BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF027B15

Length=756
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003635158.1|  PREDICTED: oligopeptide transporter 3-like         363   1e-122   Vitis vinifera
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              374   3e-121   Nicotiana sylvestris
emb|CDP04526.1|  unnamed protein product                                373   1e-120   Coffea canephora [robusta coffee]
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         373   1e-120   Solanum tuberosum [potatoes]
emb|CBI18636.3|  unnamed protein product                                355   3e-120   Vitis vinifera
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              372   5e-120   Solanum lycopersicum
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              369   4e-119   Nicotiana tomentosiformis
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              367   3e-118   Vitis vinifera
gb|KDO78547.1|  hypothetical protein CISIN_1g004659mg                   357   4e-118   Citrus sinensis [apfelsine]
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              365   7e-118   Sesamum indicum [beniseed]
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              365   1e-117   Nelumbo nucifera [Indian lotus]
emb|CBI18634.3|  unnamed protein product                                365   1e-117   Vitis vinifera
gb|ABF98906.1|  oligopeptide transporter 3, putative, expressed         357   3e-117   Oryza sativa Japonica Group [Japonica rice]
gb|KDP35505.1|  hypothetical protein JCGZ_08943                         364   3e-117   Jatropha curcas
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         363   4e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                363   5e-117   Erythranthe guttata [common monkey flower]
ref|XP_002522882.1|  Oligopeptide transporter, putative                 363   5e-117   
gb|KDO78546.1|  hypothetical protein CISIN_1g004659mg                   356   1e-116   Citrus sinensis [apfelsine]
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 362   2e-116   
ref|XP_002463868.1|  hypothetical protein SORBIDRAFT_01g007900          349   2e-116   
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         361   3e-116   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF70152.1|  oligopeptide transporter OPT family protein             361   3e-116   Musa acuminata [banana]
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         361   5e-116   Populus euphratica
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         360   6e-116   Elaeis guineensis
gb|ADW66457.1|  oligopeptide transporter                                360   7e-116   Phytolacca americana [common pokeberry]
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         360   9e-116   Eucalyptus grandis [rose gum]
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            360   9e-116   Populus trichocarpa [western balsam poplar]
gb|AAO32313.1|  putative oligopeptide transporter protein               359   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981750.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    359   3e-115   
ref|XP_008665425.1|  PREDICTED: oligopeptide transporter 3              359   3e-115   
gb|ACL82964.1|  glutathione transporter                                 358   4e-115   Zea mays [maize]
ref|NP_001051290.1|  Os03g0751100                                       359   4e-115   
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              358   6e-115   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   358   7e-115   Citrus sinensis [apfelsine]
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         358   7e-115   Citrus sinensis [apfelsine]
ref|XP_002323123.2|  OLIGOPEPTIDE TRANSPORTER family protein            355   8e-115   
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             357   9e-115   Citrus clementina [clementine]
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              357   1e-114   Populus euphratica
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                357   1e-114   Gossypium arboreum [tree cotton]
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             356   3e-114   
gb|KHN42268.1|  Oligopeptide transporter 3                              355   3e-114   Glycine soja [wild soybean]
gb|AAQ91200.1|  putative glutathione transporter                        355   4e-114   Zea mays [maize]
dbj|BAK07444.1|  predicted protein                                      356   4e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         355   7e-114   Glycine max [soybeans]
gb|EMT33592.1|  Oligopeptide transporter 3                              354   2e-113   
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         354   2e-113   Eucalyptus grandis [rose gum]
gb|KJB67417.1|  hypothetical protein B456_010G190300                    353   5e-113   Gossypium raimondii
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         353   5e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         353   5e-113   Glycine max [soybeans]
ref|XP_006651827.1|  PREDICTED: oligopeptide transporter 3-like         352   8e-113   
gb|KHN03544.1|  Oligopeptide transporter 3                              352   8e-113   Glycine soja [wild soybean]
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              352   1e-112   Prunus mume [ume]
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          352   1e-112   Sorghum bicolor [broomcorn]
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         352   2e-112   Phoenix dactylifera
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    351   3e-112   Arabis alpina [alpine rockcress]
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              350   5e-112   Pyrus x bretschneideri [bai li]
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             350   6e-112   Phaseolus vulgaris [French bean]
ref|XP_006856263.1|  hypothetical protein AMTR_s00047p00062520          349   1e-111   Amborella trichopoda
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             349   1e-111   Capsella rubella
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         349   1e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              349   1e-111   Camelina sativa [gold-of-pleasure]
gb|ADW09325.1|  oligopeptide transporter 3                              348   2e-111   Noccaea caerulescens
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             348   2e-111   Arabidopsis lyrata subsp. lyrata
gb|AAK96781.1|  Unknown protein                                         348   2e-111   Arabidopsis thaliana [mouse-ear cress]
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    348   2e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              348   2e-111   Cucumis melo [Oriental melon]
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             348   3e-111   Eutrema salsugineum [saltwater cress]
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         348   3e-111   Phoenix dactylifera
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              348   3e-111   Brassica rapa
emb|CDY42539.1|  BnaC08g10640D                                          348   3e-111   Brassica napus [oilseed rape]
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3              348   5e-111   Fragaria vesca subsp. vesca
ref|XP_010039444.1|  PREDICTED: oligopeptide transporter 3-like i...    348   5e-111   Eucalyptus grandis [rose gum]
ref|XP_010039447.1|  PREDICTED: oligopeptide transporter 3-like i...    347   6e-111   Eucalyptus grandis [rose gum]
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3-like         347   8e-111   Cucumis sativus [cucumbers]
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         347   9e-111   Malus domestica [apple tree]
emb|CAD91127.1|  glutathione transporter GT1                            343   3e-110   Brassica juncea [brown mustard]
gb|KEH32683.1|  oligopeptide transporter OPT family protein             346   3e-110   Medicago truncatula
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         345   4e-110   Cicer arietinum [garbanzo]
ref|NP_567493.5|  oligopeptide transporter                              344   9e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009374859.1|  PREDICTED: oligopeptide transporter 3-like         344   1e-109   Pyrus x bretschneideri [bai li]
ref|XP_008349335.1|  PREDICTED: oligopeptide transporter 3-like         342   1e-108   
ref|XP_010039443.1|  PREDICTED: oligopeptide transporter 3-like         331   4e-105   Eucalyptus grandis [rose gum]
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              331   1e-104   Tarenaya hassleriana [spider flower]
gb|KCW45990.1|  hypothetical protein EUGRSUZ_L00158                     332   1e-104   Eucalyptus grandis [rose gum]
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              323   8e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         320   1e-100   Elaeis guineensis
emb|CDP04527.1|  unnamed protein product                                298   2e-92    Coffea canephora [robusta coffee]
gb|AAO72613.1|  Isp-4-like protein                                      288   2e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010087657.1|  Oligopeptide transporter 3                         295   5e-91    
gb|KDP35952.1|  hypothetical protein JCGZ_09924                         266   3e-85    Jatropha curcas
gb|ABK94821.1|  unknown                                                 264   4e-82    Populus trichocarpa [western balsam poplar]
ref|XP_010919977.1|  PREDICTED: oligopeptide transporter 4-like         261   6e-82    
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         270   2e-81    Nelumbo nucifera [Indian lotus]
ref|XP_009398499.1|  PREDICTED: oligopeptide transporter 4-like         270   2e-81    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58811.1|  hypothetical protein B456_009G227200                    270   3e-81    Gossypium raimondii
gb|KDO67987.1|  hypothetical protein CISIN_1g020208mg                   258   5e-81    Citrus sinensis [apfelsine]
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             268   1e-80    Selaginella moellendorffii
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         268   1e-80    Pyrus x bretschneideri [bai li]
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         267   3e-80    Solanum tuberosum [potatoes]
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         266   6e-80    Citrus sinensis [apfelsine]
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             266   6e-80    Selaginella moellendorffii
gb|KJB32168.1|  hypothetical protein B456_005G227300                    261   6e-80    Gossypium raimondii
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             266   7e-80    Citrus clementina [clementine]
gb|KEH36459.1|  oligopeptide transporter OPT family protein             261   8e-80    Medicago truncatula
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              266   8e-80    Nicotiana sylvestris
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              266   8e-80    Nicotiana tomentosiformis
ref|XP_007018304.1|  Oligopeptide transporter 2                         266   1e-79    
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              265   2e-79    Solanum lycopersicum
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             265   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like         265   2e-79    Cucumis sativus [cucumbers]
emb|CDO97359.1|  unnamed protein product                                255   2e-79    Coffea canephora [robusta coffee]
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              265   3e-79    Populus euphratica
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         264   3e-79    
ref|XP_002518328.1|  Oligopeptide transporter, putative                 265   3e-79    Ricinus communis
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         264   4e-79    Eucalyptus grandis [rose gum]
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         264   4e-79    Prunus mume [ume]
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         264   5e-79    Elaeis guineensis
ref|XP_004485624.1|  PREDICTED: oligopeptide transporter 4-like         263   6e-79    Cicer arietinum [garbanzo]
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              263   8e-79    Cucumis melo [Oriental melon]
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              263   9e-79    Sesamum indicum [beniseed]
gb|EYU18387.1|  hypothetical protein MIMGU_mgv1a0036351mg               259   1e-78    Erythranthe guttata [common monkey flower]
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             263   1e-78    Prunus persica
ref|XP_007042780.1|  Oligopeptide transporter 4                         266   1e-78    
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                263   1e-78    Gossypium arboreum [tree cotton]
gb|AES90550.2|  oligopeptide transporter OPT family protein             262   1e-78    Medicago truncatula
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         263   2e-78    Eucalyptus grandis [rose gum]
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         263   2e-78    Phoenix dactylifera
ref|XP_003593303.1|  Oligopeptide transporter                           262   2e-78    
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         262   2e-78    Citrus sinensis [apfelsine]
ref|XP_003608353.1|  Oligopeptide transporter                           262   3e-78    
gb|KJB58808.1|  hypothetical protein B456_009G227000                    262   3e-78    Gossypium raimondii
emb|CBI35438.3|  unnamed protein product                                261   3e-78    Vitis vinifera
gb|KJB32170.1|  hypothetical protein B456_005G227300                    262   3e-78    Gossypium raimondii
gb|KJB58809.1|  hypothetical protein B456_009G227000                    256   3e-78    Gossypium raimondii
ref|XP_007159179.1|  hypothetical protein PHAVU_002G215700g             261   4e-78    Phaseolus vulgaris [French bean]
ref|XP_010104576.1|  Oligopeptide transporter 2                         261   4e-78    
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         261   4e-78    
emb|CAN61122.1|  hypothetical protein VITISV_038682                     258   4e-78    Vitis vinifera
gb|KJB32169.1|  hypothetical protein B456_005G227300                    261   5e-78    Gossypium raimondii
ref|XP_010112260.1|  Oligopeptide transporter 4                         261   5e-78    Morus notabilis
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              261   6e-78    Vitis vinifera
ref|XP_003528403.1|  PREDICTED: oligopeptide transporter 4-like         261   7e-78    Glycine max [soybeans]
emb|CAN81605.1|  hypothetical protein VITISV_025060                     261   9e-78    Vitis vinifera
ref|XP_001767301.1|  predicted protein                                  259   9e-78    
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              260   1e-77    
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             260   1e-77    
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     260   1e-77    Eucalyptus grandis [rose gum]
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              260   1e-77    Vitis vinifera
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         260   1e-77    Camelina sativa [gold-of-pleasure]
ref|NP_201246.1|  oligopeptide transporter 4                            260   1e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAM64614.1|  Isp4-like protein                                       260   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             260   1e-77    Arabidopsis lyrata subsp. lyrata
