation factor 1-gamma-like        94.7    2e-19   
ref|XP_003956526.1|  hypothetical protein KAFR_0C04000                94.7    2e-19   
gb|KEF61767.1|  elongation factor 1-gamma                             94.7    2e-19   
ref|XP_001643583.1|  hypothetical protein Kpol_1073p11                94.7    2e-19   
gb|KFY62519.1|  hypothetical protein V496_04550                       94.7    2e-19   
emb|CCM01656.1|  predicted protein                                    94.7    3e-19   
gb|ABG11961.1|  tail muscle elongation factor 1 gamma                 95.1    3e-19   
emb|CCO33240.1|  Elongation factor 1-gamma Short=EF-1-gamma           94.7    3e-19   
ref|XP_003980245.1|  hypothetical protein NDAI_0G05860                94.4    3e-19   
ref|XP_002548408.1|  elongation factor 1-gamma 1                      94.4    3e-19   
gb|ELR10406.1|  hypothetical protein GMDG_00818                       94.4    3e-19   
ref|XP_001642592.1|  hypothetical protein Kpol_333p4                  94.4    3e-19   
ref|XP_004363777.1|  eukaryotic translation elongation factor 1 g...  94.4    4e-19   
gb|EPS26219.1|  hypothetical protein PDE_01155                        94.0    4e-19   
ref|XP_007001088.1|  hypothetical protein TREMEDRAFT_56155            94.4    4e-19   
gb|KDQ23974.1|  hypothetical protein PLEOSDRAFT_1067979               94.0    4e-19   
ref|XP_003645716.1|  hypothetical protein Ecym_3413                   94.0    5e-19   
ref|XP_003668941.1|  hypothetical protein NDAI_0C00370                94.0    5e-19   
ref|XP_006220052.1|  PREDICTED: probable elongation factor 1-gamm...  90.5    5e-19   
ref|XP_006684814.1|  eEF1-gamma domain-containing protein             93.6    5e-19   
ref|XP_008081375.1|  eEF1-gamma                                       93.6    6e-19   
gb|EHL02475.1|  putative Elongation factor 1-gamma 2                  94.0    6e-19   
gb|KGG52346.1|  hypothetical protein DI09_185p10                      94.0    6e-19   
ref|XP_004202421.1|  Piso0_001255                                     93.6    6e-19   
sp|Q90YC0.1|EF1G_CARAU  RecName: Full=Elongation factor 1-gamma; ...  94.0    7e-19   
ref|XP_009497238.1|  hypothetical protein H696_05113                  93.6    7e-19   
ref|XP_003290965.1|  hypothetical protein DICPUDRAFT_49566            93.2    8e-19   
ref|XP_001560910.1|  elongation factor 1 gamma domain-containing ...  93.2    8e-19   
ref|XP_003292098.1|  hypothetical protein DICPUDRAFT_156785           93.2    8e-19   
ref|XP_003670363.1|  hypothetical protein NDAI_0E03030                93.2    9e-19   
ref|XP_002488120.1|  elongation factor 1 gamma domain-containing ...  92.8    9e-19   
gb|KDQ08948.1|  hypothetical protein BOTBODRAFT_37468                 93.2    9e-19   
ref|XP_011388729.1|  hypothetical protein UMAG_02442                  93.2    9e-19   
ref|XP_005723183.1|  PREDICTED: elongation factor 1-gamma-like        93.2    1e-18   
ref|XP_011277482.1|  Elongation factor 1-gamma                        92.8    1e-18   
ref|XP_009055805.1|  hypothetical protein LOTGIDRAFT_189800           93.2    1e-18   
ref|XP_005913461.1|  PREDICTED: elongation factor 1-gamma-like        93.2    1e-18   
ref|XP_004545571.1|  PREDICTED: elongation factor 1-gamma-like        93.6    1e-18   
ref|XP_005988901.1|  PREDICTED: elongation factor 1-gamma-like        93.2    1e-18   
gb|KFO72580.1|  Elongation factor 1-gamma                             89.7    1e-18   
gb|KIH56458.1|  elongation factor 1 gamma, hypothetical protein       92.8    1e-18   
gb|KFY21400.1|  hypothetical protein V493_07447                       92.8    1e-18   
gb|EYC11955.1|  hypothetical protein Y032_0049g1870                   92.8    1e-18   
gb|KIX10612.1|  hypothetical protein Z518_01696                       92.8    1e-18   
ref|XP_459180.2|  elongation factor 1 gamma domain-containing pro...  92.8    1e-18   
ref|XP_003289626.1|  hypothetical protein DICPUDRAFT_92342            91.3    1e-18   
ref|XP_008325378.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...  92.8    2e-18   
ref|XP_007777470.1|  elongation factor EF-1 gamma subunit             92.4    2e-18   
ref|XP_448998.1|  elongation factor 1 gamma domain-containing pro...  92.4    2e-18   
emb|CCK67906.1|  hypothetical protein KNAG_0A02170                    92.0    2e-18   
ref|XP_007922713.1|  hypothetical protein MYCFIDRAFT_70922            92.4    2e-18   
gb|KFM62317.1|  Elongation factor 1-gamma                             90.5    2e-18   
ref|XP_001733005.1|  glutathione S-transferase domain-containing ...  92.0    2e-18   
gb|EMD34943.1|  hypothetical protein CERSUDRAFT_116469                92.4    2e-18   
ref|XP_003444636.1|  PREDICTED: elongation factor 1-gamma-like        92.4    2e-18   
ref|XP_449323.1|  elongation factor 1 gamma domain-containing pro...  92.0    2e-18   
gb|ADX97113.1|  elongation factor 1-gamma                             90.9    2e-18   
ref|XP_002259965.1|  elongation factor 1-gamma                        92.0    3e-18   
gb|KDQ08950.1|  hypothetical protein BOTBODRAFT_59000                 92.0    3e-18   
gb|ESZ99426.1|  40S ribosomal protein S3aE                            92.0    3e-18   
gb|EMF15588.1|  eEF1-gamma domain-containing protein                  92.0    3e-18   
gb|ERG81045.1|  putative elongation factor 1-gamma                    92.0    3e-18   
ref|XP_007246522.1|  PREDICTED: elongation factor 1-gamma             92.0    3e-18   
ref|XP_500806.1|  elongation factor 1 gamma domain-containing pro...  91.3    3e-18   
gb|KGB33601.1|  putative elongation factor 1-gamma                    87.8    3e-18   
dbj|GAD91456.1|  elongation factor 1 gamma domain-containing protein  91.7    3e-18   
dbj|GAA86285.1|  translation elongation factor eEF-1 subunit gamma    91.3    4e-18   
ref|XP_006781412.1|  PREDICTED: elongation factor 1-gamma-like is...  91.7    4e-18   
ref|XP_011505224.1|  PREDICTED: elongation factor 1-gamma             90.9    4e-18   
ref|XP_006781411.1|  PREDICTED: elongation factor 1-gamma-like is...  91.7    4e-18   
gb|EGA60310.1|  Cam1p                                                 90.5    4e-18   
emb|CBQ71185.1|  related to translation elongation factor eEF1, g...  91.3    4e-18   
emb|CEL61253.1|  Elongation factor 1-gamma OS=Schizosaccharomyces...  91.3    5e-18   
gb|EUN29355.1|  hypothetical protein COCVIDRAFT_24648                 93.2    5e-18   
ref|XP_007707915.1|  hypothetical protein COCCADRAFT_1433             93.2    5e-18   
ref|XP_007705773.1|  hypothetical protein COCSADRAFT_185747           93.2    5e-18   
emb|CDH14124.1|  probable Elongation factor 1-gamma 1                 90.9    5e-18   
gb|ABG88960.1|  elongation factor-1 gamma                             90.1    5e-18   
gb|ENI01501.1|  hypothetical protein COCC4DRAFT_43377                 93.2    5e-18   
ref|XP_007692467.1|  hypothetical protein COCMIDRAFT_107326           93.2    5e-18   
ref|XP_004073276.1|  PREDICTED: elongation factor 1-gamma             91.3    5e-18   
ref|XP_002837234.1|  elongation factor 1 gamma domain-containing ...  89.7    6e-18   
ref|XP_001095725.2|  PREDICTED: elongation factor 1-gamma-like        87.8    6e-18   
emb|CDH08824.1|  probable Elongation factor 1-gamma 1                 90.9    6e-18   
ref|XP_007387563.1|  EF1G-domain-containing protein                   91.3    6e-18   
gb|EGA82035.1|  Tef4p                                                 89.0    6e-18   
gb|AIL25493.1|  EF1Bgamma1                                            90.9    6e-18   
gb|EGA85925.1|  Tef4p                                                 89.0    7e-18   
emb|CCF48051.1|  related to translation elongation factor eEF1, g...  90.5    7e-18   
ref|XP_005178105.1|  PREDICTED: elongation factor 1-gamma             90.5    8e-18   
ref|XP_953151.1|  elongation factor 1-gamma                           90.1    8e-18   
ref|XP_006899929.1|  PREDICTED: elongation factor 1-gamma             90.1    8e-18   
gb|EWC45095.1|  hypothetical protein DRE_06234                        90.5    9e-18   
gb|KFD49891.1|  hypothetical protein M513_09220                       92.0    9e-18   
emb|CDF91100.1|  ZYBA0S09-04786g1_1                                   90.1    9e-18   
ref|XP_007875131.1|  hypothetical protein PNEG_03075                  90.1    1e-17   
gb|EHN06108.1|  Tef4p                                                 89.0    1e-17   
ref|XP_003028482.1|  hypothetical protein SCHCODRAFT_86015            90.1    1e-17   
gb|EGA77962.1|  Tef4p                                                 89.0    1e-17   
gb|EWH15445.1|  Cam1p                                                 90.1    1e-17   
dbj|GAC74705.1|  translation elongation factor EF-1 gamma             90.5    1e-17   
gb|EDZ70964.1|  YKL081Wp-like protein                                 89.0    1e-17   
ref|NP_015277.1|  Cam1p                                               90.1    1e-17   
ref|XP_003297795.1|  hypothetical protein PTT_08317                   92.4    1e-17   
gb|ABG88956.1|  elongation factor-1 gamma                             89.7    1e-17   
gb|EOA93957.1|  Elongation factor 1-gamma                             86.7    1e-17   
ref|XP_502225.1|  elongation factor 1 gamma domain-containing pro...  89.7    1e-17   
gb|ESX01128.1|  Elongation factor 1-gamma 1                           90.1    1e-17   



>gb|KDO42760.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=387

 Score =   281 bits (718),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  237  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  296

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYD ELY+ K+VDI
Sbjct  297  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI  356

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  357  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  387



>gb|KDO42759.1| hypothetical protein CISIN_1g014592mg [Citrus sinensis]
Length=422

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYD ELY+ K+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  392  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_006441587.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
 gb|ESR54827.1| hypothetical protein CICLE_v10020303mg [Citrus clementina]
Length=422

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTISFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIP+F++DECYD ELY+ K+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPQFIMDECYDMELYDWKKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  392  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_007041181.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
 gb|EOX97012.1| Elongation factor 1-gamma 3 isoform 1 [Theobroma cacao]
Length=422

 Score =   280 bits (715),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FVLDECYD ELYE K+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVLDECYDMELYEWKKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  392  SDEAQKERVSQMIEDCEPFEGEPLLDAKCFK  422



>gb|AFK34308.1| unknown [Medicago truncatula]
Length=418

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTASFVTLNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYD ELYE  +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D VQKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_003592901.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|ABE91935.1| Elongation factor 1, gamma chain; Glutathione S-transferase, 
C-terminal; Thioredoxin-like fold [Medicago truncatula]
 gb|AES63152.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYD ELYE  +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D VQKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_010683294.1| PREDICTED: elongation factor 1-gamma 2-like [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  268  SKMVLDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG EIP+FVLDECYD ELYE  +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPQFVLDECYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVSQMIEDFEPFEGEALLDAKCFK  418



>ref|XP_003592902.1| Elongation factor 1-gamma [Medicago truncatula]
 gb|AES63153.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=418

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYD ELYE  +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D VQKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|XP_010686883.1| PREDICTED: elongation factor 1-gamma-like [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  325

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FVLDECYD ELYE  +VD+
Sbjct  326  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVLDECYDMELYEWTKVDL  385

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  386  SDEAQKERVSQMIEDYEPFEGEALLDAKCFK  416



>gb|KEH34076.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   277 bits (708),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  269  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYD ELYE  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIMDECYDMELYEWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  389  SDEAQKERVSQMIEDFEPFEGEALLDAKCFK  419



>ref|XP_010030200.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 ref|XP_010030201.1| PREDICTED: elongation factor 1-gamma [Eucalyptus grandis]
 gb|KCW57149.1| hypothetical protein EUGRSUZ_I02782 [Eucalyptus grandis]
Length=419

 Score =   277 bits (708),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+E+P+FV+DECYD ELYE K+VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEVPQFVIDECYDMELYEWKKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  389  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  419



>ref|XP_004485430.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Cicer arietinum]
 ref|XP_004485431.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Cicer arietinum]
Length=420

 Score =   277 bits (708),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  270  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV++ECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMEECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKER SQMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERASQMIEDFEPFEGEALLDAKCFK  420



>gb|ACU24330.1| unknown [Glycine max]
Length=255

 Score =   271 bits (693),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  105  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  164

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI
Sbjct  165  GFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  224

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  225  SDEAQKERVNQMIEDYEPFEGEALLDAKCFK  255



>ref|XP_009774942.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT SF T+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYD ELYE K+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009610260.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=417

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT SF T+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYD ELYE K+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009610261.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=417

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT SF T+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYD ELYE K+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_009774948.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT SF T+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYD ELYE K+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_006478210.1| PREDICTED: elongation factor 1-gamma-like [Citrus sinensis]
Length=422

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+ IP+F++ ECYD ELY+ K+VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQVIPQFIMYECYDMELYDWKKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  392  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  422



>ref|XP_002264400.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
 ref|XP_010657965.1| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]
Length=423

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  273  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  332

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYD ELYE K+VDI
Sbjct  333  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDI  392

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  393  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  423