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         260   1e-77    Camelina sativa [gold-of-pleasure]
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    260   1e-77    Phoenix dactylifera
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              259   2e-77    Camelina sativa [gold-of-pleasure]
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             259   2e-77    Eutrema salsugineum [saltwater cress]
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             259   2e-77    Capsella rubella
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              260   2e-77    Tarenaya hassleriana [spider flower]
ref|XP_003545740.1|  PREDICTED: oligopeptide transporter 4              259   3e-77    
gb|KJB32171.1|  hypothetical protein B456_005G227300                    262   3e-77    Gossypium raimondii
gb|KHN33580.1|  Oligopeptide transporter 4                              259   4e-77    Glycine soja [wild soybean]
ref|XP_007148333.1|  hypothetical protein PHAVU_006G200000g             259   4e-77    Phaseolus vulgaris [French bean]
emb|CBI19305.3|  unnamed protein product                                258   5e-77    Vitis vinifera
gb|EMS45133.1|  Oligopeptide transporter 4                              257   5e-77    Triticum urartu
gb|EPS59040.1|  hypothetical protein M569_15770                         254   5e-77    Genlisea aurea
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg             258   5e-77    
emb|CBI19303.3|  unnamed protein product                                260   6e-77    Vitis vinifera
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     258   6e-77    Eucalyptus grandis [rose gum]
ref|XP_007148334.1|  hypothetical protein PHAVU_006G200100g             258   6e-77    Phaseolus vulgaris [French bean]
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         258   7e-77    Nelumbo nucifera [Indian lotus]
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like         258   7e-77    
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              258   1e-76    Brassica rapa
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         258   1e-76    
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             258   1e-76    Citrus clementina [clementine]
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         258   1e-76    Vitis vinifera
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              257   1e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              257   2e-76    Cucumis melo [Oriental melon]
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       257   2e-76    Cucumis sativus [cucumbers]
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         257   2e-76    Eucalyptus grandis [rose gum]
gb|EMT16469.1|  Oligopeptide transporter 4                              258   2e-76    
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like         257   2e-76    Cucumis sativus [cucumbers]
gb|EMT13287.1|  Oligopeptide transporter 4                              252   2e-76    
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         256   3e-76    Camelina sativa [gold-of-pleasure]
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                257   3e-76    Gossypium arboreum [tree cotton]
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     257   3e-76    Eucalyptus grandis [rose gum]
gb|KJB58807.1|  hypothetical protein B456_009G227000                    256   3e-76    Gossypium raimondii
gb|EMT05383.1|  Oligopeptide transporter 4                              253   4e-76    
emb|CDY31321.1|  BnaA02g34200D                                          256   4e-76    Brassica napus [oilseed rape]
emb|CDP19591.1|  unnamed protein product                                253   4e-76    Coffea canephora [robusta coffee]
emb|CDY46800.1|  BnaC02g43080D                                          256   4e-76    Brassica napus [oilseed rape]
dbj|BAJ90957.1|  predicted protein                                      256   5e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              256   5e-76    Tarenaya hassleriana [spider flower]
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    259   5e-76    Arabis alpina [alpine rockcress]
gb|EMS53301.1|  Oligopeptide transporter 4                              253   7e-76    Triticum urartu
ref|XP_006847459.1|  hypothetical protein AMTR_s03508p00001080          246   1e-75    
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         255   1e-75    Eucalyptus grandis [rose gum]
gb|EMS64171.1|  Oligopeptide transporter 4                              252   2e-75    Triticum urartu
ref|XP_007018306.1|  Oligopeptide transporter 4                         254   3e-75    
gb|KHN33579.1|  Oligopeptide transporter 4                              252   4e-75    Glycine soja [wild soybean]
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         253   4e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001266848.1|  uncharacterized protein LOC101027225               244   5e-75    
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             253   5e-75    Capsella rubella
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         252   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         252   1e-74    Brachypodium distachyon [annual false brome]
gb|AFW63465.1|  hypothetical protein ZEAMMB73_812110                    246   1e-74    
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              251   2e-74    Camelina sativa [gold-of-pleasure]
gb|KDP41518.1|  hypothetical protein JCGZ_15925                         251   2e-74    Jatropha curcas
ref|XP_003522744.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    251   3e-74    Glycine max [soybeans]
dbj|BAD08158.1|  putative sexual differentiation process protein ...    251   3e-74    Oryza sativa Japonica Group [Japonica rice]
gb|EEE57620.1|  hypothetical protein OsJ_08019                          251   3e-74    Oryza sativa Japonica Group [Japonica rice]
emb|CDP19592.1|  unnamed protein product                                250   4e-74    Coffea canephora [robusta coffee]
ref|XP_002527347.1|  Oligopeptide transporter, putative                 251   4e-74    Ricinus communis
ref|XP_002892535.1|  ATOPT2                                             251   4e-74    Arabidopsis lyrata subsp. lyrata
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370          250   5e-74    Amborella trichopoda
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             250   6e-74    
gb|EEC73829.1|  hypothetical protein OsI_08562                          250   8e-74    Oryza sativa Indica Group [Indian rice]
emb|CBI19304.3|  unnamed protein product                                250   1e-73    Vitis vinifera
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             249   1e-73    Prunus persica
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              249   1e-73    Vitis vinifera
ref|NP_172464.1|  oligopeptide transporter 2                            249   1e-73    Arabidopsis thaliana [mouse-ear cress]
emb|CDP04528.1|  unnamed protein product                                247   1e-73    Coffea canephora [robusta coffee]
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              249   1e-73    Populus euphratica
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         249   1e-73    Solanum tuberosum [potatoes]
gb|ABE65610.1|  oligopeptide transporter OPT family protein             249   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        249   2e-73    
emb|CDY69955.1|  BnaCnng66090D                                          248   3e-73    Brassica napus [oilseed rape]
gb|KDP41519.1|  hypothetical protein JCGZ_15926                         241   4e-73    Jatropha curcas
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              248   5e-73    Brassica rapa
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    248   5e-73    Setaria italica
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         248   7e-73    Prunus mume [ume]
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         248   7e-73    Nicotiana tomentosiformis
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    248   7e-73    
dbj|BAB89477.1|  isp4 protein-like                                      248   8e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         247   1e-72    Sesamum indicum [beniseed]
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         247   2e-72    Solanum lycopersicum
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like         247   2e-72    Zea mays [maize]
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    247   2e-72    
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                246   2e-72    Erythranthe guttata [common monkey flower]
ref|XP_002977317.1|  hypothetical protein SELMODRAFT_232939             245   3e-72    
gb|EAY75055.1|  hypothetical protein OsI_02950                          246   3e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like         245   5e-72    Cucumis melo [Oriental melon]
dbj|BAD94325.1|  hypothetical protein                                   234   6e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         245   7e-72    Citrus sinensis [apfelsine]
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             244   1e-71    
ref|XP_004164894.1|  PREDICTED: oligopeptide transporter 4-like         244   2e-71    
ref|XP_004136414.1|  PREDICTED: oligopeptide transporter 4-like         244   2e-71    Cucumis sativus [cucumbers]
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             243   2e-71    Eutrema salsugineum [saltwater cress]
ref|XP_008348885.1|  PREDICTED: oligopeptide transporter 4-like         231   2e-71    
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         243   2e-71    
gb|KHG27447.1|  Oligopeptide transporter 2 -like protein                230   3e-71    Gossypium arboreum [tree cotton]
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         243   3e-71    Phoenix dactylifera
emb|CDY22616.1|  BnaC08g42500D                                          245   3e-71    Brassica napus [oilseed rape]
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             243   4e-71    Phaseolus vulgaris [French bean]
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                     243   5e-71    Eucalyptus grandis [rose gum]
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              243   5e-71    Pyrus x bretschneideri [bai li]
ref|XP_004288877.2|  PREDICTED: oligopeptide transporter 2-like         243   6e-71    Fragaria vesca subsp. vesca
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like         242   8e-71    Nelumbo nucifera [Indian lotus]
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         242   9e-71    
ref|XP_010104574.1|  Oligopeptide transporter 4                         242   1e-70    Morus notabilis
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         241   1e-70    Nelumbo nucifera [Indian lotus]
ref|XP_002971950.1|  hypothetical protein SELMODRAFT_148240             241   2e-70    
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000          241   2e-70    
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4              240   3e-70    Fragaria vesca subsp. vesca
emb|CDP00949.1|  unnamed protein product                                241   3e-70    Coffea canephora [robusta coffee]
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         240   6e-70    
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         239   7e-70    Solanum lycopersicum
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         239   1e-69    Brachypodium distachyon [annual false brome]
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         238   2e-69    Nicotiana sylvestris
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         238   2e-69    Nicotiana tomentosiformis
gb|EYU45287.1|  hypothetical protein MIMGU_mgv1a0020141mg               224   2e-69    Erythranthe guttata [common monkey flower]
ref|NP_001056650.2|  Os06g0125400                                       224   3e-69    
emb|CDP19589.1|  unnamed protein product                                238   3e-69    Coffea canephora [robusta coffee]
gb|ACF78596.1|  unknown                                                 228   3e-69    Zea mays [maize]
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         238   3e-69    Nelumbo nucifera [Indian lotus]
ref|XP_002874647.1|  ATOPT7                                             238   4e-69    
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             237   5e-69    
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         237   6e-69    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS65868.1|  hypothetical protein M569_08909                         233   6e-69    Genlisea aurea
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              237   1e-68    Camelina sativa [gold-of-pleasure]
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         236   1e-68    
emb|CDP19590.1|  unnamed protein product                                236   1e-68    
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              236   1e-68    
gb|EYU36438.1|  hypothetical protein MIMGU_mgv1a023798mg                235   1e-68    
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              236   1e-68    
ref|XP_002867483.1|  ATOPT6                                             236   1e-68    
ref|NP_194503.1|  oligopeptide transporter                              236   1e-68    
ref|NP_192815.1|  oligopeptide transporter 7                            236   2e-68    
ref|XP_002867556.1|  ATOPT5                                             236   2e-68    
gb|AAB60748.1|  Similar to S. pombe ISP4 (gb|D83992)                    235   2e-68    
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         235   2e-68    
ref|XP_006413163.1|  hypothetical protein EUTSA_v10024804mg             232   2e-68    
gb|KDO81278.1|  hypothetical protein CISIN_1g0461252mg                  231   2e-68    
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          236   2e-68    
ref|NP_200164.1|  oligopeptide transporter 8                            235   2e-68    
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         235   2e-68    
gb|KHN08229.1|  Oligopeptide transporter 4                              234   2e-68    
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         235   2e-68    
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like         235   3e-68    
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         235   4e-68    
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         235   4e-68    
ref|XP_010448244.1|  PREDICTED: oligopeptide transporter 5-like         235   4e-68    
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              235   4e-68    
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         234   4e-68    
gb|KCW76549.1|  hypothetical protein EUGRSUZ_D00938                     232   4e-68    
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         234   5e-68    
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         234   5e-68    
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             234   7e-68    
ref|XP_007039134.1|  Oligopeptide transporter 1 isoform 3               230   7e-68    
gb|EEC71133.1|  hypothetical protein OsI_02948                          220   7e-68    
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             234   9e-68    
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             234   1e-67    
ref|XP_010438730.1|  PREDICTED: oligopeptide transporter 5              234   1e-67    
ref|XP_006656581.1|  PREDICTED: oligopeptide transporter 7-like         233   1e-67    
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         233   1e-67    
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         233   1e-67    
emb|CDY47076.1|  BnaA03g12220D                                          233   1e-67    
ref|XP_007039133.1|  Oligopeptide transporter 1 isoform 2               231   2e-67    
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         233   2e-67    
ref|XP_010433474.1|  PREDICTED: oligopeptide transporter 5-like         233   2e-67    
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    233   2e-67    
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         233   2e-67    
dbj|BAJ85921.1|  predicted protein                                      224   2e-67    
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         233   2e-67    
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              233   2e-67    
ref|XP_010090089.1|  Oligopeptide transporter 7                         226   2e-67    
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    233   2e-67    
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             233   2e-67    
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             233   3e-67    
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         232   3e-67    
ref|XP_006413037.1|  hypothetical protein EUTSA_v10024519mg             229   3e-67    
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         233   3e-67    
ref|XP_010671041.1|  PREDICTED: oligopeptide transporter 2              232   3e-67    
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              232   3e-67    
emb|CDY06549.1|  BnaC02g12730D                                          232   4e-67    
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    232   4e-67    
emb|CDY55351.1|  BnaAnng13860D                                          231   4e-67    
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         232   4e-67    
ref|XP_010932249.1|  PREDICTED: oligopeptide transporter 5-like         220   4e-67    
emb|CDX96230.1|  BnaC02g14210D                                          232   4e-67    
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         232   5e-67    
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    231   5e-67    
ref|XP_010433323.1|  PREDICTED: oligopeptide transporter 6-like         232   5e-67    
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             232   5e-67    
ref|XP_010448085.1|  PREDICTED: oligopeptide transporter 6              231   5e-67    
emb|CDY38751.1|  BnaC03g14980D                                          231   6e-67    
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    232   6e-67    
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    231   6e-67    
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              231   6e-67    
dbj|BAD94070.1|  sexual differentiation process protein ISP4-like       222   7e-67    
ref|XP_009780017.1|  PREDICTED: oligopeptide transporter 4-like         231   7e-67    
ref|XP_011040149.1|  PREDICTED: oligopeptide transporter 1-like i...    231   8e-67    
ref|XP_007039132.1|  Oligopeptide transporter 1 isoform 1               231   8e-67    
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              231   8e-67    
emb|CDX86844.1|  BnaA09g22340D                                          231   8e-67    
gb|KJB40154.1|  hypothetical protein B456_007G049100                    227   9e-67    
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              231   9e-67    
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              231   9e-67    
emb|CDY28832.1|  BnaA02g10240D                                          231   9e-67    
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         231   1e-66    
emb|CDY19030.1|  BnaC01g20380D                                          231   1e-66    
ref|NP_001167707.1|  uncharacterized protein LOC100381394               229   1e-66    
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         231   1e-66    
ref|XP_004309115.1|  PREDICTED: oligopeptide transporter 6-like         230   1e-66    
ref|NP_194389.1|  oligopeptide transporter 5                            231   1e-66    
ref|XP_004238545.1|  PREDICTED: oligopeptide transporter 4-like         231   1e-66    
ref|XP_002864248.1|  predicted protein                                  230   1e-66    
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         230   1e-66    
ref|XP_010537060.1|  PREDICTED: oligopeptide transporter 6-like         230   2e-66    
ref|NP_001169171.1|  hypothetical protein                               223   2e-66    
ref|XP_010485098.1|  PREDICTED: oligopeptide transporter 8-like         229   2e-66    
ref|XP_009795934.1|  PREDICTED: oligopeptide transporter 7-like i...    228   3e-66    
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    230   3e-66    
ref|XP_006652734.1|  PREDICTED: oligopeptide transporter 4-like         229   3e-66    
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like         229   3e-66    
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             229   3e-66    
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         229   3e-66    
gb|KDP39297.1|  hypothetical protein JCGZ_01054                         229   4e-66    
ref|XP_006413036.1|  hypothetical protein EUTSA_v10024519mg             229   4e-66    
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          229   4e-66    
emb|CDP01884.1|  unnamed protein product                                229   4e-66    
dbj|BAJ85522.1|  predicted protein                                      228   4e-66    
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    229   4e-66    
dbj|BAJ95761.1|  predicted protein                                      228   5e-66    
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg                228   5e-66    
ref|NP_001130398.1|  uncharacterized protein LOC100191494               229   6e-66    
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like         230   7e-66    
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         229   7e-66    
ref|XP_009615074.1|  PREDICTED: oligopeptide transporter 4-like         228   7e-66    
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990          229   7e-66    
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         229   8e-66    
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg                228   8e-66    
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like         228   8e-66    
ref|XP_010483061.1|  PREDICTED: oligopeptide transporter 1              228   9e-66    
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         228   1e-65    
ref|XP_010443233.1|  PREDICTED: oligopeptide transporter 1-like         228   1e-65    
emb|CCO06497.1|  oligopeptide transporter                               228   1e-65    
ref|XP_010317692.1|  PREDICTED: oligopeptide transporter 7-like         228   1e-65    
gb|EMS65130.1|  Oligopeptide transporter 7                              227   1e-65    
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    228   1e-65    
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         228   1e-65    
emb|CBI34570.3|  unnamed protein product                                227   1e-65    
ref|XP_006279740.1|  hypothetical protein CARUB_v10027572mg             228   1e-65    
ref|XP_010450442.1|  PREDICTED: oligopeptide transporter 1-like         228   2e-65    
gb|KJB68518.1|  hypothetical protein B456_010G248000                    228   2e-65    
gb|EMT07894.1|  Oligopeptide transporter 7                              228   2e-65    
ref|NP_001056665.1|  Os06g0127700                                       228   2e-65    
gb|KJB40153.1|  hypothetical protein B456_007G049100                    228   2e-65    
ref|XP_007156163.1|  hypothetical protein PHAVU_003G263700g             223   2e-65    
ref|XP_010536754.1|  PREDICTED: oligopeptide transporter 5-like         228   2e-65    
ref|XP_003603705.1|  Oligopeptide transporter                           227   2e-65    
ref|XP_002864417.1|  ATOPT1                                             227   2e-65    
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              227   2e-65    
ref|XP_007156168.1|  hypothetical protein PHAVU_003G263900g             227   2e-65    
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    227   2e-65    
gb|KDP39295.1|  hypothetical protein JCGZ_01052                         227   2e-65    
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    227   3e-65    
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    227   3e-65    
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          228   3e-65    
ref|XP_009414376.1|  PREDICTED: oligopeptide transporter 5-like         227   3e-65    
gb|EMS65129.1|  Oligopeptide transporter 7                              228   3e-65    
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         226   4e-65    
ref|XP_009414381.1|  PREDICTED: oligopeptide transporter 5-like         226   4e-65    
gb|KDP39296.1|  hypothetical protein JCGZ_01053                         227   4e-65    
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             226   4e-65    
ref|XP_008346658.1|  PREDICTED: oligopeptide transporter 7-like         223   5e-65    
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          226   5e-65    
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    226   6e-65    
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    226   6e-65    
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             226   6e-65    
gb|KDP35527.1|  hypothetical protein JCGZ_08965                         223   7e-65    
gb|KCW53169.1|  hypothetical protein EUGRSUZ_J02450                     222   7e-65    
gb|EEC79904.1|  hypothetical protein OsI_21444                          226   8e-65    
dbj|BAD67732.1|  putative sexual differentiation process protein ...    226   8e-65    
gb|KEH19466.1|  oligopeptide transporter OPT family protein             224   8e-65    
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                226   8e-65    
gb|KCW45497.1|  hypothetical protein EUGRSUZ_L00776                     224   8e-65    
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         226   9e-65    
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    226   9e-65    
ref|XP_004964382.1|  PREDICTED: oligopeptide transporter 7-like i...    226   1e-64    
gb|AAM14671.1|  peptide/glutathione transporter OPT1                    212   1e-64    
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             226   1e-64    
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             225   1e-64    
ref|XP_010113336.1|  Oligopeptide transporter 7                         228   1e-64    
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              225   1e-64    
dbj|BAJ85948.1|  predicted protein                                      225   1e-64    
ref|XP_008374152.1|  PREDICTED: oligopeptide transporter 7-like         223   1e-64    
ref|XP_008390300.1|  PREDICTED: oligopeptide transporter 7 isofor...    224   1e-64    
ref|XP_009137603.1|  PREDICTED: oligopeptide transporter 5-like         225   1e-64    
gb|KCW53166.1|  hypothetical protein EUGRSUZ_J02448                     223   1e-64    
ref|XP_004511249.1|  PREDICTED: oligopeptide transporter 7-like         225   2e-64    
ref|XP_010097383.1|  Oligopeptide transporter 1                         225   2e-64    
ref|XP_003628537.1|  Oligopeptide transporter                           225   2e-64    
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         224   2e-64    
ref|XP_009777242.1|  PREDICTED: oligopeptide transporter 1-like         224   2e-64    
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         225   2e-64    
gb|KGN48927.1|  hypothetical protein Csa_6G506530                       225   2e-64    
emb|CDX92812.1|  BnaC07g40700D                                          224   2e-64    
gb|EPS62495.1|  hypothetical protein M569_12295                         224   2e-64    
emb|CDX94308.1|  BnaC01g18760D                                          224   3e-64    
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like         226   3e-64    
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    224   3e-64    
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like         225   3e-64    
emb|CDX89322.1|  BnaA01g15710D                                          224   3e-64    
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         224   3e-64    
ref|XP_007156164.1|  hypothetical protein PHAVU_003G263700g             223   3e-64    
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         224   4e-64    
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              224   4e-64    
ref|XP_009142514.1|  PREDICTED: oligopeptide transporter 5              224   4e-64    
ref|XP_010034698.1|  PREDICTED: oligopeptide transporter 7-like         224   4e-64    
emb|CDP13696.1|  unnamed protein product                                223   5e-64    
emb|CBI23049.3|  unnamed protein product                                223   5e-64    
ref|XP_002530420.1|  Oligopeptide transporter, putative                 223   6e-64    
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         223   6e-64    
gb|KDP25233.1|  hypothetical protein JCGZ_20389                         223   6e-64    
ref|NP_200404.1|  oligopeptide transporter 1                            223   6e-64    
ref|XP_006452633.1|  hypothetical protein CICLE_v10007763mg             221   7e-64    
ref|XP_007156167.1|  hypothetical protein PHAVU_003G263800g             223   7e-64    
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         223   7e-64    
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             223   7e-64    
gb|AET00810.2|  oligopeptide transporter OPT family protein             223   7e-64    
ref|XP_003617851.1|  Oligopeptide transporter OPT family                223   7e-64    
emb|CDY42726.1|  BnaA03g48130D                                          223   7e-64    
ref|XP_002275134.2|  PREDICTED: oligopeptide transporter 6-like         223   7e-64    
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...    223   7e-64    
ref|XP_007156166.1|  hypothetical protein PHAVU_003G263700g             223   1e-63    
ref|XP_007208018.1|  hypothetical protein PRUPE_ppa003195mg             220   1e-63    
gb|KJB39494.1|  hypothetical protein B456_007G016300                    223   1e-63    
gb|KCW76553.1|  hypothetical protein EUGRSUZ_D00943                     219   1e-63    
ref|XP_007039427.1|  Oligopeptide transporter 7 isoform 2               218   1e-63    
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         222   2e-63    
ref|XP_008366120.1|  PREDICTED: oligopeptide transporter 1-like         221   2e-63    
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    222   3e-63    
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         222   3e-63    
ref|XP_011022429.1|  PREDICTED: oligopeptide transporter 7-like         222   3e-63    
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like         222   3e-63    
emb|CAH67988.1|  OSIGBa0142I02-OSIGBa0101B20.31                         221   3e-63    
dbj|BAJ87692.1|  predicted protein                                      221   3e-63    
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like         222   3e-63    
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    221   3e-63    
gb|KHG17687.1|  Oligopeptide transporter 7                              221   3e-63    