>ref|XP_007222556.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
 gb|EMJ23755.1| hypothetical protein PRUPE_ppa006233mg [Prunus persica]
Length=421

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF++DECYD ELY+ ++VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYDWRKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  391  TDEDQKERVNQMIEDQEPFEGEALLDAKCFK  421



>dbj|BAP19108.1| elongation factor 1 gamma-like protein, partial [Ipomoea nil]
Length=170

 Score =   267 bits (683),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  20   SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  79

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRGKEIPKF++DE YD ELYE ++ DI
Sbjct  80   GFLQRMDLARKYAFGKMLVIGSQPPFKVKGLWLFRGKEIPKFIMDEVYDMELYEWREADI  139

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  140  NDEAQKERVNQMIEDHEPFEGEDLLDAKCFK  170



>ref|XP_010553691.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=415

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF T+NKVG
Sbjct  265  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTLNKVG  324

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV GSEPPFKVKGLWLFRG+EIPKFV+DE YD ELYE K+VDI
Sbjct  325  GFLQRMDLTRKYAFGKMLVCGSEPPFKVKGLWLFRGQEIPKFVMDEVYDMELYEWKKVDI  384

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>gb|ACB72462.1| elongation factor 1 gamma-like protein [Nicotiana tabacum]
Length=417

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT SF T+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYD ELYE K+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  387  NDESQKERVNQMIEDYEPFEGEALLDAKCFK  417



>ref|XP_008219063.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=421

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN RE+A+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  271  SKMILDEWKRLYSNTKTNFREIAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF++DECYD ELY+ ++VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYDWRKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  391  TDEDQKERVNQMIEDQEPFEGEALLDAKCFK  421



>ref|XP_002526432.1| elongation factor 1 gamma, putative [Ricinus communis]
 gb|EEF35927.1| elongation factor 1 gamma, putative [Ricinus communis]
Length=307

 Score =   271 bits (694),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  157  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  216

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PP+KVKGLWLFRG+EIP+FV+DECYD ELY+ K+VD+
Sbjct  217  GFLQRMDLARKYAFGKMLVIGSNPPYKVKGLWLFRGQEIPQFVIDECYDMELYDWKKVDL  276

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  277  SDEAQKERVNQMIEDFEPFEGEALLDAKCFK  307



>ref|XP_010544111.1| PREDICTED: probable elongation factor 1-gamma 2 [Tarenaya hassleriana]
Length=416

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  325

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKY FGKMLV GSEPPFKVKGLWLFRG+EIPKFV+DE YD ELYE K+VDI
Sbjct  326  GFLQRMDLVRKYGFGKMLVCGSEPPFKVKGLWLFRGQEIPKFVMDEVYDMELYEWKKVDI  385

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  386  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  416



>ref|XP_008456982.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=422

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  272  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENIVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKF+LDECYD ELYE ++VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFILDECYDMELYEWRKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D VQKE V+QMIED EPFEGEALLDAKCFK
Sbjct  392  SDEVQKECVNQMIEDQEPFEGEALLDAKCFK  422



>ref|XP_011047878.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
 ref|XP_011047880.1| PREDICTED: elongation factor 1-gamma [Populus euphratica]
Length=421

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYD ELYE  +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDHEPFEGDALLDAKCFK  421



>ref|XP_009759974.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Nicotiana 
sylvestris]
Length=417

 Score =   275 bits (702),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT SF T+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYD ELYE K+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGESLLDAKCFK  417



>ref|XP_009759973.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Nicotiana 
sylvestris]
Length=417

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT SF T+NKVG
Sbjct  267  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFV+DECYD ELYE K+VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVMDECYDMELYEWKEVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  387  NDEAQKERVNQMIEDYEPFEGESLLDAKCFK  417



>ref|XP_007153909.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
 gb|ESW25903.1| hypothetical protein PHAVU_003G075200g [Phaseolus vulgaris]
Length=420

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF TMNKVG
Sbjct  270  SPMILDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCNYKYNDENTVSFVTMNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSNPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERVSQMIEDYEPFEGEALLDAKCFK  420



>emb|CDP10743.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKF+LDE YD ELY+ K+VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFILDEVYDMELYDWKEVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDYEPFEGEPLLDAKCFK  421



>gb|ADB11388.1| gamma class glutathione transferase EF1Bgamma3 [Populus trichocarpa]
Length=421

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYD ELYE  +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDYEPFEGDALLDAKCFK  421



>ref|XP_007148576.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
 gb|ESW20570.1| hypothetical protein PHAVU_006G220100g [Phaseolus vulgaris]
Length=419

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGE+LLDAKCFK
Sbjct  389  SDEAQKERVSQMIEDYEPFEGESLLDAKCFK  419



>emb|CAN75785.1| hypothetical protein VITISV_021574 [Vitis vinifera]
Length=423

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN  EVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  273  SKMILDEWKRLYSNTKTNFHEVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  332

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYD ELYE K+VDI
Sbjct  333  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDI  392

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  393  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  423



>ref|XP_008378997.1| PREDICTED: elongation factor 1-gamma, partial [Malus domestica]
Length=157

 Score =   265 bits (676),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  7    SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  66

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYD ELY   +VDI
Sbjct  67   GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTKVDI  126

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  127  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  157



>gb|KJB47884.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=259

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  109  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  168

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VD+
Sbjct  169  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  228

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  229  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  259



>ref|XP_006600242.1| PREDICTED: elongation factor 1-gamma isoform X1 [Glycine max]
 gb|AJE59628.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERVNQMIEDYEPFEGEALLDAKCFK  420



>gb|AHZ94964.1| elongation factor 1, partial [Lilium regale]
Length=405

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  255  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  314

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIP+FV+DECYD ELYE  +VDI
Sbjct  315  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPQFVIDECYDMELYEWTRVDI  374

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGEALLDAKCFK
Sbjct  375  SDEAQKERVSAMIEDQEPFEGEALLDAKCFK  405



>gb|ACA50518.1| elongation factor 1-gamma [Oryza sativa Japonica Group]
Length=414

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  264  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  414



>gb|ACJ85171.1| unknown [Medicago truncatula]
Length=418

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK N REVAIKGFWDMY PEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  268  SKMILDDWKRLYSNTKRNFREVAIKGFWDMYVPEGYSLWFCDYKYNDENTASFVTLNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRM LARKYAFGKML+IGSEPPFKVKGLWLFRG+EIPKF++DECYD ELYE  +VDI
Sbjct  328  GFLQRMALARKYAFGKMLIIGSEPPFKVKGLWLFRGQEIPKFIIDECYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D VQKER SQMIEDAEPFEGEALLDAKCFK
Sbjct  388  SDEVQKERASQMIEDAEPFEGEALLDAKCFK  418



>ref|NP_001046318.1| Os02g0220600 [Oryza sativa Japonica Group]
 sp|Q9ZRI7.1|EF1G1_ORYSJ RecName: Full=Elongation factor 1-gamma 1; Short=EF-1-gamma 1; 
AltName: Full=eEF-1B gamma 1 [Oryza sativa Japonica Group]
 dbj|BAA34206.1| elongation factor 1B gamma [Oryza sativa]
 dbj|BAD17615.1| Elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08232.1| Os02g0220600 [Oryza sativa Japonica Group]
Length=418

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  328  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  418



>ref|XP_010272551.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Nelumbo 
nucifera]
Length=423

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTK+N REVAIKGFWDM+DP+GYSLWFCDYK NDENT SF T+NKV 
Sbjct  273  SKMILDEWKRLYSNTKSNFREVAIKGFWDMFDPDGYSLWFCDYKYNDENTVSFVTLNKVS  332

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGK+LVIGSEPP+KVKGLWLFRG+EIP+FVLDECYD ELY+ ++VDI
Sbjct  333  GFLQRMDLARKYAFGKILVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYDWRKVDI  392

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  393  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  423



>gb|KEH32761.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=384

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  234  SKMILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  293

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI
Sbjct  294  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDI  353

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV QMIED EPFEGE LLDAKCFK
Sbjct  354  SDEAQKERVGQMIEDFEPFEGEPLLDAKCFK  384



>gb|KJB47885.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=319

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  169  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  228

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VD+
Sbjct  229  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  288

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  289  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  319



>ref|XP_006647077.1| PREDICTED: elongation factor 1-gamma 2-like [Oryza brachyantha]
Length=418

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  328  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  418



>gb|KEH32762.1| translation elongation factor EF1B, gamma chain [Medicago truncatula]
Length=419

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  269  SKMILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV QMIED EPFEGE LLDAKCFK
Sbjct  389  SDEAQKERVGQMIEDFEPFEGEPLLDAKCFK  419



>ref|XP_008452240.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=409

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  259  SSMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYD ELYE K+VD+
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKKVDV  378

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  379  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  409



>ref|XP_004155227.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Cucumis sativus]
Length=409

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  259  SSMILDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRG EIP+FVLDECYD ELYE K+VDI
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGXEIPQFVLDECYDMELYEWKKVDI  378

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  379  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  409



>gb|ABA81876.1| unknown [Solanum tuberosum]
Length=413

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  263  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV+DE YD ELYE K+VDI
Sbjct  323  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMDEVYDMELYEWKEVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  383  NDEAQKERVSQMIEDHEPFEGQALLDAKCFK  413



>ref|NP_001046317.1| Os02g0220500 [Oryza sativa Japonica Group]
 dbj|BAD17614.1| putative elongation factor 1-gamma [Oryza sativa Japonica Group]
 dbj|BAF08231.1| Os02g0220500 [Oryza sativa Japonica Group]
 gb|EEC72756.1| hypothetical protein OsI_06401 [Oryza sativa Indica Group]
 gb|EEE56571.1| hypothetical protein OsJ_05922 [Oryza sativa Japonica Group]
Length=414

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  264  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGE+LLDAKCFK
Sbjct  384  SDEAQKERVSAMIEDLEPFEGESLLDAKCFK  414



>sp|Q6YW46.2|EF1G2_ORYSJ RecName: Full=Elongation factor 1-gamma 2; Short=EF-1-gamma 2; 
AltName: Full=eEF-1B gamma 2 [Oryza sativa Japonica Group]
Length=418

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  328  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGE+LLDAKCFK
Sbjct  388  SDEAQKERVSAMIEDLEPFEGESLLDAKCFK  418



>gb|KHN39680.1| Elongation factor 1-gamma [Glycine soja]
Length=331

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  181  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  240

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYD ELY+  +VDI
Sbjct  241  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVIDECYDMELYDWTKVDI  300

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  301  SDETQKERVNQMIEDFEPFEGESLLDAKCFK  331



>ref|XP_008452241.1| PREDICTED: elongation factor 1-gamma-like [Cucumis melo]
Length=410

 Score =   272 bits (695),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN RE+AIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  260  SSMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  319

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYD ELYE K+VDI
Sbjct  320  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKKVDI  379

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  380  SDEAQKERVNQMIEDQEPFEGEVLLDAKCFK  410



>ref|XP_010242290.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
 ref|XP_010242291.1| PREDICTED: elongation factor 1-gamma-like [Nelumbo nucifera]
Length=424

 Score =   272 bits (696),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYD EGYSLWFCDYK NDENT SF T+NKV 
Sbjct  274  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDAEGYSLWFCDYKYNDENTVSFVTLNKVS  333

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+++P+FVLDECYD ELY+ ++VDI
Sbjct  334  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQDVPQFVLDECYDMELYDWRKVDI  393

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  394  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  424



>gb|AAO72574.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=409

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  259  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  318

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  319  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  378

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGE+LLDAKCFK
Sbjct  379  SDEAQKERVSAMIEDLEPFEGESLLDAKCFK  409



>ref|XP_010272550.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Nelumbo 
nucifera]
Length=487

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTK+N REVAIKGFWDM+DP+GYSLWFCDYK NDENT SF T+NKV 
Sbjct  337  SKMILDEWKRLYSNTKSNFREVAIKGFWDMFDPDGYSLWFCDYKYNDENTVSFVTLNKVS  396

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGK+LVIGSEPP+KVKGLWLFRG+EIP+FVLDECYD ELY+ ++VDI
Sbjct  397  GFLQRMDLARKYAFGKILVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYDWRKVDI  456

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  457  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  487



>gb|KHN03584.1| Elongation factor 1-gamma [Glycine soja]
Length=420

 Score =   272 bits (695),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N ENT SF T+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAQKERVNQMIEDYEPFEGEALLDAKCFK  420



>ref|NP_001274793.1| elongation factor 1-gamma 2-like [Solanum tuberosum]
 gb|ABB87108.1| putative elongation factor 1-gamma-like [Solanum tuberosum]
Length=414

 Score =   271 bits (694),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV+DE YD ELYE K+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMDEVYDMELYEWKEVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGQALLDAKCFK  414



>gb|EEE56572.1| hypothetical protein OsJ_05923 [Oryza sativa Japonica Group]
Length=479

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  329  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  388

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  389  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  448

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGEALLDAKCFK
Sbjct  449  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  479



>gb|EEC72757.1| hypothetical protein OsI_06402 [Oryza sativa Indica Group]
Length=479

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  329  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  388

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  389  GFLQRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  448

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGEALLDAKCFK
Sbjct  449  SDEAQKERVSAMIEDLEPFEGEALLDAKCFK  479



>gb|KJB47897.1| hypothetical protein B456_008G046200 [Gossypium raimondii]
Length=421

 Score =   271 bits (694),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>gb|AIZ68134.1| translation elongation factor 1-gamma [Ornithogalum saundersiae]
Length=414

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK N+ENT SF T+NKVG
Sbjct  264  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNEENTVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRGKEIP FV++ECYD ELYE  +VD+
Sbjct  324  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGKEIPPFVVEECYDMELYEWTKVDL  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_010928857.1| PREDICTED: elongation factor 1-gamma 2 [Elaeis guineensis]
Length=419

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVS  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYD ELYE  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  389  TDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>ref|XP_006339362.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
tuberosum]
Length=416

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  266  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  325

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YD ELYE K+VDI
Sbjct  326  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKEVDI  385

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  386  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  416



>ref|XP_004133719.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=409

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE K LYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  259  SSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+FVLDECYD ELYE K+VDI
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQFVLDECYDMELYEWKKVDI  378

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  379  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  409



>ref|XP_006339363.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
tuberosum]
Length=414

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YD ELYE K+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKEVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_006385057.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ABK94655.1| unknown [Populus trichocarpa]
 gb|ADB11387.1| gamma class glutathione transferase EF1Bgamma2 [Populus trichocarpa]
 gb|ERP62854.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=422

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFC+YK N+ENT SF T+NKVG
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCNYKYNEENTVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+FV+DECYD ELYE  +VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKER SQMIED EPFEGEALLDAKCFK
Sbjct  392  SDEAQKERASQMIEDCEPFEGEALLDAKCFK  422



>ref|XP_010907209.1| PREDICTED: elongation factor 1-gamma 2-like [Elaeis guineensis]
Length=419

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+ IP+FVLDECYD ELYE  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQHIPQFVLDECYDMELYEWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  389  TDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>gb|KHG12420.1| hypothetical protein F383_17048 [Gossypium arboreum]
Length=421

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>ref|XP_002325529.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|EEE99910.1| hypothetical protein POPTR_0019s10560g [Populus trichocarpa]
 gb|ADB11386.1| gamma class glutathione transferase EF1Bgamma1 [Populus trichocarpa]
Length=426

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  276  SKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  335

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VDI
Sbjct  336  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDI  395

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKER SQMIED EPFEGE LLDAKCFK
Sbjct  396  TDEEQKERASQMIEDYEPFEGEPLLDAKCFK  426



>gb|KJB47883.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47887.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
 gb|KJB47888.1| hypothetical protein B456_008G046300 [Gossypium raimondii]
Length=421

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>ref|NP_001242737.1| uncharacterized protein LOC100810452 [Glycine max]
 gb|ACU18062.1| unknown [Glycine max]
Length=420

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N ENT SF T+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+EIP+FV+DECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEPQKERVNQMIEDCEPFEGEALLDAKCFK  420



>gb|KHN40193.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59625.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=420

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N ENT SF T+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNQENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+EIP+FV+DECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEPQKERVNQMIEDCEPFEGEALLDAKCFK  420



>ref|XP_006389499.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
 gb|ERP48413.1| elongation factor 1-gamma 1 family protein [Populus trichocarpa]
Length=421

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+FV+DECYD ELYE  +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFVIDECYDMELYEWTKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  391  SDEAQKERVSQMIEDYEPFEGDALLDAKCFK  421



>gb|KHG04277.1| hypothetical protein F383_29497 [Gossypium arboreum]
Length=421

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT SF TMNKVG
Sbjct  271  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSFVTMNKVG  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+ PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VD+
Sbjct  331  GFLQRMDLARKYAFGKMLVIGANPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  391  SDAAQKERVNQMIEDCEPFEGEPLLDAKCFK  421



>emb|CBI29690.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -3

Query  631  ILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFL  452
            ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVGGFL
Sbjct  2    ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVGGFL  61

Query  451  QRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDP  272
            QRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYD ELYE K+VDI+D 
Sbjct  62   QRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMELYEWKKVDISDE  121

Query  271  VQKERVSQMIEDAEPFEGEALLDAKCFK  188
             QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  122  AQKERVNQMIEDQEPFEGEALLDAKCFK  149



>ref|XP_008789740.1| PREDICTED: elongation factor 1-gamma 1 isoform X2 [Phoenix dactylifera]
Length=384

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  234  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  293

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYD ELYE  + DI
Sbjct  294  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTKADI  353

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKER++ MIED EPFEGEALLDAKCFK
Sbjct  354  TDEAQKERINAMIEDQEPFEGEALLDAKCFK  384



>ref|XP_011028370.1| PREDICTED: elongation factor 1-gamma 2-like [Populus euphratica]
Length=422

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFC+YK N+ENT SF T+NKVG
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCNYKYNEENTVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP+F++DECYD ELYE  +VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPQFIIDECYDMELYEWTKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKER SQMIED EPFEGEALLDAKCFK
Sbjct  392  SDEAQKERASQMIEDCEPFEGEALLDAKCFK  422



>ref|XP_011031541.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031542.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
 ref|XP_011031543.1| PREDICTED: elongation factor 1-gamma-like [Populus euphratica]
Length=426

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  276  SKMILDEWKRLYSNTKTNFREVAIKGFWEMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  335

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VDI
Sbjct  336  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDI  395

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKER SQMIED EPFEGE LLDAKCFK
Sbjct  396  TDEEQKERASQMIEDYEPFEGEPLLDAKCFK  426



>gb|KDO40980.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=287

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  137  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  196

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYD ELY+ K+ DI
Sbjct  197  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  256

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  257  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  287



>gb|AFW71312.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=317

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  167  SKLILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  226

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VD+
Sbjct  227  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDL  286

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  287  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  317



>ref|XP_011074970.1| PREDICTED: elongation factor 1-gamma-like [Sesamum indicum]
Length=420

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDP GYSLWFC+YK NDENT SF T+NKV 
Sbjct  270  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPAGYSLWFCNYKYNDENTVSFVTLNKVS  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE P+KVKGLWLFRG EIP+FVLDECYD ELY+  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPYKVKGLWLFRGTEIPQFVLDECYDMELYDWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  390  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  420



>ref|NP_001241223.1| uncharacterized protein LOC100787125 [Glycine max]
 gb|ACU24574.1| unknown [Glycine max]
 gb|AJE59627.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=419

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  269  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIPKFV+DECYD ELY+  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPKFVIDECYDMELYDWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE+LLDAKCFK
Sbjct  389  SDETQKERVNQMIEDFEPFEGESLLDAKCFK  419



>ref|XP_008789739.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Phoenix dactylifera]
Length=419

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG+EIP+FVLDECYD ELYE  + DI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQEIPQFVLDECYDMELYEWTKADI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKER++ MIED EPFEGEALLDAKCFK
Sbjct  389  TDEAQKERINAMIEDQEPFEGEALLDAKCFK  419



>gb|ADR70876.1| eukaryotic translation elongation factor 1B gamma-subunit [Hevea 
brasiliensis]
Length=424

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  274  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  333

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG  PP+KVKGLWLFRG+EIP+FV+DECYD ELYE K+VDI
Sbjct  334  GFLQRMDLARKYAFGKMLVIGENPPYKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDI  393

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  394  SDEAQKERVNQMIEDQEPFEGEPLLDAKCFK  424



>gb|EYU22759.1| hypothetical protein MIMGU_mgv1a007114mg [Erythranthe guttata]
Length=419

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  269  SKMVLDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+E PFKVKGLWLFRG EIP+FV+DECYD ELY   +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGTEAPFKVKGLWLFRGTEIPQFVMDECYDMELYHWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKER SQMIEDAEPFEGE LLDAKCFK
Sbjct  389  NDEAQKERASQMIEDAEPFEGEGLLDAKCFK  419



>ref|XP_008804357.1| PREDICTED: elongation factor 1-gamma 2-like [Phoenix dactylifera]
Length=461

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFW+MYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  311  SKMILDEWKRLYSNTKTNFREVAIKGFWNMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  370

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPP+KVKGLWLFRG++IP+FVLDECYD ELYE  +VDI
Sbjct  371  GFLQRMDLARKYAFGKMLVIGSEPPYKVKGLWLFRGQQIPQFVLDECYDMELYEWTKVDI  430

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D VQKERV+ MIED EPFEGEALLDAKCFK
Sbjct  431  ADEVQKERVNAMIEDQEPFEGEALLDAKCFK  461



>gb|KDO40983.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40984.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40985.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=256

 Score =   265 bits (676),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  106  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  165

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYD ELY+ K+ DI
Sbjct  166  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  225

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  226  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  256



>ref|XP_004240589.1| PREDICTED: elongation factor 1-gamma 2-like [Solanum lycopersicum]
Length=413

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  263  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRM+L RKYAFGKML++GSE PFKV+GLWLFRGKEIPKFV++E YD ELYE K+VDI
Sbjct  323  GFLQRMELVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPKFVMEEVYDMELYEWKEVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEG+ALLDAKCFK
Sbjct  383  NDEAQKERVSQMIEDHEPFEGQALLDAKCFK  413



>ref|XP_004294500.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=419

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  269  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKGLWLFRG+E+P+F++DECYD ELY+  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGLWLFRGQEVPQFIIDECYDMELYDWCKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  389  TDENQKERVNQMIEDHEPFEGEALLDAKCFK  419



>gb|KDO40981.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
 gb|KDO40982.1| hypothetical protein CISIN_1g021153mg [Citrus sinensis]
Length=316

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  166  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  225

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYD ELY+ K+ DI
Sbjct  226  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  285

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  286  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  316



>ref|XP_004966044.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   269 bits (688),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  Q+ERVS MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQRERVSAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_002278756.2| PREDICTED: elongation factor 1-gamma [Vitis vinifera]
Length=424

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  274  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVT  333

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML++GSE PFKVKGLWLFRG+EIP+FV+DECYD ELYE K+VD+
Sbjct  334  GFLQRMDLARKYAFGKMLIVGSEAPFKVKGLWLFRGQEIPQFVIDECYDMELYEWKKVDL  393

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  394  SDEAQKERVNQMIEDQEPFEGEALLDAKCFK  424



>ref|XP_004966045.1| PREDICTED: elongation factor 1-gamma 3-like [Setaria italica]
Length=414

 Score =   269 bits (688),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  Q+ERVS MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQRERVSAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_004250641.1| PREDICTED: elongation factor 1-gamma 2-like isoform X1 [Solanum 
lycopersicum]
Length=414

 Score =   269 bits (688),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIP FV++E YD ELYE K+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPMFVMEEVYDMELYEWKEVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_008677347.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008677348.1| PREDICTED: elongation factor 1-gamma 2 isoform X1 [Zea mays]
 ref|XP_008679834.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 ref|XP_008679835.1| PREDICTED: elongation factor 1-gamma 2-like [Zea mays]
 gb|AFW66035.1| elongation factor 1-gamma 2 [Zea mays]
 gb|AFW66036.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VD+
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTKVDL  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_006392372.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29658.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=350

 Score =   267 bits (682),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  200  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  259

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  260  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  319

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  320  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  350



>ref|NP_001131533.1| uncharacterized protein LOC100192872 [Zea mays]
 gb|ACF79973.1| unknown [Zea mays]
Length=307

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  157  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  216

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YD ELYE  +VDI
Sbjct  217  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  276

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  277  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  307



>ref|XP_004951452.1| PREDICTED: elongation factor 1-gamma 2-like [Setaria italica]
Length=417

 Score =   269 bits (687),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  267  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VD+
Sbjct  327  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTKVDL  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_004250642.1| PREDICTED: elongation factor 1-gamma 2-like isoform X2 [Solanum 
lycopersicum]
Length=414

 Score =   269 bits (687),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKML++GSE PFKV+GLWLFRGKEIP FV++E YD ELYE K+VDI
Sbjct  324  GFLQRMDLVRKYAFGKMLIVGSEAPFKVQGLWLFRGKEIPMFVMEEVYDMELYEWKEVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  384  NDEAQKERVSQMIEDHEPFEGEALLDAKCFK  414



>ref|XP_003540135.1| PREDICTED: elongation factor 1-gamma-like [Glycine max]
 gb|KHN11054.1| Elongation factor 1-gamma [Glycine soja]
 gb|AJE59626.1| EF1Bgamma class glutathione S-transferase [Glycine max]
Length=418

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDEN+ SF T+NKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENSVSFVTLNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIP+FV+DECYD ELY+  +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPQFVIDECYDMELYDWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  SDETQKERVNQMIEDYEPFEGEPLLDAKCFK  418



>ref|XP_008643919.1| PREDICTED: uncharacterized protein LOC100381466 isoform X1 [Zea 
mays]
 gb|AFW71313.1| hypothetical protein ZEAMMB73_547198 [Zea mays]
Length=414

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  264  SKLILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VD+
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDL  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_008352808.1| PREDICTED: elongation factor 1-gamma-like [Malus domestica]
Length=424

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  274  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  333

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKF++DECYD  LYE ++VDI
Sbjct  334  GFLQRMDLARKYAFGKMLVIGSAPPFKVKGLWLFRGQEIPKFIIDECYDMXLYEWRKVDI  393

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  394  TDEDQKERVNQMIEDHEPFEGEDLLDAKCFK  424



>gb|KDP42461.1| hypothetical protein JCGZ_00258 [Jatropha curcas]
Length=423

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  273  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  332

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG+ PP+KVKGLWLFRG EIP+FV+DECYD ELY+ K+VDI
Sbjct  333  GFLQRMDLARKYAFGKMLVIGANPPYKVKGLWLFRGSEIPQFVIDECYDMELYDWKKVDI  392

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  393  SDEEQKERVNQMIEDFEPFEGEPLLDAKCFK  423



>ref|XP_002451782.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
 gb|EES04758.1| hypothetical protein SORBIDRAFT_04g007760 [Sorghum bicolor]
Length=418

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  268  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VD+
Sbjct  328  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWTKVDL  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  388  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  418



>ref|XP_009355338.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  270  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYD ELY   +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|XP_006392370.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 ref|XP_006392371.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29656.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
 gb|ESQ29657.1| hypothetical protein EUTSA_v10023493mg [Eutrema salsugineum]
Length=414

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  264  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_009353791.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
 ref|XP_009353792.1| PREDICTED: elongation factor 1-gamma [Pyrus x bretschneideri]
Length=420

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  270  SKMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYD ELY   +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYSWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|XP_009362385.1| PREDICTED: elongation factor 1-gamma-like [Pyrus x bretschneideri]
Length=422

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVA+KGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAVKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG+EIPKF+++ECYD +LYE ++VDI
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSAPPFKVKGLWLFRGQEIPKFIINECYDMDLYEWRKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV QMIED EPFEGE LLDAKCFK
Sbjct  392  TDEDQKERVCQMIEDHEPFEGEDLLDAKCFK  422



>gb|AFW76477.1| elongation factor gamma1 [Zea mays]
Length=291

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  141  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  200

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YD ELYE  +VDI
Sbjct  201  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  260

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  261  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  291