>ref|XP_003635158.1| PREDICTED: oligopeptide transporter 3-like [Vitis vinifera]
Length=283

 Score =   363 bits (931),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  87   TVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIWGLIGPRRLFGPGGLYR  146

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  147  NLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGA  206

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+  LKWWG++LDHCPLA
Sbjct  207  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNENHNLKWWGTKLDHCPLA  266

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPT PGIVVEGCPVF+
Sbjct  267  TCPTQPGIVVEGCPVFQ  283



>ref|XP_009773627.1| PREDICTED: oligopeptide transporter 3 [Nicotiana sylvestris]
Length=751

 Score =   374 bits (961),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIENICD +AL P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  555  TVNLAVAWWMLGSIENICDVEALHPDSPWTCPKFRVTFDASVIWGLIGPQRLFGPGGLYR  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  615  NLVWLFLIGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRK WWQKYNYVLSAALDAGTAFM VLLFFALQNE K LKWWG+ELDHCPLA
Sbjct  675  IFNYFVFKYRKEWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGKNLKWWGTELDHCPLA  734

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGIVV GCPVFK
Sbjct  735  TCPTAPGIVVAGCPVFK  751



>emb|CDP04526.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIEN+CD +AL P SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  559  TVNLAVAWWMLGSIENLCDVEALHPESPWTCPKFRVTFDASVIWGLIGPERLFGPGGLYR  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLF+IGAVLPVPVW+LSKMFP++KWIPLINIPVISYGFAGMPPATPTNI SWI+TG+
Sbjct  619  NLVWLFIIGAVLPVPVWMLSKMFPDQKWIPLINIPVISYGFAGMPPATPTNIASWIITGM  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VLLFFALQNE K +KWWG+E DHCPLA
Sbjct  679  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGKNIKWWGAEPDHCPLA  738

Query  214  SCPTAPGIVVEGCPVFK  164
            SCPTAPGIVVEGCP+FK
Sbjct  739  SCPTAPGIVVEGCPLFK  755



>ref|XP_006352325.1| PREDICTED: oligopeptide transporter 3-like [Solanum tuberosum]
Length=752

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  556  TINLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDASVIWGLIGPERLFGPGGLYR  615

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA+LPVP+WVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  616  NLVWLFLIGALLPVPIWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  675

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRK WW+KYNYVLSAALDAGTAFM VLLFFALQNE K LKWWG+ELDHCPLA
Sbjct  676  IFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMGVLLFFALQNEGKNLKWWGTELDHCPLA  735

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI+V+GCPVFK
Sbjct  736  TCPTAPGIIVQGCPVFK  752



>emb|CBI18636.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   355 bits (910),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  21   TVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIWGLIGPRRLFGPGGLYR  80

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  81   NLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGA  140

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+  LKWWG++LDHCPLA
Sbjct  141  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNENHNLKWWGTKLDHCPLA  200

Query  214  SCPTAPGIVVEGCP  173
            +CPT PGIVVEGCP
Sbjct  201  TCPTQPGIVVEGCP  214



>ref|XP_004250295.1| PREDICTED: oligopeptide transporter 3 [Solanum lycopersicum]
Length=755

 Score =   372 bits (954),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 187/197 (95%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  559  TINLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDASVIWGLIGPERLFGPGGLYR  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA+LPVP+WVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  619  NLVWLFLIGALLPVPIWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRK WW+KYNYVLSAALDAGTAFM VLLFFALQNE K LKWWG+ELDHCPLA
Sbjct  679  IFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMGVLLFFALQNEGKNLKWWGTELDHCPLA  738

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI+V+GCPVF 
Sbjct  739  TCPTAPGIIVQGCPVFN  755



>ref|XP_009590288.1| PREDICTED: oligopeptide transporter 3 [Nicotiana tomentosiformis]
Length=751

 Score =   369 bits (948),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 185/197 (94%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIWGLIGP+RLFG GGLYR
Sbjct  555  TVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIWGLIGPERLFGSGGLYR  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  615  NLVWLFLIGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRK WWQKYNYVLSAALDAGTAFM VLLFFALQNE K LKWWG++LDHCPLA
Sbjct  675  IFNYFVFKYRKEWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGKNLKWWGTQLDHCPLA  734

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGIVV GCPVFK
Sbjct  735  TCPTAPGIVVAGCPVFK  751



>ref|XP_002273768.2| PREDICTED: oligopeptide transporter 3 [Vitis vinifera]
Length=748

 Score =   367 bits (941),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 171/197 (87%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  552  TVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIWGLIGPRRLFGPGGLYR  611

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  612  NLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGA  671

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+  LKWWG++LDHCPLA
Sbjct  672  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNENHNLKWWGTKLDHCPLA  731

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPT PGIVVEGCPVF+
Sbjct  732  TCPTQPGIVVEGCPVFQ  748



>gb|KDO78547.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=441

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  245  VVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  304

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  305  NLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  364

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN    LKWWG+ +DHCPLA
Sbjct  365  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNDINLKWWGTHVDHCPLA  424

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  425  TCPTAPGIAVEGCPVFK  441



>ref|XP_011095913.1| PREDICTED: oligopeptide transporter 3 [Sesamum indicum]
Length=740

 Score =   365 bits (938),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 172/197 (87%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIENICD +AL P SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  544  TVNLAVAWWMLGSIENICDVEALHPESPWTCPKFRVTFDASVIWGLIGPERLFGPGGLYR  603

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW+LSK+FP+KKWIPLINIPVISYGFAGMPPATPTNI SWI+TG 
Sbjct  604  NLVWLFLIGAVLPVPVWILSKIFPDKKWIPLINIPVISYGFAGMPPATPTNIASWIITGT  663

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRK WWQ+YNYVLSAALDAGTAFM VLLFFALQNE K + WWGS+ DHCPLA
Sbjct  664  IFNYFVFKYRKTWWQRYNYVLSAALDAGTAFMGVLLFFALQNEGKNVNWWGSKPDHCPLA  723

Query  214  SCPTAPGIVVEGCPVFK  164
            SCPTAPGI VEGCP F+
Sbjct  724  SCPTAPGIAVEGCPFFR  740



>ref|XP_010270227.1| PREDICTED: oligopeptide transporter 3 [Nelumbo nucifera]
Length=746

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  550  TVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDASVIWGLIGPERLFGPGGLYR  609

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW+LSKMFPEKKWIPLINIPVISYGFAGMPPATPTNI SW+ TG 
Sbjct  610  NLVWLFLIGAVLPVPVWILSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLATGT  669

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQ+YNYVLSAALDAGTAFM VLLFFALQNE + LKWWG++ DHCPLA
Sbjct  670  IFNYFVFRYRKRWWQRYNYVLSAALDAGTAFMGVLLFFALQNEGRNLKWWGTKYDHCPLA  729

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPT PGI V+GCPVFK
Sbjct  730  TCPTEPGIAVKGCPVFK  746



>emb|CBI18634.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  552  TVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIWGLIGPRRLFGPGGLYR  611

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  612  NLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGA  671

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+  LKWWG++LDHCPLA
Sbjct  672  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNENHNLKWWGTKLDHCPLA  731

Query  214  SCPTAPGIVVEGCPVFK*ASS  152
            +CPT PGIVVEGCPV    SS
Sbjct  732  TCPTQPGIVVEGCPVSSGKSS  752



>gb|ABF98906.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95541.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score =   357 bits (917),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  333  VVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPARLFGRHGLYR  392

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI SW+VTG 
Sbjct  393  NLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIASWLVTGT  452

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+ +DHCPLA
Sbjct  453  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTAVDHCPLA  512

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  513  SCPTAPGIAVKGCPVF  528



>gb|KDP35505.1| hypothetical protein JCGZ_08943 [Jatropha curcas]
Length=743

 Score =   364 bits (934),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WWML +IENICD DAL P SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  547  TLNLAVAWWMLENIENICDVDALHPESPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  606

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVP+W+LSKM+PEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  607  NLVWLFLIGAFLPVPIWILSKMYPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  666

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE K LKWWG+E+DHCPLA
Sbjct  667  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGKNLKWWGTEIDHCPLA  726

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  727  SCPTAPGIEVKGCPVF  742



>ref|XP_009380132.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=740

 Score =   363 bits (933),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SIENICD ++L P+SPWTCPK+RVTFDASVIWGLIGP RLFG GGLYR
Sbjct  545  VVNLGVAWWMLESIENICDVESLHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGHGGLYR  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  605  NLVWLFLVGAVLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  664

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQN+   LKWWG+ELDHCPLA
Sbjct  665  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNQDHNLKWWGTELDHCPLA  724

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI VEGCPVF
Sbjct  725  SCPTAPGISVEGCPVF  740



>gb|EYU27660.1| hypothetical protein MIMGU_mgv1a001879mg [Erythranthe guttata]
Length=745

 Score =   363 bits (933),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNLAV WWMLGSIENICD +AL P SPWTCPKFRVTFDASVIWGLIGP+RLFGPGG+YRN
Sbjct  550  VNLAVAWWMLGSIENICDVEALHPESPWTCPKFRVTFDASVIWGLIGPERLFGPGGMYRN  609

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            LVWLFLIGA LPVPVWVLSK++PEKKWIPLINIPVISYGFAGMPPATPTNI SWI+TG +
Sbjct  610  LVWLFLIGAFLPVPVWVLSKIYPEKKWIPLINIPVISYGFAGMPPATPTNIASWIITGTV  669

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYFVFKYRK WWQ+YNYVLSAALDAGTAFM VLLFFALQNE   +KWWGS+ DHCPLAS
Sbjct  670  FNYFVFKYRKTWWQRYNYVLSAALDAGTAFMGVLLFFALQNEGVNVKWWGSQPDHCPLAS  729

Query  211  CPTAPGIVVEGCPVFK  164
            CPTAPGIVV+GCPVF 
Sbjct  730  CPTAPGIVVQGCPVFS  745



>ref|XP_002522882.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39482.1| Oligopeptide transporter, putative [Ricinus communis]
Length=734

 Score =   363 bits (932),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWML ++ENICD +AL P SPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  538  TVNLAVAWWMLENVENICDIEALHPESPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  597

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVP+W+LSKMFPEKKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  598  NLVWLFLIGAFLPVPIWILSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  657

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE K LKWWG+E+DHCPLA
Sbjct  658  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGKTLKWWGTEIDHCPLA  717

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI VEGCPVF
Sbjct  718  TCPTAPGITVEGCPVF  733



>gb|KDO78546.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=527

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  331  VVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  390

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  391  NLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  450

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN    LKWWG+ +DHCPLA
Sbjct  451  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNDINLKWWGTHVDHCPLA  510

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  511  TCPTAPGIAVEGCPVFK  527



>ref|XP_007026362.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
 gb|EOY28984.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
Length=739

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWML SI+NICD +   P SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  543  TVNLAVAWWMLDSIDNICDVEGKHPESPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  603  NLVWLFLIGAVLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE   +KWWG+E+DHCPLA
Sbjct  663  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGHNVKWWGTEVDHCPLA  722

Query  214  SCPTAPGIVVEGCPVFK  164
            SCPTAPGI VEGCPVFK
Sbjct  723  SCPTAPGITVEGCPVFK  739



>ref|XP_002463868.1| hypothetical protein SORBIDRAFT_01g007900 [Sorghum bicolor]
 gb|EER90866.1| hypothetical protein SORBIDRAFT_01g007900 [Sorghum bicolor]
Length=349

 Score =   349 bits (896),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +I+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  154  VVNLAVAWWMLDNIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGRHGLYR  213

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI +W+VTG 
Sbjct  214  NLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIATWLVTGT  273

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQKYNYVLSAALDAGTAFM VL+FFALQN H +LKWWG+E+DHCPLA
Sbjct  274  IFNFFVFRYRKAWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHDLKWWGTEVDHCPLA  333

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  334  SCPTAPGIAVKGCPVF  349



>ref|XP_009397220.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=748

 Score =   361 bits (927),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWMLGSIENICD DAL P SPWTCPK+RVTFDASVIWGL+GP RLFG GGLYR
Sbjct  553  VVNLAVAWWMLGSIENICDVDALHPESPWTCPKYRVTFDASVIWGLVGPGRLFGHGGLYR  612

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GA LPVPVW LSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  613  NLVWLFLVGAALPVPVWALSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  672

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQN +  L+WWG+ELDHCPLA
Sbjct  673  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNANHNLRWWGTELDHCPLA  732

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PGI V+GCPVF
Sbjct  733  SCPTEPGISVKGCPVF  748



>gb|ABF70152.1| oligopeptide transporter OPT family protein [Musa acuminata]
Length=748

 Score =   361 bits (927),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWMLGSIENICD DAL P SPWTCPK+RVTFDASVIWGL+GP RLFG GGLYR
Sbjct  553  VVNLAVAWWMLGSIENICDVDALHPESPWTCPKYRVTFDASVIWGLVGPGRLFGHGGLYR  612

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GA LPVPVW LSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  613  NLVWLFLVGAALPVPVWALSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  672

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQN +  L+WWG+ELDHCPLA
Sbjct  673  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNANHNLRWWGTELDHCPLA  732

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PGI V+GCPVF
Sbjct  733  SCPTEPGISVKGCPVF  748



>ref|XP_011002374.1| PREDICTED: oligopeptide transporter 3-like [Populus euphratica]
Length=744

 Score =   361 bits (926),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWML +IENICDTD L  NSPWTCPK+RVTFDASVIWGLIGP+RLFGP GLYR
Sbjct  549  TVNLAVAWWMLENIENICDTDVLDSNSPWTCPKYRVTFDASVIWGLIGPRRLFGPDGLYR  608

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  609  NLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGMPPATPTNIASWLVTGT  668

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  K+LKWWG+ELDHCPLA
Sbjct  669  IFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNSGKQLKWWGTELDHCPLA  728

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGIVV+GCPVF
Sbjct  729  SCPTAPGIVVKGCPVF  744



>ref|XP_010907563.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=735

 Score =   360 bits (925),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            ++NLAV WWML SIENICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG GGLYR
Sbjct  540  IMNLAVAWWMLESIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGHGGLYR  599

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  600  NLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  659

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQNE++ L WWG+ELDHCPLA
Sbjct  660  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNENRNLSWWGTELDHCPLA  719

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PGI V+GCPVF
Sbjct  720  SCPTEPGISVKGCPVF  735



>gb|ADW66457.1| oligopeptide transporter [Phytolacca americana]
Length=733

 Score =   360 bits (924),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI+N+CD ++L+PNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  538  VVNLAVAWWMLASIDNLCDVESLNPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  597

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW+L K++PEKKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  598  NLVWLFLIGAVLPVPVWILHKIYPEKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  657

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRK WW+KYNYVLSAALDAGTAFMAV +FFALQNE  +LKWWG+++DHCPLA
Sbjct  658  IFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMAVFIFFALQNEKIDLKWWGTDIDHCPLA  717

Query  214  SCPTAPGIVVEGCP  173
            SCPTAPGIVV+GCP
Sbjct  718  SCPTAPGIVVQGCP  731



>ref|XP_010039442.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW45989.1| hypothetical protein EUGRSUZ_L00157 [Eucalyptus grandis]
Length=745

 Score =   360 bits (924),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML  IENICD +AL P+SPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  549  VVNLAVAWWMLDGIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  608

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NL+WLFLIGAVLPVP+W LSKMFPEKKWI LINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  609  NLIWLFLIGAVLPVPIWALSKMFPEKKWIALINIPVISYGFAGMPPATPTNIASWLITGT  668

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQKYNY+LSAALDAGTAFM VLLFFALQNE+K LKWWG+++DHCPLA
Sbjct  669  IFNYFVFRYRKRWWQKYNYILSAALDAGTAFMGVLLFFALQNENKNLKWWGTDIDHCPLA  728

Query  214  SCPTAPGIVVEGCPVFK  164
            SCPTAPGI V  CPVF 
Sbjct  729  SCPTAPGISVPNCPVFN  745



>ref|XP_002308764.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEE92287.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=744

 Score =   360 bits (924),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WWML +IENICDTD L  +SPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  549  TLNLAVAWWMLENIENICDTDVLDSSSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  608

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  609  NLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGMPPATPTNIASWLVTGT  668

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  KELKWWG+E+DHCPLA
Sbjct  669  IFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNSGKELKWWGTEVDHCPLA  728

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGIVV+GCPVF
Sbjct  729  SCPTAPGIVVKGCPVF  744



>gb|AAO32313.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
Length=726

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  531  VVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPARLFGRHGLYR  590

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI SW+VTG 
Sbjct  591  NLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIASWLVTGT  650

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+ +DHCPLA
Sbjct  651  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTAVDHCPLA  710

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  711  SCPTAPGIAVKGCPVF  726



>ref|XP_004981750.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like 
[Setaria italica]
Length=750

 Score =   359 bits (922),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  555  VVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGRHGLYR  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLF++GAVLPVPVW+LS+ FPEKKWI LINIPVISYGFAGMPPATPTNI +W+VTG 
Sbjct  615  NLVWLFVVGAVLPVPVWLLSRAFPEKKWIALINIPVISYGFAGMPPATPTNIATWLVTGT  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+E+DHCPLA
Sbjct  675  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTEVDHCPLA  734

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGIVV+GCPVF
Sbjct  735  SCPTAPGIVVKGCPVF  750



>ref|XP_008665425.1| PREDICTED: oligopeptide transporter 3 [Zea mays]
 tpg|DAA51401.1| TPA: glutathione transporter [Zea mays]
Length=748

 Score =   359 bits (921),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  553  VVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGQHGLYR  612

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI +W+VTG 
Sbjct  613  NLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIATWLVTGT  672