>ref|XP_006431568.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
 gb|ESR44808.1| hypothetical protein CICLE_v10003566mg [Citrus clementina]
Length=418

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  268  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYD ELY+ K+ DI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  388  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  418



>ref|XP_009417204.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=419

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  269  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+PPFKVKG+WLFRG EIPKFVLDE YD ELY+  +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSDPPFKVKGVWLFRGLEIPKFVLDEVYDMELYDWAKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  389  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  419



>gb|ACJ84953.1| unknown [Medicago truncatula]
Length=149

 Score =   258 bits (659),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  631  ILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFL  452
            ILD+ KRLYSNTK N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF  +NKVGGFL
Sbjct  2    ILDDWKRLYSNTKNNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENAVSFVALNKVGGFL  61

Query  451  QRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDP  272
            QRMDLARKYAFGKMLVIG EPPFKVKGLWLFRG+EIPKFV+DECYD ELYE  +VDI+D 
Sbjct  62   QRMDLARKYAFGKMLVIGFEPPFKVKGLWLFRGQEIPKFVMDECYDMELYEWTKVDISDE  121

Query  271  VQKERVSQMIEDAEPFEGEALLDAKCFK  188
             QKERV QMIED EPFEGE LLDAKCFK
Sbjct  122  AQKERVGQMIEDFEPFEGEPLLDAKCFK  149



>ref|XP_008365322.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like 
[Malus domestica]
Length=419

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  269  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  328

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+DECYD ELY   +VDI
Sbjct  329  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMDECYDMELYNWTKVDI  388

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  389  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  419



>ref|XP_006494223.1| PREDICTED: elongation factor 1-gamma 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494224.1| PREDICTED: elongation factor 1-gamma 3-like isoform X2 [Citrus 
sinensis]
 gb|ACP43319.1| translation elongation factor [Citrus maxima]
Length=418

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  268  SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+EPP+KVKGLWLFRG EIPKFV+DECYD ELY+ K+ DI
Sbjct  328  GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  388  SDEEQKERVNQMIEDHEPFEGEALLDAKCFK  418



>ref|XP_010101278.1| Elongation factor 1-gamma [Morus notabilis]
 gb|EXB88213.1| Elongation factor 1-gamma [Morus notabilis]
Length=460

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N+ENT S+ T+NKV 
Sbjct  310  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNEENTVSYVTLNKVS  369

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS PPFKVKGLWLFRG++IP+FV+DECYD ELYE ++VDI
Sbjct  370  GFLQRMDLARKYAFGKMLVIGSGPPFKVKGLWLFRGQQIPQFVIDECYDMELYEWQKVDI  429

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+QMIED EPFEGEALLD+KCFK
Sbjct  430  TDEAQKERVNQMIEDHEPFEGEALLDSKCFK  460



>gb|ACU24584.1| unknown [Glycine max]
Length=418

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDEN+ SF T+NKVG
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENSVSFVTLNKVG  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGS+ PFKVKGLWLFRG+EIP+FV+DECYD ELY+  +VDI
Sbjct  328  GFLQRMDLARKYAFGKMLVIGSQAPFKVKGLWLFRGQEIPQFVIDECYDMELYDWTKVDI  387

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  388  FDETQKERVNQMIEDYEPFEGEPLLDAKCFK  418



>gb|AFW87006.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
 gb|AFW87007.1| hypothetical protein ZEAMMB73_710904 [Zea mays]
Length=382

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  232  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  291

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YD ELYE  +VDI
Sbjct  292  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  351

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  352  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  382



>ref|XP_002438602.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
 gb|EER89969.1| hypothetical protein SORBIDRAFT_10g022570 [Sorghum bicolor]
Length=417

 Score =   267 bits (682),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFK+KGLWLFRG+E+PKFV+DE YD ELYE  +VDI
Sbjct  327  GFLQRMDLARKYAFGKMLVIGSEAPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>gb|AFW76480.1| elongation factor gamma1 [Zea mays]
Length=382

 Score =   266 bits (679),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  232  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  291

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YD ELYE  +VDI
Sbjct  292  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  351

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  352  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  382



>ref|NP_001151229.1| elongation factor 1-gamma 2 [Zea mays]
 gb|ACG42059.1| elongation factor 1-gamma 2 [Zea mays]
Length=414

 Score =   266 bits (681),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  264  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE  +VD+
Sbjct  324  GFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGSEIPKFVMDEVYDMELYEWAKVDL  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +   QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  384  SAEAQKERVNAMIEDQEPFEGEALLDAKCFK  414



>ref|XP_004300001.1| PREDICTED: elongation factor 1-gamma-like [Fragaria vesca subsp. 
vesca]
Length=420

 Score =   266 bits (681),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  270  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG EIP+FV+ ECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEIPEFVMQECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  390  SDENQKERVSQMIEDQEPFEGEPLLDAKCFK  420



>ref|NP_001148829.1| elongation factor 1-gamma 3 [Zea mays]
 gb|ACG33050.1| elongation factor 1-gamma 3 [Zea mays]
 gb|AFW87009.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   266 bits (681),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLV+GSEPPFK+KGLWLFRG+E+PKFV+DE YD ELYE  +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVVGSEPPFKLKGLWLFRGQEVPKFVMDEVYDMELYEWTKVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_006845799.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
 gb|ERN07474.1| hypothetical protein AMTR_s00019p00255470 [Amborella trichopoda]
Length=430

 Score =   267 bits (682),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT S+ T+NKV 
Sbjct  280  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSYVTLNKVA  339

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGK+L+IGSEPP+K+KG+WLFRG+EIP+FVLDECYD ELYE  +VDI
Sbjct  340  GFLQRMDLARKYAFGKVLIIGSEPPYKLKGVWLFRGQEIPQFVLDECYDMELYEWTKVDI  399

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  400  NDETQKERVNAMIEDQEPFEGEALLDAKCFK  430



>dbj|BAD94347.1| hypothetical protein [Arabidopsis thaliana]
Length=149

 Score =   257 bits (656),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -3

Query  631  ILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFL  452
            +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVGGFL
Sbjct  2    VLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVGGFL  61

Query  451  QRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDP  272
            QRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI+D 
Sbjct  62   QRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISDE  121

Query  271  VQKERVSQMIEDAEPFEGEALLDAKCFK  188
             QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  122  AQKERVSQMIEDAEPFEGEALLDAKCFK  149



>emb|CDY22629.1| BnaC08g42630D [Brassica napus]
Length=415

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  265  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  325  GFLQRMDLARKYAFGKMLICGSEAPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>emb|CDY31074.1| BnaA08g26240D [Brassica napus]
Length=412

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  262  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  321

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  322  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  381

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  412



>ref|XP_008647353.1| PREDICTED: uncharacterized protein LOC100192872 isoform X1 [Zea 
mays]
 gb|AFW76478.1| elongation factor gamma1 [Zea mays]
Length=417

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YD ELYE  +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDMELYEWTKVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_008218698.1| PREDICTED: elongation factor 1-gamma-like [Prunus mume]
Length=420

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  270  SSMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYD ELY+  +VD+
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYKWTKVDL  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>gb|ACG36145.1| elongation factor 1-gamma 3 [Zea mays]
Length=417

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  267  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFK+KGLWLFRG+++PKFV+DE YD ELYE  +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVIGSEPPFKLKGLWLFRGQDVPKFVMDEVYDIELYEWTKVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  387  SDEAQKERVNAMIEDQEPFEGEALLDAKCFK  417



>ref|XP_004308137.1| PREDICTED: elongation factor 1-gamma-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  270  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG E+P+FV+ ECYD ELYE  +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEVPEFVMQECYDMELYEWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  390  SDENQKERVSQMIEDQEPFEGEPLLDAKCFK  420



>emb|CDX93494.1| BnaA06g05540D [Brassica napus]
Length=413

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_008218696.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
 ref|XP_008218697.1| PREDICTED: elongation factor 1-gamma [Prunus mume]
Length=422

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  272  SSMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYD ELY   +VD+
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDL  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  392  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  422



>ref|XP_009110814.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=412

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  262  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  321

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  322  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  381

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  382  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  412



>ref|XP_009418787.1| PREDICTED: elongation factor 1-gamma 2-like [Musa acuminata subsp. 
malaccensis]
Length=421

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSEPPFKVKG+WLFRG+EIPKFVLDE YD ELY+  +VDI
Sbjct  331  GFLQRMDLTRKYAFGKMLVIGSEPPFKVKGVWLFRGQEIPKFVLDEVYDMELYDWAKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKE V+ MIED EPFEGEALLDAKCFK
Sbjct  391  SDEAQKELVNAMIEDQEPFEGEALLDAKCFK  421



>gb|EPS67955.1| elongation factor 1 gamma-like protein, partial [Genlisea aurea]
Length=422

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  271  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIG  PP+KVKGLWLFRG EIP+FV+DECYD ELY+  +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLVIGGNPPYKVKGLWLFRGTEIPQFVIDECYDVELYDWAKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFE-GEALLDAKCFK  188
            ND  QKERV+QMIEDAEPFE GE LLDAKCFK
Sbjct  391  NDEAQKERVNQMIEDAEPFEGGEPLLDAKCFK  422



>ref|XP_006417552.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
 gb|ESQ35905.1| hypothetical protein EUTSA_v10007759mg [Eutrema salsugineum]
Length=413

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_009148264.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            +  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  TPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_008339412.1| PREDICTED: elongation factor 1-gamma [Malus domestica]
Length=420

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  270  SKMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG+EIPKFV+ ECYD ELY   +VDI
Sbjct  330  GFLQRMDLARKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPKFVMXECYDMELYSWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGEALLDAKCFK
Sbjct  390  SDENQKERVNQMIEDQEPFEGEALLDAKCFK  420



>ref|XP_011470423.1| PREDICTED: elongation factor 1-gamma-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  329  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  388

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG+ PP+KVKGLWLFRG E+P+FV+ ECYD ELYE  +VDI
Sbjct  389  GFLQRMDLARKYAFGKMLIIGANPPYKVKGLWLFRGPEVPEFVMQECYDMELYEWTKVDI  448

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGE LLDAKCFK
Sbjct  449  SDENQKERVSQMIEDQEPFEGEPLLDAKCFK  479



>gb|AAL87298.1| unknown protein [Arabidopsis thaliana]
Length=345

 Score =   262 bits (669),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  195  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  254

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  255  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  314

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  315  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  345



>emb|CDY06365.1| BnaA09g48380D [Brassica napus]
Length=413

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  + DI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEAPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKADI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>emb|CDY50887.1| BnaCnng19790D [Brassica napus]
Length=413

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ G+E PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGAEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_009118302.1| PREDICTED: probable elongation factor 1-gamma 1 [Brassica rapa]
Length=413

 Score =   264 bits (674),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKV+GLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEAPFKVEGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>gb|AAO72563.1| elongation factor 1 gamma-like protein [Oryza sativa Japonica 
Group]
Length=413

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN RE+AIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  263  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YD ELYE  +VD+
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDL  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGE LLDAKCFK
Sbjct  383  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  413



>ref|NP_001057916.1| Os06g0571400 [Oryza sativa Japonica Group]
 sp|Q5Z627.1|EF1G3_ORYSJ RecName: Full=Elongation factor 1-gamma 3; Short=EF-1-gamma 3; 
AltName: Full=eEF-1B gamma 3 [Oryza sativa Japonica Group]
 dbj|BAD61828.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAD61932.1| putative elongation factor 1 gamma [Oryza sativa Japonica Group]
 dbj|BAF19830.1| Os06g0571400 [Oryza sativa Japonica Group]
 dbj|BAG90811.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96325.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN RE+AIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  325

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YD ELYE  +VD+
Sbjct  326  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDL  385

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGE LLDAKCFK
Sbjct  386  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  416



>ref|XP_006302321.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
 gb|EOA35219.1| hypothetical protein CARUB_v10020374mg [Capsella rubella]
Length=413

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>gb|EYU28215.1| hypothetical protein MIMGU_mgv1a007176mg [Erythranthe guttata]
Length=416

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDEN  SF T+NKV 
Sbjct  266  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENKVSFVTLNKVS  325

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSE PFKVKGLWLFRG EIP+F++DECYD ELY+  +VDI
Sbjct  326  GFLQRMDLARKYAFGKMLVIGSEGPFKVKGLWLFRGTEIPQFIIDECYDMELYDWTKVDI  385

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND   KERV+QMIEDAEPFEGE LLDAKCFK
Sbjct  386  NDEAHKERVNQMIEDAEPFEGEPLLDAKCFK  416



>sp|Q9FUM1.1|EF1G_PRUAV RecName: Full=Elongation factor 1-gamma; Short=EF-1-gamma; AltName: 
Full=eEF-1B gamma [Prunus avium]
 gb|AAG17901.1|AF297712_1 translation elongation factor 1-gamma [Prunus avium]
Length=422

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  272  SNMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYD ELY   +VD+
Sbjct  332  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDL  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+Q+IED EPFEGEALLDAKCFK
Sbjct  392  SDENQKERVNQVIEDQEPFEGEALLDAKCFK  422



>ref|XP_010511351.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=414

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  264  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|O04487.1|EF1G1_ARATH RecName: Full=Probable elongation factor 1-gamma 1; Short=EF-1-gamma 
1; AltName: Full=eEF-1B gamma 1 [Arabidopsis thaliana]
 gb|AAB60721.1| Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 
come from this gene [Arabidopsis 
thaliana]
 dbj|BAH20206.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28472.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=414

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  264  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>gb|EAZ37421.1| hypothetical protein OsJ_21756 [Oryza sativa Japonica Group]
Length=440

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN RE+AIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  290  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  349

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YD ELYE  +VD+
Sbjct  350  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDL  409

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGE LLDAKCFK
Sbjct  410  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  440



>ref|XP_010470318.1| PREDICTED: probable elongation factor 1-gamma 2 [Camelina sativa]
Length=413

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_007222927.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
 gb|EMJ24126.1| hypothetical protein PRUPE_ppa005220mg [Prunus persica]
Length=472

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKVG
Sbjct  322  SGMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVG  381

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRG+EIP FV++ECYD ELY   +VD+
Sbjct  382  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPPFVMEECYDMELYNWTKVDL  441