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+E+DHCPLA
Sbjct  673  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTEVDHCPLA  732

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  733  SCPTAPGIAVKGCPVF  748



>gb|ACL82964.1| glutathione transporter [Zea mays]
Length=746

 Score =   358 bits (920),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  551  VVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGQHGLYR  610

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI +W+VTG 
Sbjct  611  NLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIATWLVTGT  670

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+E+DHCPLA
Sbjct  671  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTEVDHCPLA  730

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  731  SCPTAPGIAVKGCPVF  746



>ref|NP_001051290.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|AAR87263.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
 gb|ABF98905.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13204.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|EEC76189.1| hypothetical protein OsI_13528 [Oryza sativa Indica Group]
 gb|EEE59939.1| hypothetical protein OsJ_12589 [Oryza sativa Japonica Group]
Length=757

 Score =   359 bits (921),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  562  VVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPARLFGRHGLYR  621

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI SW+VTG 
Sbjct  622  NLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIASWLVTGT  681

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+ +DHCPLA
Sbjct  682  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTAVDHCPLA  741

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  742  SCPTAPGIAVKGCPVF  757



>ref|XP_010686627.1| PREDICTED: oligopeptide transporter 3 [Beta vulgaris subsp. vulgaris]
Length=741

 Score =   358 bits (919),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +I+N+CD ++L+PNSPWTCPKFRVTFDASVIWGLIGP RLFG GGLYR
Sbjct  546  VVNLAVAWWMLATIDNLCDVESLNPNSPWTCPKFRVTFDASVIWGLIGPNRLFGSGGLYR  605

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWVL KMFP+ KWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  606  NLVWLFLIGAVLPVPVWVLHKMFPKNKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  665

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRK WW++YNYVLSAALDAGTAFMAVL+FFALQNE+KELKWWG+++DHCPLA
Sbjct  666  IFNYFVFKYRKEWWKRYNYVLSAALDAGTAFMAVLIFFALQNENKELKWWGTDIDHCPLA  725

Query  214  SCPTAPGIVVEGCPV  170
            SCPTAPGI+VE CP+
Sbjct  726  SCPTAPGIMVEKCPL  740



>gb|KDO78542.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=739

 Score =   358 bits (918),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  543  VVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  603  NLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN    LKWWG+ +DHCPLA
Sbjct  663  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNDINLKWWGTHVDHCPLA  722

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  723  TCPTAPGIAVEGCPVFK  739



>ref|XP_006467278.1| PREDICTED: oligopeptide transporter 3-like [Citrus sinensis]
Length=739

 Score =   358 bits (918),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  543  VVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  603  NLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN    LKWWG+ +DHCPLA
Sbjct  663  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNDINLKWWGTHVDHCPLA  722

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  723  TCPTAPGIAVEGCPVFK  739



>ref|XP_002323123.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEF04884.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=661

 Score =   355 bits (912),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWML +IENICD D+   NSPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  466  TVNLAVAWWMLENIENICDVDSQDSNSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  525

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGMPP+TPTNI SW++TG 
Sbjct  526  NLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGMPPSTPTNIASWLITGT  585

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  K+L WWG+ELDHCPLA
Sbjct  586  IFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNTDKKLSWWGAELDHCPLA  645

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGIVV+GCPVF
Sbjct  646  TCPTAPGIVVKGCPVF  661



>ref|XP_006449924.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
 gb|ESR63164.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
Length=739

 Score =   357 bits (917),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML S+ENICD ++L P+S WTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  543  VVNLGVAWWMLESVENICDVESLHPDSQWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  603  NLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGM  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN    LKWWG+ +DHCPLA
Sbjct  663  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNDINLKWWGTHVDHCPLA  722

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  723  TCPTAPGIAVEGCPVFK  739



>ref|XP_011040169.1| PREDICTED: oligopeptide transporter 3 [Populus euphratica]
Length=743

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWML +IENICD D+   NSPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  548  TVNLAVAWWMLENIENICDVDSQDSNSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  608  NLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGMPPATPTNIASWLITGT  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  K+L WWG+ELDHCPLA
Sbjct  668  IFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNTDKKLSWWGAELDHCPLA  727

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGIVV+GCPVF
Sbjct  728  TCPTAPGIVVKGCPVF  743



>gb|KHG20373.1| Oligopeptide transporter 3 -like protein [Gossypium arboreum]
Length=741

 Score =   357 bits (917),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNL V WWML  I+NICD +   P+SPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  545  IVNLGVAWWMLDDIDNICDVEGNHPDSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  605  NLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  664

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQNE   LKWWG+E+DHCPLA
Sbjct  665  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGHNLKWWGTEVDHCPLA  724

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  725  TCPTAPGISVEGCPVFK  741



>ref|XP_007211357.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
 gb|EMJ12556.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
Length=733

 Score =   356 bits (914),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML SI+N+CD DAL PNSPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  538  IVNLAVAWWMLESIDNLCDIDALHPNSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  597

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLF++GA LPVP+W+LSK+FP+KKWIPLIN+PVI+YGFAGMPPATPTNI SW++TG 
Sbjct  598  NLVWLFIVGAFLPVPIWILSKIFPDKKWIPLINMPVITYGFAGMPPATPTNIASWLITGG  657

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN +  +KWWG+ELDHCPLA
Sbjct  658  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNNYNVKWWGTELDHCPLA  717

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI VEGCPVF
Sbjct  718  TCPTAPGIKVEGCPVF  733



>gb|KHN42268.1| Oligopeptide transporter 3 [Glycine soja]
Length=698

 Score =   355 bits (910),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  502  VVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  561

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGMPPATP NI SW+VTG+
Sbjct  562  NLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGMPPATPANIASWLVTGM  621

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN    LKWWGSELDHCPLA
Sbjct  622  IFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAGHNLKWWGSELDHCPLA  681

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  682  TCPTAPGIEVEGCPVFK  698



>gb|AAQ91200.1| putative glutathione transporter [Zea mays]
Length=721

 Score =   355 bits (912),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  526  VVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGQHGLYR  585

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI +W+VTG 
Sbjct  586  NLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIATWLVTGT  645

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+E+DHCPLA
Sbjct  646  IFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTEVDHCPLA  705

Query  214  SCPTAPGIVVEGCPVF  167
            SCP APGI V+GCPVF
Sbjct  706  SCPPAPGIAVKGCPVF  721



>dbj|BAK07444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   356 bits (913),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SIENICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  550  VVNLAVAWWMLDSIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGQHGLYR  609

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLF++GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGFAGMPPATPTNI SW+VTG 
Sbjct  610  NLVWLFVVGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGFAGMPPATPTNIASWLVTGT  669

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H +LKWWG+E+DHCPLA
Sbjct  670  VFNFFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHDLKWWGTEVDHCPLA  729

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGIVV+GCPVF
Sbjct  730  TCPTAPGIVVKGCPVF  745



>ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=742

 Score =   355 bits (911),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  546  VVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  605

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGMPPATP NI SW+VTG+
Sbjct  606  NLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGMPPATPANIASWLVTGM  665

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN    LKWWGSELDHCPLA
Sbjct  666  IFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAGHNLKWWGSELDHCPLA  725

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI VEGCPVFK
Sbjct  726  TCPTAPGIEVEGCPVFK  742



>gb|EMT33592.1| Oligopeptide transporter 3 [Aegilops tauschii]
Length=750

 Score =   354 bits (909),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  555  VVNLAVAWWMLDSIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGQHGLYR  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLF++GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGFAGMPPATPTNI SW+VTG 
Sbjct  615  NLVWLFVVGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGFAGMPPATPTNIASWLVTGT  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H +LKWWG+E+DHCPLA
Sbjct  675  VFNFFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHDLKWWGTEVDHCPLA  734

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGIVV+GCPVF
Sbjct  735  TCPTAPGIVVKGCPVF  750



>ref|XP_010057794.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW75109.1| hypothetical protein EUGRSUZ_E03859 [Eucalyptus grandis]
Length=744

 Score =   354 bits (908),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML +I +ICD +   P+SPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  548  LVNLAVAWWMLENINDICDVEGQHPDSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+WVLSK+FPEKKWI LINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  608  NLVWLFLIGAVLPVPIWVLSKIFPEKKWIALINIPVISYGFAGMPPATPTNIASWLITGM  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN ++ LKWWGSELDHCPLA
Sbjct  668  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNNRNLKWWGSELDHCPLA  727

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PGIVV+GC VF
Sbjct  728  SCPTEPGIVVKGCRVF  743



>gb|KJB67417.1| hypothetical protein B456_010G190300 [Gossypium raimondii]
Length=741

 Score =   353 bits (906),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNL V WWML  I+NICD +   P+SPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  545  IVNLGVAWWMLDDIDNICDVEGNHPDSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  605  NLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  664

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQNE   LKWWG+E+DHCPLA
Sbjct  665  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGHNLKWWGTEVDHCPLA  724

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI V+GC VFK
Sbjct  725  TCPTAPGISVDGCRVFK  741



>ref|XP_009404107.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   353 bits (905),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            V+NL+V WWML +IENICD D+L P+SPWTCPK+RVTFDASVIWGLI P RLFG GGLYR
Sbjct  543  VLNLSVAWWMLENIENICDVDSLHPDSPWTCPKYRVTFDASVIWGLIAPGRLFGHGGLYR  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWVLSK+FPEKKWI LIN+PVI+YGFAGMPPATPTNI SW++TG 
Sbjct  603  NLVWLFLVGAVLPVPVWVLSKVFPEKKWISLINVPVITYGFAGMPPATPTNIASWLITGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQ+YNYVLSAALDAGTAFM VLLFFALQN+H  L WWGSELDHCPLA
Sbjct  663  IFNYFVFRYRKVWWQRYNYVLSAALDAGTAFMGVLLFFALQNQHHNLHWWGSELDHCPLA  722

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  723  SCPTAPGISVKGCPVF  738



>ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=741

 Score =   353 bits (905),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI++IC  D +  +SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  545  VVNLAVAWWMLDSIKDICMDDKVHHDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGMPPATP NI SW+VTG+
Sbjct  605  NLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGMPPATPANIASWLVTGM  664

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN    LKWWGSELDHCPLA
Sbjct  665  IFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAGHNLKWWGSELDHCPLA  724

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI V+GCPVFK
Sbjct  725  TCPTAPGIEVDGCPVFK  741



>ref|XP_006651827.1| PREDICTED: oligopeptide transporter 3-like [Oryza brachyantha]
Length=742

 Score =   352 bits (904),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWMLG+I+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  547  VVNLAVAWWMLGNIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPARLFGRHGLYR  606

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWL   GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGFAGMPPATPTNI SW+VTG 
Sbjct  607  NLVWLGGAGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGFAGMPPATPTNIASWLVTGT  666

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H ELKWWG+E+DHCPLA
Sbjct  667  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHELKWWGTEVDHCPLA  726

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  727  SCPTAPGIAVKGCPVF  742



>gb|KHN03544.1| Oligopeptide transporter 3 [Glycine soja]
Length=725

 Score =   352 bits (903),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI++IC  D +  +SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  529  VVNLAVAWWMLDSIKDICMDDKVHHDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  588

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGMPPATP NI SW+VTG+
Sbjct  589  NLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGMPPATPANIASWLVTGM  648

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN    LKWWGSELDHCPLA
Sbjct  649  IFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAGHNLKWWGSELDHCPLA  708

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPTAPGI V+GCPVFK
Sbjct  709  TCPTAPGIEVDGCPVFK  725



>ref|XP_008224626.1| PREDICTED: oligopeptide transporter 3 [Prunus mume]
Length=739

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML SI+N+CD DA  PNSPWTCPK++VTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  544  IVNLAVAWWMLESIDNLCDIDAHHPNSPWTCPKYKVTFDASVIWGLIGPRRLFGPGGLYR  603

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLF++GA LPVP+W+LSK+FP+KKWIPLIN+PVI+YGFAGMPPATPTNI SW++TG 
Sbjct  604  NLVWLFIVGAFLPVPIWILSKIFPDKKWIPLINMPVITYGFAGMPPATPTNIASWLITGG  663

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN +  +KWWG+ELDHCPLA
Sbjct  664  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNNYNVKWWGTELDHCPLA  723

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI VEGCPVF
Sbjct  724  TCPTAPGIKVEGCPVF  739



>ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
 gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
Length=747

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +I+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  552  VVNLAVAWWMLDNIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGRHGLYR  611

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI +W+VTG 
Sbjct  612  NLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIATWLVTGT  671

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQKYNYVLSAALDAGTAFM VL+FFALQN H +LKWWG+E+DHCPLA
Sbjct  672  IFNFFVFRYRKAWWQKYNYVLSAALDAGTAFMGVLIFFALQNAHHDLKWWGTEVDHCPLA  731

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  732  SCPTAPGIAVKGCPVF  747



>ref|XP_008780991.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=735

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            ++NLAV WWML SI+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG GGLYR
Sbjct  540  IMNLAVAWWMLESIDNICDFEALHPDSPWTCPKYRVTFDASVIWGLIGPSRLFGHGGLYR  599

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGA LPVPVWVLSK+FPEK+WIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  600  NLVWLFLIGAFLPVPVWVLSKIFPEKEWIPLINIPVISYGFAGMPPATPTNIASWLITGT  659

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFF LQNE++ L WWG++LDHCPLA
Sbjct  660  IFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFVLQNENRNLSWWGTDLDHCPLA  719

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PGI V+GCPVF
Sbjct  720  SCPTEPGISVKGCPVF  735



>gb|KFK26550.1| hypothetical protein AALP_AA8G263100 [Arabis alpina]
Length=734

 Score =   351 bits (900),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 177/195 (91%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V WWML SI++ICD + + PNSPWTCPK+RVTFDASVIWGLIGPKRLFG GG+YRN
Sbjct  540  VNLGVAWWMLESIQDICDIEGVHPNSPWTCPKYRVTFDASVIWGLIGPKRLFGAGGMYRN  599

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            LVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG I
Sbjct  600  LVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGTI  659

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLAS
Sbjct  660  FNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLAS  719

Query  211  CPTAPGIVVEGCPVF  167
            CPTAPGI+ +GCPVF
Sbjct  720  CPTAPGIIAKGCPVF  734



>ref|XP_009374520.1| PREDICTED: oligopeptide transporter 3 [Pyrus x bretschneideri]
Length=749

 Score =   350 bits (899),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML SIENICD ++ +PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  554  IVNLAVAWWMLESIENICDVESQNPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  613

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GA LPVP+WV+SK+FP+KKWIPLIN+PVI YGFAGMPPATPTNI SW++TG 
Sbjct  614  NLVWLFLVGAFLPVPIWVMSKIFPDKKWIPLINMPVILYGFAGMPPATPTNIASWLITGG  673

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN   ELKWWG++LDHCPLA
Sbjct  674  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPKHELKWWGTKLDHCPLA  733

Query  214  SCPTAPGIVVEGCPVF  167
            +CP APGI V+GCPVF
Sbjct  734  TCPIAPGIHVDGCPVF  749



>ref|XP_007154044.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
 gb|ESW26038.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
Length=741

 Score =   350 bits (898),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  545  VVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+WVLSK++PEKKWIPLINIPVISYGFAGMPPATP NI SW++TG+
Sbjct  605  NLVWLFLIGAVLPVPIWVLSKIYPEKKWIPLINIPVISYGFAGMPPATPANIASWLLTGM  664

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN    LKWWGSE+DHCPLA
Sbjct  665  IFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAGHNLKWWGSEMDHCPLA  724

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI V+GCPVF
Sbjct  725  TCPTAPGIEVDGCPVF  740



>ref|XP_006856263.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
 gb|ERN17730.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
Length=738

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLA+ WWMLGSI+++CD ++L PNSPWTCPK+RVTFD+SVIWGLIGP+RLFGPGG+YR
Sbjct  543  TVNLAIAWWMLGSIKDLCDVESLHPNSPWTCPKYRVTFDSSVIWGLIGPRRLFGPGGMYR  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GA+LP+PVWVLSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG+
Sbjct  603  NLVWLFLVGALLPIPVWVLSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGM  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y KGWWQKYNYVLSAALDAGTAFM VLL+FAL  E++ L WWG++LDHCPLA
Sbjct  663  IFNYFVFRYNKGWWQKYNYVLSAALDAGTAFMGVLLYFALGMENRNLNWWGTQLDHCPLA  722

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PG+ V GCPVF
Sbjct  723  SCPTEPGVSVAGCPVF  738



>ref|XP_006283198.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
 gb|EOA16096.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
Length=737

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW LSK+FP+KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVWLFLIGAVLPVPVWALSKIFPKKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  662  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  721

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  722  SCPTAPGIKAKGCPVF  737



>ref|XP_010440168.1| PREDICTED: oligopeptide transporter 3-like [Camelina sativa]
Length=737

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVWLFLIGAVLPVPVWALSKVFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  662  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  721

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  722  SCPTAPGIKAKGCPVF  737



>ref|XP_010449801.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=737

 Score =   349 bits (895),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVWLFLIGAVLPVPVWALSKVFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  662  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  721

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  722  SCPTAPGIKAKGCPVF  737



>gb|ADW09325.1| oligopeptide transporter 3 [Noccaea caerulescens]
Length=736

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD + + PNSPWTCPK+RVTFDASVIWGLIGPKRLFG GG+YR
Sbjct  541  VVNLGVAWWMLESIQDICDIEGVHPNSPWTCPKYRVTFDASVIWGLIGPKRLFGAGGMYR  600

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW +SK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  601  NLVWLFLIGAVLPVPVWAMSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  660

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  661  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  720

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI V+GCPVF
Sbjct  721  TCPTAPGIRVKGCPVF  736



>ref|XP_002868139.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44398.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  662  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  721

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  722  SCPTAPGIKAKGCPVF  737



>gb|AAK96781.1| Unknown protein [Arabidopsis thaliana]
Length=737

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  662  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  721

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  722  SCPTAPGIKAKGCPVF  737



>sp|O23482.3|OPT3_ARATH RecName: Full=Oligopeptide transporter 3; Short=AtOPT3 [Arabidopsis 
thaliana]
 gb|AAN72034.1| isp4 like protein [Arabidopsis thaliana]
Length=737

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  662  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  721

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  722  SCPTAPGIKAKGCPVF  737



>ref|XP_008464311.1| PREDICTED: oligopeptide transporter 3 [Cucumis melo]
Length=745

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WWML SIENICD DAL   SPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  550  TINLAVAWWMLDSIENICDDDALHAESPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  609

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+W LSK FPEKKWI LINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  610  NLVWLFLIGAVLPVPIWALSKAFPEKKWIKLINIPVISYGFAGMPPATPTNIASWLMTGT  669

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN    L+WWGS+ DHCPLA
Sbjct  670  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHNLRWWGSQPDHCPLA  729

Query  214  SCPTAPGIVVEGCPVF  167
             CPTAPGI V+GCPVF
Sbjct  730  KCPTAPGIAVKGCPVF  745



>ref|XP_006414361.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
 gb|ESQ55814.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
Length=736

 Score =   348 bits (893),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  541  VVNLGVAWWMLESIQDICDIEGEHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  600

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW +SK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  601  NLVWLFLIGAVLPVPVWAMSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  660

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  661  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  720

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI  +GCPVF
Sbjct  721  TCPTAPGIRAKGCPVF  736



>ref|XP_008785648.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=730

 Score =   348 bits (893),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML +IENICDTDAL  +SPWTCPK+RVTFDASVIWGLIGP RLF  GGLYR
Sbjct  535  VVNLAVAWWMLENIENICDTDALPSDSPWTCPKYRVTFDASVIWGLIGPSRLFAHGGLYR  594

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+W+LSKM+P+KKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  595  NLVWLFLIGAVLPVPIWLLSKMYPKKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  654

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FV +YRK WWQKYNYVLSAALDAGTAFM VLLF ALQN+H  + WWG+E+DHCPLA
Sbjct  655  IFNFFVLRYRKEWWQKYNYVLSAALDAGTAFMGVLLFLALQNQHIGVHWWGTEVDHCPLA  714

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PGIVV+GCPVF
Sbjct  715  SCPTEPGIVVKGCPVF  730



>ref|XP_009124517.1| PREDICTED: oligopeptide transporter 3 [Brassica rapa]
 emb|CDY22769.1| BnaA08g05990D [Brassica napus]
Length=735

 Score =   348 bits (893),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGPKRLFG GG+YR
Sbjct  540  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPKRLFGAGGMYR  599

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  600  NLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  659

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  660  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  719

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI+ +GCPVF
Sbjct  720  SCPTAPGIIAKGCPVF  735



>emb|CDY42539.1| BnaC08g10640D [Brassica napus]
Length=735

 Score =   348 bits (893),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGPKRLFG GG+YR
Sbjct  540  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPKRLFGAGGMYR  599

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  600  NLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  659

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  660  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  719

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI+ +GCPVF
Sbjct  720  SCPTAPGIIAKGCPVF  735