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+QMIED EPFEGE LLDAKCFK
Sbjct  442  SDENQKERVNQMIEDQEPFEGEVLLDAKCFK  472



>ref|XP_006307657.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
 gb|EOA40555.1| hypothetical protein CARUB_v10009284mg [Capsella rubella]
Length=415

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  265  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFKVKGLW+FRG EIPKF++DE YD ELYE  +VDI
Sbjct  325  GFLQRMDLARKYAFGKMLICGSEGPFKVKGLWIFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_010490215.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  265  SSMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  325  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_006656177.1| PREDICTED: elongation factor 1-gamma 3-like [Oryza brachyantha]
Length=416

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN RE+AIKGFWDMYDPEGYSLWFCDYK NDENT SF TMNKVG
Sbjct  266  SKMILDEWKRLYSNTKTNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVG  325

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YD ELY+  +VD+
Sbjct  326  GFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYDWTKVDL  385

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERV+ MIED EPFEGE LLDAKCFK
Sbjct  386  SDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  416



>ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 ref|NP_001031202.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 sp|Q9FVT2.1|EF1G2_ARATH RecName: Full=Probable elongation factor 1-gamma 2; Short=EF-1-gamma 
2; AltName: Full=eEF-1B gamma 2 [Arabidopsis thaliana]
 gb|AAG50755.1|AC079733_23 elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAK43879.1|AF370502_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL11623.1|AF424630_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL16277.1|AF428347_1 At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAL47343.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47351.1| At1g57720/T8L23_18 [Arabidopsis thaliana]
 gb|AAM62488.1| elongation factor 1B gamma, putative [Arabidopsis thaliana]
 gb|AAN41373.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
 gb|AEE33455.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 gb|AEE33456.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=413

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis thaliana]
Length=413

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>ref|XP_002892012.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68271.1| hypothetical protein ARALYDRAFT_474857 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  383  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  413



>emb|CBI29691.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   253 bits (647),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  631  ILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFL  452
            ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK N ENT SF T+ KV GFL
Sbjct  2    ILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNAENTVSFVTLIKVDGFL  61

Query  451  QRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDP  272
            QRMDLA KYAFGKMLVIGSE PFKVKGLWLFRG+EIP+F++DECYD E YE K+VDI+D 
Sbjct  62   QRMDLAHKYAFGKMLVIGSEAPFKVKGLWLFRGQEIPQFIIDECYDMEHYEWKKVDISDE  121

Query  271  VQKERVSQMIEDAEPFEGEALLDAKCFK  188
             QK RV QMIED EPFEGEALLDAKCFK
Sbjct  122  AQKGRVIQMIEDQEPFEGEALLDAKCFK  149



>ref|XP_002889762.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66021.1| hypothetical protein ARALYDRAFT_471063 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  264  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  323

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  324  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  383

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  384  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  414



>ref|XP_010475805.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X2 [Camelina 
sativa]
Length=435

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  285  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  344

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  345  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  404

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  405  TDEAQKERVSQMIEDAEPFEGEALLDAKCFK  435



>gb|AGC13144.1| EF1Bgamma class glutathione S-transferase [Pinus tabuliformis]
Length=421

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKV 
Sbjct  271  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVT  330

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG E PFKVKGLWLFRG EIPKFV+DECYD ELYE  +VDI
Sbjct  331  GFLQRMDLARKYAFGKMLIIGKEGPFKVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDI  390

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  Q+ER + MIED EPFEGE LLDAKCFK
Sbjct  391  NDDAQRERANAMIEDQEPFEGEPLLDAKCFK  421



>ref|XP_003563720.1| PREDICTED: elongation factor 1-gamma 3 [Brachypodium distachyon]
Length=413

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK  DENT S+ T+NKVG
Sbjct  263  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYQDENTVSYVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIG+E PFKVKGLWLFRG++IPKFV+DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGTEAPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDI  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEG+ALLDAKCFK
Sbjct  383  SDEAQKERVSAMIEDLEPFEGQALLDAKCFK  413



>ref|XP_010475804.1| PREDICTED: probable elongation factor 1-gamma 1 isoform X1 [Camelina 
sativa]
Length=415

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N R VAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  265  SPMVLDDWKRLYSNTKSNFRGVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  325  GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  TDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>ref|XP_010458260.1| PREDICTED: probable elongation factor 1-gamma 1 [Camelina sativa]
Length=415

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N R VAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  265  SPMVLDDWKRLYSNTKSNFRGVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  324

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKML+ GSE PFKV GLWLFRG EIPKF++DE YD ELYE  +VDI
Sbjct  325  GFLQRMDLARKYSFGKMLICGSEGPFKVTGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI  384

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  385  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  415



>gb|AHC03515.1| gamma class glutathione S-transferase [Larix kaempferi]
Length=422

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK N+ENT SF T+NKV 
Sbjct  272  SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNEENTVSFVTLNKVT  331

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG   PFKVKGLWLFRG EIPKFV+DECYD ELYE  +VDI
Sbjct  332  GFLQRMDLARKYAFGKMLIIGENGPFKVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDI  391

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  Q+ERV+ MIED EPFEGE LLDAKCFK
Sbjct  392  NDEAQRERVNTMIEDQEPFEGEPLLDAKCFK  422



>emb|CDY20681.1| BnaC08g13770D [Brassica napus]
Length=558

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  262  SPMVLDEWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  321

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+ GSE PFK KGLWLFRG EIPKFV+DE YD ELYE  +VDI
Sbjct  322  GFLQRMDLARKYAFGKMLICGSEGPFKAKGLWLFRGPEIPKFVMDEVYDMELYEWTKVDI  381

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCF  191
            +D  QKERVSQMIEDAEPFEGEALLDAKCF
Sbjct  382  SDEAQKERVSQMIEDAEPFEGEALLDAKCF  411



>ref|XP_003571724.1| PREDICTED: elongation factor 1-gamma 2 [Brachypodium distachyon]
Length=417

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ K+LYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK ++ENT S+ T+NKVG
Sbjct  267  SKMILDDWKKLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYDEENTVSYVTLNKVG  326

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG EIPKFVL+E YD ELYE  +VDI
Sbjct  327  GFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGTEIPKFVLEEVYDMELYEWTKVDI  386

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKER S MIED EPF+GEALLDAKCFK
Sbjct  387  SDEAQKERASAMIEDLEPFDGEALLDAKCFK  417



>gb|ABK25057.1| unknown [Picea sitchensis]
Length=424

 Score =   256 bits (654),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT SF T+NKV 
Sbjct  274  SKMVLDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSFVTLNKVT  333

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG E PFKVKGLWLFRG EIPKF +DECYD ELYE  +VD+
Sbjct  334  GFLQRMDLARKYAFGKMLIIGKEGPFKVKGLWLFRGPEIPKFFVDECYDMELYEWTKVDL  393

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKE V+ MIED EPFEGE LLDAKCFK
Sbjct  394  NDEAQKELVNAMIEDQEPFEGEPLLDAKCFK  424



>ref|NP_001235707.1| elongation factor 1-gamma [Glycine max]
 gb|AAL82617.1|AF475939_1 elongation factor 1-gamma [Glycine max]
Length=420

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK +DENT SF T+NKVG
Sbjct  270  SPMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKNHDENTVSFVTLNKVG  329

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFL RMDLA KY FGKMLVIGS PPFKVKGLWLFRG+EIPKFV+DECYD +L+   +VDI
Sbjct  330  GFLHRMDLAPKYPFGKMLVIGSVPPFKVKGLWLFRGQEIPKFVIDECYDMDLHGWTKVDI  389

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D   KER +QMIED EPFEGEALLDAKCFK
Sbjct  390  SDEAPKERFNQMIEDYEPFEGEALLDAKCFK  420



>gb|EMT01475.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=604

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE K+LYSNTKTN REVAIKGFWDMYDPEGYSLWFCD+K N+ENT SF TMNKVG
Sbjct  454  SKMILDEWKKLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDFKYNEENTVSFVTMNKVG  513

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFL RMDL RKYAFGKMLVIGSEPPFKVKGLWLFRG +IPKFV++E YD  LY+  +VD+
Sbjct  514  GFLLRMDLCRKYAFGKMLVIGSEPPFKVKGLWLFRGPKIPKFVMEEVYDMALYDWAKVDL  573

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVS MIED EPFEGEALLDAKCFK
Sbjct  574  SDAAQKERVSAMIEDLEPFEGEALLDAKCFK  604



>gb|KGN56266.1| hypothetical protein Csa_3G110630 [Cucumis sativus]
Length=402

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 129/151 (85%), Gaps = 7/151 (5%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  259  SSMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMD+ARKYA G MLVI S       GLWLFRGKEIP+FVLDECYD ELYE K+VDI
Sbjct  319  GFLQRMDIARKYALGNMLVILS-------GLWLFRGKEIPQFVLDECYDMELYEWKKVDI  371

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  372  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  402



>gb|EMS60520.1| Elongation factor 1-gamma 2 [Triticum urartu]
Length=413

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTK+N  +VAIKGFW+MYDPEGYSLWFCDYK  +ENT S+ T+NKVG
Sbjct  263  SKMVLDDWKRLYSNTKSNFHDVAIKGFWEMYDPEGYSLWFCDYKYQEENTVSYVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG++IP+FV++E YD ELYE  +VD+
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGQDIPEFVMNEVYDMELYEWTKVDL  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QK+RV  MIED EPFEG+ALLDAKCFK
Sbjct  383  SDEAQKKRVEAMIEDLEPFEGQALLDAKCFK  413



>gb|EMT20600.1| Elongation factor 1-gamma 2 [Aegilops tauschii]
Length=413

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD+ KRLYSNTK+N  +VA+KGFW+MYDPEGYSLWFCDYK  +ENT S+ T+NKVG
Sbjct  263  SKMVLDDWKRLYSNTKSNFHDVAVKGFWEMYDPEGYSLWFCDYKYQEENTVSYVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKMLVIGSE PFKVKGLWLFRG++IP+FV++E YD ELYE  +VD+
Sbjct  323  GFLQRMDLCRKYAFGKMLVIGSEAPFKVKGLWLFRGQDIPEFVMNEVYDMELYEWTKVDL  382

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QK+RV  MIED EPFEG+ALLDAKCFK
Sbjct  383  SDEAQKKRVEAMIEDLEPFEGQALLDAKCFK  413



>gb|AIW07751.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07752.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07753.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07754.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07755.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07756.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07757.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07758.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07761.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07762.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07763.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07764.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07765.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07766.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07767.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07768.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07771.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07772.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07773.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07774.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07775.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07776.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07779.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07780.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07783.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07784.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07785.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07786.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07787.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07788.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07789.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07790.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07791.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07792.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07793.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07794.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07795.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07796.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07797.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07798.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07799.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07800.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07801.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07802.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07803.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07804.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07805.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07806.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07807.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07808.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07809.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07810.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07811.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07813.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07814.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07815.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07816.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07817.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07818.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07819.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07820.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07821.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07822.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07823.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07824.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07825.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07826.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07827.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07828.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07829.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07830.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07831.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07832.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07833.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07834.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07837.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07838.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07841.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07842.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07844.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07845.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07846.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07847.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07848.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07849.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07850.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07851.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07852.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07853.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07854.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07855.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07856.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07857.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07858.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07859.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07860.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07861.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07862.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07864.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   236 bits (603),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT S+ T+NKV 
Sbjct  43   SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVT  102

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG + PFKVKGLWLFRG EIPKFV+DECYD ELYE  +VDI
Sbjct  103  GFLQRMDLARKYAFGKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTKVDI  162

Query  280  NDPVQKERVSQMIEDAEPFE  221
            ND  QKERV+ MIED EPFE
Sbjct  163  NDEAQKERVNAMIEDQEPFE  182



>gb|AIW07759.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07760.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07769.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07770.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07781.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07782.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07812.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07835.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07836.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07839.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07840.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07843.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07863.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   236 bits (603),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT S+ T+NKV 
Sbjct  43   SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVT  102

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IG + PFKVKGLWLFRG EIPKFV+DECYD ELYE  +VDI
Sbjct  103  GFLQRMDLARKYAFGKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTKVDI  162

Query  280  NDPVQKERVSQMIEDAEPFE  221
            ND  QKERV+ MIED EPFE
Sbjct  163  NDDAQKERVNAMIEDQEPFE  182



>gb|EEC80835.1| hypothetical protein OsI_23436 [Oryza sativa Indica Group]
Length=458

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 134/193 (69%), Gaps = 42/193 (22%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIK-----------------------------------  566
            SK ILDE KRLYSNTKTN RE+AIK                                   
Sbjct  266  SKMILDEWKRLYSNTKTNFREIAIKAPAPAPPLLELELSQTVSAPPKLGVELGGALSQNR  325

Query  565  -------GFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKML  407
                   GFWDMYDPEGYSLWFCDYK NDENT SF TMNKVGGFLQRMDL RKYAFGKML
Sbjct  326  HYHVYFPGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGKML  385

Query  406  VIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEP  227
            VIGS PPFKVKGLWLFRG++IPKFV+DE YD ELYE  +VD++D  QKERV+ MIED EP
Sbjct  386  VIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQEP  445

Query  226  FEGEALLDAKCFK  188
            FEGE LLDAKCFK
Sbjct  446  FEGEDLLDAKCFK  458



>gb|AIW07777.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
 gb|AIW07778.1| elongation factor subfamily 1b subunit gamma, partial [Pinus 
krempfii]
Length=182

 Score =   235 bits (599),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILD+ KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFC+YK NDENT S+ T+NKV 
Sbjct  43   SKMILDDWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVT  102

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAF KML+IG + PFKVKGLWLFRG EIPKFV+DECYD ELYE  +VDI
Sbjct  103  GFLQRMDLARKYAFAKMLIIGEKGPFKVKGLWLFRGPEIPKFVIDECYDMELYEWTKVDI  162

Query  280  NDPVQKERVSQMIEDAEPFE  221
            ND  QKERV+ MIED EPFE
Sbjct  163  NDEAQKERVNAMIEDQEPFE  182



>dbj|BAH56923.1| AT1G57720 [Arabidopsis thaliana]
Length=391

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 115/151 (76%), Gaps = 22/151 (15%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD+ KRLYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDEN  SF T+NKVG
Sbjct  263  SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG  322

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGK                      IPKF++DE YD ELYE  +VDI
Sbjct  323  GFLQRMDLARKYSFGK----------------------IPKFIMDEVYDMELYEWTKVDI  360

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIEDAEPFEGEALLDAKCFK
Sbjct  361  SDEAQKERVSQMIEDAEPFEGEALLDAKCFK  391



>ref|XP_011099002.1| PREDICTED: elongation factor 1-gamma 2-like [Sesamum indicum]
Length=391

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 114/151 (75%), Gaps = 27/151 (18%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKV 
Sbjct  268  SKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKML+IGSE P+K    W                       K+VD+
Sbjct  328  GFLQRMDLARKYAFGKMLIIGSEAPYK----W-----------------------KKVDV  360

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ND  QKERV+QMIEDAEPFEGEALLDAKCFK
Sbjct  361  NDEAQKERVNQMIEDAEPFEGEALLDAKCFK  391



>ref|XP_002973046.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
 gb|EFJ26267.1| hypothetical protein SELMODRAFT_98733, partial [Selaginella moellendorffii]
Length=418

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKT-NXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKV  464
            S  +LD+ KRLYSNTK  +  EVA+KGFWDMYDPEGYSLWFCDYK NDENT  F TMNKV
Sbjct  267  SPMVLDDWKRLYSNTKAKDFAEVALKGFWDMYDPEGYSLWFCDYKYNDENTVPFVTMNKV  326

Query  463  GGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
             GFLQRMD  RKYAF K+ ++G +PP+K+KG+WLFRG EIP+ V DECYD ELYE  + D
Sbjct  327  SGFLQRMDFIRKYAFAKICILGDQPPYKIKGVWLFRGPEIPQQVRDECYDLELYEWTKAD  386

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
              D V KER++   E+ +  EGE LL+AKCFK
Sbjct  387  PTDHVHKERINAYFEEPDVIEGEKLLEAKCFK  418



>ref|XP_002984514.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
 gb|EFJ14564.1| hypothetical protein SELMODRAFT_156635 [Selaginella moellendorffii]
Length=430

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKT-NXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKV  464
            S  +LD+ KRLYSNTK  +  EVA+KGFW+MYDPEGYSLWFCDYK NDENT  F TMNKV
Sbjct  279  SPMVLDDWKRLYSNTKAKDFAEVALKGFWEMYDPEGYSLWFCDYKYNDENTVPFVTMNKV  338

Query  463  GGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
             GFLQRMD  RKYAF K+ ++G +PPFK+KG+WLFRG EIP+ V DECYD ELYE  + D
Sbjct  339  SGFLQRMDFIRKYAFAKICILGDQPPFKIKGVWLFRGPEIPQQVRDECYDLELYEWTKAD  398

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
              D V KER++   E+ +  EGE LL+AKCFK
Sbjct  399  PTDHVHKERINAYFEEPDVIEGEKLLEAKCFK  430



>gb|AFP90271.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   200 bits (508),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKAPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90278.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKSPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90281.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDQAQKERVNAMIEDQEPFEGE  116



>gb|AFP90241.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90242.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90243.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90245.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90248.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90249.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90250.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90251.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90252.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90256.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90257.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90259.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90260.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90261.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
 gb|AFP90262.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90263.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90266.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
 gb|AFP90267.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90269.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90270.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90272.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90273.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90274.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90279.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90280.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
 gb|AFP90283.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90284.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90285.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90286.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90287.1| elongation factor 1-gamma 1, partial [Pinus armandii]
Length=117

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90247.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDKELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90268.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   198 bits (504),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV  MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVYAMIEDQEPFEGE  116



>gb|AFP90255.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   198 bits (503),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD E+YE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMEMYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90265.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   198 bits (503),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML++G + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIMGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90276.1| elongation factor 1-gamma 1, partial [Pinus densata]
 gb|AFP90277.1| elongation factor 1-gamma 1, partial [Pinus yunnanensis]
Length=117

 Score =   197 bits (502),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND   KERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAHKERVNAMIEDQEPFEGE  116



>gb|AFP90258.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLW C+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWICEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90264.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELY   +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYGWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90253.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLF G EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFLGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90244.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   196 bits (498),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLW FRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWPFRGPEIPKFVMDECYDVELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90275.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DEC D ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECNDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90254.1| elongation factor 1-gamma 1, partial [Pinus tabuliformis]
Length=117

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKE V+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKECVNAMIEDQEPFEGE  116



>gb|AFP90246.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG +  F
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGLF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE  +VDIND  QKERV+ MIED EPFEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTKVDINDEAQKERVNAMIEDQEPFEGE  116



>gb|AFP90282.1| elongation factor 1-gamma 1, partial [Pinus densata]
Length=117

 Score =   195 bits (496),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  562  FWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPF  383
            FWDMYDPEGYSLWFC+YK NDENT S+ T+NKV GFLQRMDLARKYAFGKML+IG + PF
Sbjct  1    FWDMYDPEGYSLWFCEYKYNDENTVSYVTLNKVTGFLQRMDLARKYAFGKMLIIGEKGPF  60

Query  382  KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGE  215
            KVKGLWLFRG EIPKFV+DECYD ELYE   VDIND  QKERV+ MIED E FEGE
Sbjct  61   KVKGLWLFRGPEIPKFVMDECYDMELYEWTNVDINDEAQKERVNAMIEDQELFEGE  116



>ref|XP_001771013.1| predicted protein [Physcomitrella patens]
 gb|EDQ64168.1| predicted protein [Physcomitrella patens]
 gb|AFZ39147.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=431

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KRLYSNTK     +AI GFW+M+D EGYSLWFCDYK NDEN  +F TMNKVG
Sbjct  281  SPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGYSLWFCDYKYNDENQVTFVTMNKVG  340

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKM ++G E P+K+KG+WLFRG E+P+ VLDE YD ELY+  +VDI
Sbjct  341  GFLQRMDLMRKYAFGKMCILGEEAPYKIKGVWLFRGLEMPQMVLDEVYDAELYDWTKVDI  400

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            N+  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  401  NNEEQKALVNAYFEEPDTIQGEKLLEAKCFK  431



>ref|XP_001758671.1| predicted protein [Physcomitrella patens]
 gb|EDQ76649.1| predicted protein [Physcomitrella patens]
 gb|AFZ39148.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KRLYSNTK     +AI GFW+M+D EGYSLWFCDYK NDEN  +F TMNKVG
Sbjct  278  SPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGYSLWFCDYKYNDENQVTFVTMNKVG  337

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDL RKYAFGKM ++G E PFK++G+WLFRG+++P+ V+DE YD ELY+  +VDI
Sbjct  338  GFLQRMDLVRKYAFGKMCILGEEAPFKIRGVWLFRGQDMPQMVMDEVYDAELYDWTKVDI  397

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            ++  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  398  SNEEQKTLVNAYFEEPDTIQGEKLLEAKCFK  428



>ref|XP_001774148.1| predicted protein [Physcomitrella patens]
 gb|EDQ61062.1| predicted protein [Physcomitrella patens]
 gb|AFZ39149.1| EF1Bgamma class glutathione S-transferase [Physcomitrella patens]
Length=428

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            +  +LD  KRLYSNTK     +AI GFW+M+D EG+SLWFCDYK NDEN  +F TMNKVG
Sbjct  278  TPMVLDNWKRLYSNTKAKDFHLAISGFWEMFDAEGWSLWFCDYKYNDENQVTFVTMNKVG  337

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKY+FGKM ++G  PP+K+KG+WLFRG ++P+ VLDE YD ELYE  +VDI
Sbjct  338  GFLQRMDLARKYSFGKMCILGENPPYKIKGVWLFRGLDVPQMVLDEVYDAELYEWTKVDI  397

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             +  QK  V+   E+ +  +GE LL+AKCFK
Sbjct  398  TNEEQKALVNAYFEEPDTIQGEKLLEAKCFK  428



>ref|XP_004172027.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like, 
partial [Cucumis sativus]
Length=363

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE KRLYSNTKTN REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  259  SSMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  318

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLD  326
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIPKFVLD
Sbjct  319  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPKFVLD  363



>gb|KGN56265.1| hypothetical protein Csa_3G110620 [Cucumis sativus]
Length=379

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 106/151 (70%), Gaps = 31/151 (21%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE K LYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  260  SSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  319

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMD+AR                                VLDECYD ELYE K+VDI
Sbjct  320  GFLQRMDIARN-------------------------------VLDECYDMELYEWKKVDI  348

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +D  QKERVSQMIED EPFEGEALLDAKCFK
Sbjct  349  SDEAQKERVSQMIEDQEPFEGEALLDAKCFK  379



>ref|XP_004134257.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus]
Length=364

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  ILDE K LYSNTK+N REVAIKGFWDMYDPEGYSLWFCDYK NDENT SF T+NKVG
Sbjct  260  SSMILDEWKCLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVG  319

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKF  335
            GFLQRMD+ARKYAFGKMLVIGSE P+KVKGLWLFRGKEIP+F
Sbjct  320  GFLQRMDIARKYAFGKMLVIGSEAPYKVKGLWLFRGKEIPQF  361



>dbj|BAD94101.1| hypothetical protein [Arabidopsis thaliana]
Length=102

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = -3

Query  487  SFXTMNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXE  308
            SF T+NKVGGFLQRMDLARKY+FGKML+ GSE PFKVKGLWLFRG EIPKF++DE YD E
Sbjct  3    SFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDME  62

Query  307  LYEXKQVDINDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            LYE  +VDI+D  QKERVSQ+IEDAEPFEGEALLDAKCFK
Sbjct  63   LYEWTKVDISDEAQKERVSQVIEDAEPFEGEALLDAKCFK  102



>ref|NP_001167773.1| hypothetical protein [Zea mays]
 gb|ACN26025.1| unknown [Zea mays]
Length=96

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -3

Query  475  MNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEX  296
            MNKVGGFLQRMDL RKYAFGKMLV+GSEPPFKVKGLWLFRG EIPKFV+DE YD ELYE 
Sbjct  1    MNKVGGFLQRMDLCRKYAFGKMLVVGSEPPFKVKGLWLFRGPEIPKFVMDEVYDMELYEW  60

Query  295  KQVDINDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             +VD++D  QKERV+ MIED EPFEGEALLDAKCFK
Sbjct  61   TKVDLSDEAQKERVNAMIEDQEPFEGEALLDAKCFK  96



>gb|ABR25394.1| elongation factor 1-gamma 3 [Oryza sativa Indica Group]
Length=94

 Score =   156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -3

Query  469  KVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQ  290
            KVGGFLQRMDL RKYAFGKMLVIGS PPFKVKGLWLFRG++IPKFV+DE YD ELYE  +
Sbjct  1    KVGGFLQRMDLCRKYAFGKMLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTK  60

Query  289  VDINDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            VD++D  QKERV+ MIED EPFEGE LLDAKCFK
Sbjct  61   VDLSDEAQKERVNAMIEDQEPFEGEDLLDAKCFK  94



>ref|XP_007041191.1| Elongation factor 1-gamma 3, putative [Theobroma cacao]
 gb|EOX97022.1| Elongation factor 1-gamma 3, putative [Theobroma cacao]
Length=231

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 86/130 (66%), Gaps = 34/130 (26%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK ILDE KR YSNT+TN REVAIKG                                  
Sbjct  136  SKMILDEWKRPYSNTETNFREVAIKG----------------------------------  161

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMDLARKYAFGKMLVIGSEPPFKVKGL LFRG+EIP+FVLDECYD ELYE K+VDI
Sbjct  162  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLLLFRGQEIPQFVLDECYDVELYEWKKVDI  221

Query  280  NDPVQKERVS  251
            +   QKERVS
Sbjct  222  SAEAQKERVS  231



>ref|XP_005645852.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE21308.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
Length=441

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 105/170 (62%), Gaps = 19/170 (11%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTK-TNXREVAIKGFWDM-----------YDPEGYSLWFCDYKXNDE  497
            SK I+D  KRLYSNT     +E+ + G W+            +DPEGYS+WFC+YK  +E
Sbjct  272  SKMIMDSWKRLYSNTPGAKFKEICVNGLWNGADIPNSPNNEGFDPEGYSIWFCEYKYPEE  331

Query  496  NTXSFXTMNK------VGGFLQRMDLARKYAFGKMLVIGSEP-PFKVKGLWLFRGKEIPK  338
            NT +F  MNK      VGGFLQR+D  RK+AF  M ++  +   F ++G+W+FRG+EIP 
Sbjct  332  NTVNFIVMNKACTSPPVGGFLQRIDYVRKHAFAVMSILKDDKGQFPIRGMWIFRGQEIPA  391

Query  337  FVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             +++EC+D  LYE  +VD +D   +ER+S ++ + +  +G   ++ K FK
Sbjct  392  IMVEECFDLPLYEWNKVDTSDAAVRERISSLLCEEDKIDGLENVEVKVFK  441



>ref|XP_004341586.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19500.1| elongation factor 1-gamma family protein [Acanthamoeba castellanii 
str. Neff]
Length=408

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            +K  LDE KR YSN   +  +VA+  FW+ +D EG+SLW  DYK NDE T  F T N VG
Sbjct  260  TKLDLDEWKRTYSNN--DILKVAMPWFWEHFDAEGWSLWLSDYKYNDELTKMFMTSNLVG  317

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GFLQRMD  RKY FG +L+ G EP  ++ GLWLFRG E+P+  L E  D E +   +VD 
Sbjct  318  GFLQRMDKLRKYGFGSLLIFGEEPKLQIGGLWLFRGTELPE-ELWENPDAEHHTWTKVDH  376

Query  280  NDPVQKERV  254
             DP Q++ V
Sbjct  377  ADPAQRKLV  385



>gb|ETL96568.1| hypothetical protein L917_05966, partial [Phytophthora parasitica]
Length=149

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S   LD  K  YSNTK      A+  FW+  D EGYSLWFCDY  N ENT  F T N VG
Sbjct  2    SSLNLDAWKVQYSNTKN--LADAMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  59

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ +
Sbjct  60   GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  118

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  119  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  149



>gb|EXX52334.1| Tef4p [Rhizophagus irregularis DAOM 197198w]
Length=292

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 85/147 (58%), Gaps = 3/147 (2%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            L+E KR+YSN  T  R  AI  FW+ +DPEGYS+W  DYK NDE T  F + N +GGF  
Sbjct  149  LEEWKRVYSNNDT--RPTAINWFWENFDPEGYSIWRVDYKYNDELTKVFMSSNLIGGFFN  206

Query  448  RMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPV  269
            R++ ARKYAFG ++V+G +    + G ++ RG+E+P+ V D   D E Y   +VD  DP 
Sbjct  207  RLERARKYAFGSLVVLGEDNANSIAGYFVIRGQEVPEEVYDAA-DFESYTFNKVDHTDPS  265

Query  268  QKERVSQMIEDAEPFEGEALLDAKCFK  188
             K      I      +G+   D K FK
Sbjct  266  VKSSFEDYIAWDGHLDGKKYADGKIFK  292



>gb|ETM49712.1| hypothetical protein L914_06089, partial [Phytophthora parasitica]
Length=191

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S   LD  K  YSNTK      A+  FW+  D EGYSLWFCDY  N ENT  F T N VG
Sbjct  44   SSLNLDAWKVQYSNTKN--LADAMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  101

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ +
Sbjct  102  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  160

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  161  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  191



>ref|NP_001184949.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
 dbj|BAH56947.1| AT1G09640 [Arabidopsis thaliana]
 gb|AEE28473.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana]
Length=265

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -3

Query  406  VIGSEPPF-KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPVQKERVSQMIEDAE  230
             + ++P F KVKGLWLFRG EIPKF++DE YD ELYE  +VDI+D  QKERVSQMIEDAE
Sbjct  192  TVVNQPNFTKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDISDEAQKERVSQMIEDAE  251

Query  229  PFEGEALLDAKCFK  188
            PFEGEALLDAKCFK
Sbjct  252  PFEGEALLDAKCFK  265



>gb|ESA05922.1| hypothetical protein GLOINDRAFT_349960 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52332.1| Tef4p [Rhizophagus irregularis DAOM 197198w]
Length=413

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 85/147 (58%), Gaps = 3/147 (2%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            L+E KR+YSN  T  R  AI  FW+ +DPEGYS+W  DYK NDE T  F + N +GGF  
Sbjct  270  LEEWKRVYSNNDT--RPTAINWFWENFDPEGYSIWRVDYKYNDELTKVFMSSNLIGGFFN  327

Query  448  RMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDPV  269
            R++ ARKYAFG ++V+G +    + G ++ RG+E+P+ V D   D E Y   +VD  DP 
Sbjct  328  RLERARKYAFGSLVVLGEDNANSIAGYFVIRGQEVPEEVYDAA-DFESYTFNKVDHTDPS  386

Query  268  QKERVSQMIEDAEPFEGEALLDAKCFK  188
             K      I      +G+   D K FK
Sbjct  387  VKSSFEDYIAWDGHLDGKKYADGKIFK  413



>gb|ETK89973.1| hypothetical protein L915_06156, partial [Phytophthora parasitica]
 gb|ETL43374.1| hypothetical protein L916_06091, partial [Phytophthora parasitica]
Length=235

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S   LD  K  YSNTK      A+  FW+  D EGYSLWFCDY  N ENT  F T N VG
Sbjct  88   SSLNLDAWKVQYSNTKNLAD--AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVG  145

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ +
Sbjct  146  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  204

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  205  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  235



>emb|CBK20805.2| unnamed protein product [Blastocystis hominis]
Length=248

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 4/149 (3%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            LD  KR+YSNT ++   V  K FW MYD EG+S W CDY  N+ENT  F T N V GF+Q
Sbjct  102  LDNWKRIYSNTHSDFYSVMDK-FWPMYDQEGWSCWICDYMYNEENTRGFMTANLVSGFIQ  160

Query  448  RMDLARKYAFGKMLVI--GSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDIND  275
            R D  RKYAFG M ++   +EP ++V G WL RG  I + +LDE  D   Y  ++VD+ +
Sbjct  161  RSDSLRKYAFGNMNILKDANEPFYRVMGGWLIRGTAI-QPMLDENPDAAYYNWRKVDVTN  219

Query  274  PVQKERVSQMIEDAEPFEGEALLDAKCFK  188
               K+ ++ +   +E  +G+ +   + FK
Sbjct  220  EDDKKLLADLWCASETIQGKEINSNEVFK  248



>emb|CCI44608.1| unnamed protein product [Albugo candida]
Length=407

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 85/152 (56%), Gaps = 4/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LDE K  YSNTK      ++K FWD +D EGYS+W CDY  NDEN   F T N + 
Sbjct  259  SKMVLDEWKVQYSNTKPVID--SMKWFWDNFDSEGYSIWMCDYNYNDENKVLFMTSNAIN  316

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GF+QR +  RK+AFG M + G E     + G WLFRG  I   +++   D E Y  K+V 
Sbjct  317  GFIQRSEGVRKFAFGVMHICGKEGSKLNITGCWLFRGDTI-DHMMEANPDAEYYTWKRVA  375

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
              D   K R++    +    EGE L D++ FK
Sbjct  376  TFDDASKARIAAYWCNDNELEGEPLADSRVFK  407



>ref|XP_008867564.1| hypothetical protein H310_04829 [Aphanomyces invadans]
 gb|ETW03335.1| hypothetical protein H310_04829 [Aphanomyces invadans]
Length=418

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 87/152 (57%), Gaps = 4/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK   D+ K  YSNTK   +  A++  WD YDPEGYS WFC Y  N ENT  F T N V 
Sbjct  270  SKLKFDDWKVTYSNTKPLSK--AMQWLWDNYDPEGYSFWFCTYNYNQENTKLFMTCNAVS  327

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPF-KVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RK++FG   V+G+E    ++ G W+FRG+ + + +L+   D E Y   +V+
Sbjct  328  GFLQRSEAMRKFSFGVQSVLGAEGGLIEIVGCWMFRGQSV-EHMLEANPDAEYYTWTKVE  386

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            + D   K R+ +     E  +G+ + D K FK
Sbjct  387  VLDDAAKARIEEYFCSEETIDGKVIADGKVFK  418



>gb|ETK89994.1| hypothetical protein L915_06152 [Phytophthora parasitica]
 gb|ETL43394.1| hypothetical protein L916_06088 [Phytophthora parasitica]
Length=404

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 86/148 (58%), Gaps = 5/148 (3%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            LD  K  YSNTK      A+  FW+  D EGYSLWFCDY  N ENT  F T N VGGFLQ
Sbjct  261  LDAWKVQYSNTKNLAD--AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVGGFLQ  318

Query  448  RMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDP  272
            R +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ ++ND 
Sbjct  319  RSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAELNDE  377

Query  271  VQKERVSQMIEDAEPFEGEALLDAKCFK  188
              K RV+    + +  EG+ + D+K FK
Sbjct  378  T-KARVAAYWCNEDELEGKPIADSKVFK  404



>ref|XP_008891718.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETL43385.1| hypothetical protein L916_06090 [Phytophthora parasitica]
 gb|ETN22469.1| hypothetical protein PPTG_02398 [Phytophthora parasitica INRA-310]
 gb|ETO78816.1| hypothetical protein F444_06339 [Phytophthora parasitica P1976]
 gb|ETP19873.1| hypothetical protein F441_06283 [Phytophthora parasitica CJ01A1]
Length=406

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 86/148 (58%), Gaps = 5/148 (3%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            LD  K  YSNTK      A+  FW+  D EGYSLWFCDY  N ENT  F T N VGGFLQ
Sbjct  263  LDAWKVQYSNTKNLAD--AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVGGFLQ  320

Query  448  RMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDP  272
            R +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ ++ND 
Sbjct  321  RSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAELNDE  379

Query  271  VQKERVSQMIEDAEPFEGEALLDAKCFK  188
              K RV+    + +  EG+ + D+K FK
Sbjct  380  T-KARVAAYWCNEDELEGKPIADSKVFK  406



>gb|ETP19871.1| hypothetical protein F441_06281 [Phytophthora parasitica CJ01A1]
Length=407

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 86/148 (58%), Gaps = 5/148 (3%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            LD  K  YSNTK      A+  FW+  D EGYSLWFCDY  N ENT  F T N VGGFLQ
Sbjct  264  LDAWKVQYSNTKNLAD--AMTWFWEHLDTEGYSLWFCDYNYNSENTKMFMTCNAVGGFLQ  321

Query  448  RMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDINDP  272
            R +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ ++ND 
Sbjct  322  RSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAELNDE  380

Query  271  VQKERVSQMIEDAEPFEGEALLDAKCFK  188
              K RV+    + +  EG+ + D+K FK
Sbjct  381  T-KARVAAYWCNEDELEGKPIADSKVFK  407



>ref|XP_002901767.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57157.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=406

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 88/152 (58%), Gaps = 5/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S   LD  K  YSNT+      A+  FW+  D EGYSLWFCDY  N+ENT  F T N VG
Sbjct  259  SSLNLDAWKVQYSNTRNLAD--AMTWFWEHLDTEGYSLWFCDYNYNNENTKMFMTCNAVG  316

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ +
Sbjct  317  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  375

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +ND   K RV+    + +  EG+ + D+K FK
Sbjct  376  LNDET-KARVAAYWCNEDELEGKPIADSKVFK  406



>emb|CDH60277.1| elongation factor 1 gamma domain-containingprotein [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=399

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 86/151 (57%), Gaps = 7/151 (5%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KR+YSN  T   +VA+K FW+ +D EG+S+W  DY+ NDE T  F + N +G
Sbjct  256  SSFVLDEWKRMYSNNDT---DVAMKWFWENFDKEGWSIWRVDYRYNDELTLVFMSNNLIG  312

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GF  R++ ARKYAFG MLV G+     + G ++ RG+E+P     E YD   Y   + + 
Sbjct  313  GFFARLERARKYAFGSMLVTGTNNNNAISGYFIIRGQEVPY----EIYDAADYPSYKFEK  368

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             +P Q E     IE    +E E   D K FK
Sbjct  369  IEPSQYEEKKDEIEKYMAWEVEGFADGKIFK  399



>emb|CBK21757.2| unnamed protein product [Blastocystis hominis]
Length=392

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 4/149 (3%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            LD  KR+YSNT ++   V  K FW MYD EG+S W CDY  N+ENT  F T N V GF+Q
Sbjct  246  LDNWKRIYSNTHSDFYSVMDK-FWPMYDQEGWSCWICDYMYNEENTRGFMTANLVSGFIQ  304

Query  448  RMDLARKYAFGKMLVI--GSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDIND  275
            R D  RKYAFG M ++   +EP ++V G WL RG  I + +LDE  D   Y  ++VD+ +
Sbjct  305  RSDSLRKYAFGNMNILKDANEPFYRVMGGWLIRGTAI-QPMLDENPDAAYYNWRKVDVTN  363

Query  274  PVQKERVSQMIEDAEPFEGEALLDAKCFK  188
               K+ ++ +   +E  +G+ +   + FK
Sbjct  364  EDDKKLLADLWCASETIQGKEINSNEVFK  392



>ref|XP_002901771.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
 gb|EEY57161.1| elongation factor 1-gamma, putative [Phytophthora infestans T30-4]
Length=367

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 89/155 (57%), Gaps = 6/155 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S   LD  K  YSNT+      A+  FW+  D EGYSLWFCDY  N+ENT  F T N VG
Sbjct  218  SSLNLDAWKVQYSNTRNLAD--AMTWFWEHLDTEGYSLWFCDYNYNNENTKMFMTCNAVG  275

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y  K+ +
Sbjct  276  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMIEANPDAEYYTWKKAE  334

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK*AH  179
            +ND   K RV+    + +  EG+ + D+K F  AH
Sbjct  335  LNDET-KARVAAYWCNEDELEGKPIADSKVFN-AH  367



>emb|CCA15330.1| calciumdependent protein 1 putative [Albugo laibachii Nc14]
Length=422

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 85/152 (56%), Gaps = 4/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LDE K  YSNTK      ++K FWD +D EGYS+W CDY  N+EN   F T N V 
Sbjct  274  SKMVLDEWKVQYSNTKPVSD--SMKWFWDNFDSEGYSIWMCDYNYNEENKVLFMTSNAVN  331

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GF+QR +  RK+AFG M + G E     + G WLFRG  + + +++   D E Y  K+V 
Sbjct  332  GFIQRSEGVRKFAFGVMHICGEEGSKLDITGCWLFRGDTV-EHIMEANPDAEYYTWKRVT  390

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
              D   K R++    +    EG  L D++ FK
Sbjct  391  TFDDASKARIAAYWCNDAELEGRPLADSRVFK  422



>ref|XP_009519315.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
 gb|ACH68459.1| calcium-dependent protein 1 [Phytophthora sojae]
 gb|EGZ24027.1| hypothetical protein PHYSODRAFT_284839 [Phytophthora sojae]
Length=405

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S   LD  K  YSNTK      A+K FW+  D EGYSLWFCDY  N ENT  F T N VG
Sbjct  258  SSMNLDAWKVQYSNTKDLAD--AMKWFWEHLDTEGYSLWFCDYNYNKENTKMFMTCNAVG  315

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y   + +
Sbjct  316  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMVEANPDAEYYTWTKAE  374

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +ND   K R++    + +  EG+ + D+K FK
Sbjct  375  LNDET-KARIAAYWCNEDELEGKPIADSKVFK  405



>ref|XP_006680023.1| hypothetical protein BATDEDRAFT_37118 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79252.1| hypothetical protein BATDEDRAFT_37118 [Batrachochytrium dendrobatidis 
JAM81]
Length=411

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 3/151 (2%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KR+YSN  T  R  A+  FW  +DP+GYS++  DYK N E    F + N VG
Sbjct  264  SSMVLDEWKRVYSNNDT--RPTAVDWFWANFDPQGYSIYKVDYKYNSELAMVFMSSNLVG  321

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GF QR++ +RKYAFG ++++G +   ++ G ++FRG+ IP F + +C D E Y+  +VD 
Sbjct  322  GFFQRLESSRKYAFGSLVILGEDGNNQITGYFVFRGQGIP-FEVSDCPDFESYDFVKVDH  380

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             D   +     ++   E   G+   D K FK
Sbjct  381  TDSAVRAEFEAVLAWDETINGKKCADGKIFK  411



>ref|XP_009519320.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
 gb|EGZ24032.1| hypothetical protein PHYSODRAFT_359164 [Phytophthora sojae]
Length=451

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S   LD  K  YSNTK      A+K FW+  D EGYSLWFCDY  N ENT  F T N VG
Sbjct  304  SSMNLDAWKVQYSNTKDLAD--AMKWFWEHLDTEGYSLWFCDYNYNKENTKMFMTCNAVG  361

Query  460  GFLQRMDLARKYAFGKMLVIGSE-PPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVD  284
            GFLQR +  RKYAFG M V G+E     + G WLFRG +  K +++   D E Y   + +
Sbjct  362  GFLQRSEAMRKYAFGVMDVCGAEGSEIIITGCWLFRG-DSEKHMVEANPDAEYYTWTKAE  420

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +ND   K R++    + +  EG+ + D+K FK
Sbjct  421  LNDET-KARIAAYWCNEDELEGKPIADSKVFK  451



>emb|CDS05969.1| hypothetical protein LRAMOSA08497 [Absidia idahoensis var. thermophila]
Length=401

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 85/151 (56%), Gaps = 7/151 (5%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KR+YSN  T   +VA+K FW+ +D EG+S+W  DY+ NDE T  F + N +G
Sbjct  258  SSFVLDEWKRMYSNNDT---DVAMKWFWENFDNEGWSIWRVDYRYNDELTLVFMSNNLIG  314

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GF  R++ ARKYAFG MLV G+     + G ++ RG+E+P     E YD   Y   + + 
Sbjct  315  GFFARLERARKYAFGSMLVTGTNNNNAISGYFIIRGQEVPY----EIYDAADYPSYKFEK  370

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             +P Q       IE    +E E   D K FK
Sbjct  371  VEPSQYAEKKDEIEKYMAWEVEGFADGKIFK  401



>ref|XP_001562716.1| elongation factor-1 gamma [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM41841.1| elongation factor-1 gamma [Leishmania braziliensis MHOM/BR/75/M2904]
Length=403

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 92/151 (61%), Gaps = 4/151 (3%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F++ YD EGY+ ++  YK N+EN   F T N V 
Sbjct  257  SNFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEENKKQFMTANLVR  314

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            G+ QRM+  RKYAFG  L+IG +   ++ G W+FRGK +P+ +++E  D EL+E +++  
Sbjct  315  GWFQRMEHLRKYAFGIALIIGEDTAHELMGFWVFRGKGMPE-IVNEVVDTELFEWEEIK-  372

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            N   +KE+++  +    P     +L+ +CFK
Sbjct  373  NVQAEKEKITDYLCWEGPTIPRPVLEGRCFK  403



>gb|EPY23706.1| elongation factor 1-gamma [Strigomonas culicis]
Length=254

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD  KR YSN  T  R VA   F++ YDPEGY+ ++C YK N++N   F T N V 
Sbjct  108  SKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTANLVR  165

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++  ++ D
Sbjct  166  GWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIVT-EVVDTENFDWTEIAD  224

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            I    +KE+++  +    P     +L+ + FK
Sbjct  225  IQK--EKEQITDYLAWEGPTIPRPVLEGRVFK  254



>emb|CEP19706.1| hypothetical protein [Parasitella parasitica]
Length=411

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 83/151 (55%), Gaps = 7/151 (5%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK I+D+ KR YSN  TN   VAIK FWD +DPEGYS+W  DYK NDE T +F + N +G
Sbjct  268  SKFIMDQWKREYSNNDTN---VAIKWFWDNFDPEGYSIWKVDYKYNDELTLTFMSNNLIG  324

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GF  R++ A KYAFG M+V G      + G ++ RG+E+P     E YD   Y       
Sbjct  325  GFYARLERAHKYAFGSMIVRGENNKNTISGYFVVRGQEVPF----EIYDAADYGSYNFQK  380

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             +P Q E           ++ E  +D K FK
Sbjct  381  IEPAQYEEKKDEFYKYLAWDFEDCVDGKVFK  411



>gb|EPY29488.1| elongation factor 1-gamma [Strigomonas culicis]
Length=408

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 91/152 (60%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD  KR YSN  T  R VA   F++ YDPEGY+ ++C YK N++N   F T N V 
Sbjct  262  SKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTANLVR  319

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ ++ E  D E ++  ++ D
Sbjct  320  GWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPE-IVTEVVDTENFDWTEIAD  378

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            I    +KE+++  +    P     +L+ + FK
Sbjct  379  IQK--EKEQITDYLAWEGPTIPRPVLEGRVFK  408



>ref|XP_003872780.1| elongation factor-1 gamma [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ24254.1| elongation factor-1 gamma [Leishmania mexicana MHOM/GT/2001/U1103]
Length=404

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 91/152 (60%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F++ YD EGY+ ++  YK N++N   F T N V 
Sbjct  258  SSFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEDNKKQFMTANLVR  315

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG +   ++  LW+FRGK +P+ V  E  D EL+E +++ D
Sbjct  316  GWFQRMEHVRKYAFGIALIIGEDAAHELTSLWVFRGKGMPEIV-SEVVDTELFEWEEIKD  374

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +    +KE+++  +    P     +L+ +CFK
Sbjct  375  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  404



>ref|XP_010704334.1| elongation factor-1 gamma [Leishmania panamensis]
 gb|AIN96012.1| elongation factor-1 gamma [Leishmania panamensis]
Length=403

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 92/152 (61%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F++ YD EGY+ ++  YK N+EN   F T N V 
Sbjct  257  SNFVLDAYKREYSNTDT--RTVAAPYFFEHYDAEGYTCFWARYKYNEENKKQFMTANLVR  314

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG +   ++ G W+FRG  +P+ +++E  D EL+E +++ D
Sbjct  315  GWFQRMEHLRKYAFGVALIIGEDTAHELMGFWVFRGTGMPE-IVNEVVDTELFEWEEIKD  373

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +    +KE+++  +    P     +L+ +CFK
Sbjct  374  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  403



>gb|EPY20606.1| elongation factor 1-gamma [Strigomonas culicis]
Length=483

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            SK +LD  KR YSN  T  R VA   F++ YDPEGY+ ++C YK N++N   F T N V 
Sbjct  337  SKLVLDAFKREYSNNDT--RAVAAPWFFNNYDPEGYTCFWCKYKYNEDNKVPFMTANLVR  394

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG E   ++ G W+FRGK +P+ V  E  D E ++  ++ D
Sbjct  395  GWFQRMEHTRKYAFGVALIIGEEKGHEIVGFWVFRGKGMPEIV-TEVVDTENFDWTEIAD  453

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            I    +KE+++  +    P     +L+ + FK
Sbjct  454  IQK--EKEQITDYLAWEGPTIPRPVLEGRVFK  483



>gb|AAS55635.1| elongation factor 1B gamma 2 [Crithidia fasciculata]
Length=407

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F+  YD EGY+ ++C YK N+EN   F T N V 
Sbjct  261  SSFVLDAFKREYSNTDT--RTVAAPYFFANYDAEGYTCYWCRYKYNEENKMQFMTANMVR  318

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG +    + G+W+FRGK +P+ V  E  D EL++ +++ D
Sbjct  319  GWFQRMEHVRKYAFGIALLIGEDKKHDLVGMWVFRGKGMPEIV-SEVVDTELFDWEEIAD  377

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +     K++++  +    P     +L+ +CFK
Sbjct  378  VQ--AAKDKITDYLCWEGPTIPLPVLEGRCFK  407



>emb|CCC95849.1| unnamed protein product [Trypanosoma congolense IL3000]
Length=406

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 88/152 (58%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F+  YDP GY+ ++C YK N++N   F T N V 
Sbjct  260  SPFVLDNFKREYSNTDT--RTVAAPYFFSNYDPNGYTTFWCRYKYNEDNKMQFMTANLVR  317

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG E    +  LW+FRGK +P  V D   D EL++ +++ D
Sbjct  318  GWFQRMEHTRKYAFGVALIIGEEKRHDIVALWVFRGKGMPDIVKD-VEDTELFDWEEIPD  376

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +    Q+ER++       P   + +L+ + FK
Sbjct  377  VK--AQRERITDYFCWEGPTIPKPVLEGRVFK  406



>gb|KEQ85130.1| eEF1-gamma domain-containing protein [Aureobasidium pullulans 
EXF-150]
Length=414

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 90/151 (60%), Gaps = 9/151 (6%)
 Frame = -3

Query  628  LDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVGGFLQ  449
            +DE KR YSN +T  REVA+  FW+  + E YSLW  DYK NDE T +F + N++GGF  
Sbjct  269  IDELKRKYSNEET--REVALPWFWENVNFEEYSLWRMDYKYNDELTLTFMSNNQIGGFFT  326

Query  448  RMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKE-IPKFVLDECYDXELYEXKQVDINDP  272
            R++ +RKY FG   V GS     ++G +L RG+E +P F  D   D E YE K++D  +P
Sbjct  327  RLEASRKYIFGAASVYGSSNDSLIRGAFLVRGQEALPAF--DVAPDVESYEFKKLDPKNP  384

Query  271  VQKERVSQMI---EDAEPFEGEALLDAKCFK  188
              K+ V  M    E A+P EG+   D K FK
Sbjct  385  EDKKFVEAMWAWDEPAQP-EGKEWADGKVFK  414



>emb|CAC35543.1| elongation factor-1 gamma [Leishmania infantum]
Length=404

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F++ YD EGY+ ++  YK N++N   F T N V 
Sbjct  258  SSFVLDAYKREYSNTDT--RTVAAPYFFEHYDTEGYTCFWARYKYNEDNKKQFMTANLVR  315

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG +   ++   W+FRGK +P+ V  E  D EL+E +++ D
Sbjct  316  GWFQRMEHVRKYAFGVALIIGEDAAHELVSFWVFRGKGMPEIV-SEVVDTELFEWEEIKD  374

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +    +KE+++  +    P     +L+ +CFK
Sbjct  375  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  404



>ref|XP_001463560.1| elongation factor-1 gamma [Leishmania infantum JPCM5]
 emb|CAM65925.1| elongation factor-1 gamma [Leishmania infantum JPCM5]
Length=405

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F++ YD EGY+ ++  YK N++N   F T N V 
Sbjct  259  SSFVLDAYKREYSNTDT--RTVAAPYFFEHYDTEGYTCFWARYKYNEDNKKQFMTANLVR  316

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG +   ++   W+FRGK +P+ V  E  D EL+E +++ D
Sbjct  317  GWFQRMEHVRKYAFGVALIIGEDAAHELVSFWVFRGKGMPEIV-SEVVDTELFEWEEIKD  375

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +    +KE+++  +    P     +L+ +CFK
Sbjct  376  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  405



>ref|XP_003858781.1| elongation factor-1 gamma [Leishmania donovani]
 emb|CBZ32061.1| elongation factor-1 gamma [Leishmania donovani]
Length=450

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F++ YD EGY+ ++  YK N++N   F T N V 
Sbjct  304  SSFVLDAYKREYSNTDT--RTVAAPYFFEHYDTEGYTCFWARYKYNEDNKKQFMTANLVR  361

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG +   ++   W+FRGK +P+ V  E  D EL+E +++ D
Sbjct  362  GWFQRMEHVRKYAFGVALIIGEDAAHELVSFWVFRGKGMPEIV-SEVVDTELFEWEEIKD  420

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +    +KE+++  +    P     +L+ +CFK
Sbjct  421  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  450



>emb|CDS12960.1| hypothetical protein LRAMOSA05144 [Absidia idahoensis var. thermophila]
Length=401

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 82/151 (54%), Gaps = 7/151 (5%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LDE KR YSN  T   +VA+K FW+ +DPEG+S+W   YK NDE T  F + N +G
Sbjct  258  SNFVLDEWKRTYSNNDT---DVAMKWFWEHFDPEGWSIWKATYKYNDELTLVFMSNNLIG  314

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQVDI  281
            GF  R++ ARKYAF  M+V G+     + G ++ RG+E+P     E YD   Y+      
Sbjct  315  GFFARLERARKYAFASMVVTGTNNNNAISGYFIIRGQEVPY----EIYDAADYDSYDFVK  370

Query  280  NDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
             +P Q E     I     +E +   D K FK
Sbjct  371  IEPAQYEEKKDEIYKYMAWEVDGFADGKIFK  401



>ref|XP_001463559.1| elongation factor-1 gamma [Leishmania infantum JPCM5]
 emb|CAM65924.1| elongation factor-1 gamma [Leishmania infantum JPCM5]
Length=453

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 90/152 (59%), Gaps = 6/152 (4%)
 Frame = -3

Query  640  SKXILDEXKRLYSNTKTNXREVAIKGFWDMYDPEGYSLWFCDYKXNDENTXSFXTMNKVG  461
            S  +LD  KR YSNT T  R VA   F++ YD EGY+ ++  YK N++N   F T N V 
Sbjct  307  SSFVLDAYKREYSNTDT--RTVAAPYFFEHYDTEGYTCFWARYKYNEDNKKQFMTANLVR  364

Query  460  GFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGKEIPKFVLDECYDXELYEXKQV-D  284
            G+ QRM+  RKYAFG  L+IG +   ++   W+FRGK +P+ V  E  D EL+E +++ D
Sbjct  365  GWFQRMEHVRKYAFGVALIIGEDAAHELVSFWVFRGKGMPEIV-SEVVDTELFEWEEIKD  423

Query  283  INDPVQKERVSQMIEDAEPFEGEALLDAKCFK  188
            +    +KE+++  +    P     +L+ +CFK
Sbjct  424  VQ--AEKEKITDYLCWEGPTIPRPVLEGRCFK  453



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375