>ref|XP_004295330.1| PREDICTED: oligopeptide transporter 3 [Fragaria vesca subsp. 
vesca]
Length=736

 Score =   348 bits (892),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML  I+NICDTD L P+SPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  541  IVNLAVAWWMLEGIQNICDTDVLPPDSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  600

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GA+LPVP++VLSK+FP+KKWIPLIN+PVI YGFAGMPPATPTNI SW++TG 
Sbjct  601  NLVWLFLVGALLPVPIYVLSKIFPDKKWIPLINMPVILYGFAGMPPATPTNIASWLITGA  660

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYF+F+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN +  + WWGSELDHCPLA
Sbjct  661  IFNYFLFRYHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNNNILVHWWGSELDHCPLA  720

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  721  SCPTAPGITVKGCPVF  736



>ref|XP_010039444.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039445.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW45991.1| hypothetical protein EUGRSUZ_L00159 [Eucalyptus grandis]
Length=765

 Score =   348 bits (893),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWM+GSIENICD +AL P+SPWTCPKF VTFD SVIWGLIGP+RLF P GLYR
Sbjct  569  IVNLAVAWWMMGSIENICDVEALHPDSPWTCPKFAVTFDNSVIWGLIGPRRLFVPDGLYR  628

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NL+WLFL+GA+LP+P+W LSKMFPEKKWI LINIPV+S+GFAG+PPA+PTNI SW++TG+
Sbjct  629  NLIWLFLVGALLPLPIWALSKMFPEKKWIRLINIPVLSFGFAGVPPASPTNIASWLITGM  688

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
             FNYF+F+YRK WWQKYNYVLSAALDAGTAFM V LFFALQN++K LKWWG+E+DHCPLA
Sbjct  689  FFNYFMFRYRKRWWQKYNYVLSAALDAGTAFMGVFLFFALQNQNKSLKWWGTEIDHCPLA  748

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPT PG+VV+GCPVFK
Sbjct  749  TCPTEPGVVVQGCPVFK  765



>ref|XP_010039447.1| PREDICTED: oligopeptide transporter 3-like isoform X2 [Eucalyptus 
grandis]
Length=704

 Score =   347 bits (889),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWM+GSIENICD +AL P+SPWTCPKF VTFD SVIWGLIGP+RLF P GLYR
Sbjct  508  IVNLAVAWWMMGSIENICDVEALHPDSPWTCPKFAVTFDNSVIWGLIGPRRLFVPDGLYR  567

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NL+WLFL+GA+LP+P+W LSKMFPEKKWI LINIPV+S+GFAG+PPA+PTNI SW++TG+
Sbjct  568  NLIWLFLVGALLPLPIWALSKMFPEKKWIRLINIPVLSFGFAGVPPASPTNIASWLITGM  627

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
             FNYF+F+YRK WWQKYNYVLSAALDAGTAFM V LFFALQN++K LKWWG+E+DHCPLA
Sbjct  628  FFNYFMFRYRKRWWQKYNYVLSAALDAGTAFMGVFLFFALQNQNKSLKWWGTEIDHCPLA  687

Query  214  SCPTAPGIVVEGCPVFK  164
            +CPT PG+VV+GCPVFK
Sbjct  688  TCPTEPGVVVQGCPVFK  704



>ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 ref|XP_004162504.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 gb|KGN65011.1| hypothetical protein Csa_1G180750 [Cucumis sativus]
Length=745

 Score =   347 bits (891),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WWML SIENICD DAL   SPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  550  TINLAVAWWMLDSIENICDDDALHAESPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  609

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+W LSK FPEKKWI LINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  610  NLVWLFLIGAVLPVPIWALSKAFPEKKWIALINIPVISYGFAGMPPATPTNIASWLMTGT  669

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN    L+WWGS+ DHCPLA
Sbjct  670  VFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHNLRWWGSQPDHCPLA  729

Query  214  SCPTAPGIVVEGCPVF  167
             CPTAPGI V+GCPVF
Sbjct  730  KCPTAPGISVKGCPVF  745



>ref|XP_008345787.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=753

 Score =   347 bits (891),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI+NICD ++ +PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  558  VVNLAVAWWMLESIDNICDVESQNPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  617

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+G  LPVP+WV+SK+FP+KKWIPLIN+PVI YGFAGMPPATPTNI SW++TG 
Sbjct  618  NLVWLFLVGVFLPVPIWVMSKIFPDKKWIPLINMPVILYGFAGMPPATPTNIASWLITGG  677

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN   ELKWWG+ LDHCPLA
Sbjct  678  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPKHELKWWGTTLDHCPLA  737

Query  214  SCPTAPGIVVEGCPVF  167
            +CP APGI V+GCPVF
Sbjct  738  TCPIAPGIHVDGCPVF  753



>emb|CAD91127.1| glutathione transporter GT1 [Brassica juncea]
Length=661

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGPKRLFG GG+YR
Sbjct  466  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPKRLFGAGGMYR  525

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  526  NLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  585

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYN VLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  586  IFNYFVFNYHKRWWQKYNCVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  645

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI+ +GCPVF
Sbjct  646  SCPTAPGIIAKGCPVF  661



>gb|KEH32683.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=741

 Score =   346 bits (887),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL+V WWML SI++IC  D    +SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  546  VVNLSVAWWMLDSIKDICMDDKAHHDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  605

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWV SK++P KKWIPLINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  606  NLVWLFLVGAVLPVPVWVFSKIYPNKKWIPLINIPVISYGFAGMPPATPTNIASWLLTGM  665

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF++ K WWQKYNYVLSAALDAGTAFM VL+FFALQN    LKWWG+ELDHCPLA
Sbjct  666  IFNYFVFRFHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAGHTLKWWGTELDHCPLA  725

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGIVV+GCPVF
Sbjct  726  TCPTAPGIVVDGCPVF  741



>ref|XP_004507597.1| PREDICTED: oligopeptide transporter 3-like [Cicer arietinum]
Length=739

 Score =   345 bits (886),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWML SI++IC  D    +SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  544  VVNLAVAWWMLDSIKDICMDDKAHHDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  603

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GAVLPVPVWV SK++P+KKWI LINIPVISYGFAGMPPATPTNI SW++TG+
Sbjct  604  NLVWLFLVGAVLPVPVWVFSKIYPDKKWIALINIPVISYGFAGMPPATPTNIASWLLTGM  663

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF++ K WWQKYNYVLSAALDAGTAFM VL+FFALQN    LKWWG+ELDHCPLA
Sbjct  664  IFNYFVFRFHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAGHSLKWWGTELDHCPLA  723

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGIVV+GCPVF
Sbjct  724  TCPTAPGIVVDGCPVF  739



>ref|NP_567493.5| oligopeptide transporter [Arabidopsis thaliana]
 gb|AEE83738.1| oligopeptide transporter [Arabidopsis thaliana]
Length=737

 Score =   344 bits (883),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLV LFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVGLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  662  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  721

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  722  SCPTAPGIKAKGCPVF  737



>ref|XP_009374859.1| PREDICTED: oligopeptide transporter 3-like [Pyrus x bretschneideri]
Length=753

 Score =   344 bits (883),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML +IENICD ++ +PNSPWTCPK+RVTFDASVIWGLIGP+RLFGP GLYR
Sbjct  558  IVNLAVAWWMLENIENICDVESHNPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPRGLYR  617

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GA+LP P+  +SK+FP+KKWIPLIN+PVI+YGFAGMPPATPTNI SW++TG 
Sbjct  618  NLVWLFLVGALLPFPICAMSKIFPDKKWIPLINMPVITYGFAGMPPATPTNIASWLITGG  677

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN   ELKWWG+ELDHCPLA
Sbjct  678  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPKHELKWWGTELDHCPLA  737

Query  214  SCPTAPGIVVEGCPVF  167
            +CP APGI VEGCPVF
Sbjct  738  TCPIAPGIHVEGCPVF  753



>ref|XP_008349335.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=756

 Score =   342 bits (878),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML +IENICD ++ +PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGGLYR
Sbjct  561  IVNLAVAWWMLENIENICDVESRNPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGLYR  620

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NL+WLFL+GA+LP P+  +SK+FP+KKWIPLIN+PVI+YGFAGMPPATPTNI SW++TG 
Sbjct  621  NLMWLFLVGALLPFPICSMSKIFPDKKWIPLINMPVITYGFAGMPPATPTNIASWLITGG  680

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNY VFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN   ELKWWG+ELDHCPLA
Sbjct  681  IFNYXVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPKHELKWWGTELDHCPLA  740

Query  214  SCPTAPGIVVEGCPVF  167
            +CP APGI VEGCPVF
Sbjct  741  TCPIAPGIHVEGCPVF  756



>ref|XP_010039443.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
Length=697

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNLAV WWM+GSIENICD + L  +SPWTCPKF+V FD SVIWGLIGP+RLF P GLYRN
Sbjct  503  VNLAVAWWMIGSIENICDVEGLHRDSPWTCPKFKVAFDYSVIWGLIGPRRLFIPDGLYRN  562

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            LVWLFL+GA+LP+P+WVLSK+FPEKKWI  INIP++S+GFAG+PPA+PTNI SWI+TG+ 
Sbjct  563  LVWLFLVGALLPLPIWVLSKIFPEKKWIRHINIPLLSFGFAGIPPASPTNIASWIITGMF  622

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYF+ +YRK WWQKYNYVLSAALDAGTAFM V L+FALQN+  +LKWWG+++DHCPLA+
Sbjct  623  FNYFMLRYRKRWWQKYNYVLSAALDAGTAFMGVFLYFALQNQKTDLKWWGTQIDHCPLAT  682

Query  211  CPTAPGIVVEGCPVF  167
            CPT PG+VV+GCPVF
Sbjct  683  CPTEPGVVVKGCPVF  697



>ref|XP_010542186.1| PREDICTED: oligopeptide transporter 3 [Tarenaya hassleriana]
Length=727

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 174/196 (89%), Gaps = 5/196 (3%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   P+SPWTCPK+RVTFDASVIWGLIGPKRLFGPGG+YR
Sbjct  537  VVNLGVAWWMLESIQDICDIEGEHPDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGMYR  596

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVPVWVLSK+FP++KW+P     V+ +G +GMPPATPTNI SW+VTG+
Sbjct  597  NLVWLFLIGAVLPVPVWVLSKIFPDQKWMP-----VVHFGISGMPPATPTNIASWLVTGM  651

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQNE   LKWWG+++DHCPLA
Sbjct  652  IFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEGHNLKWWGTQVDHCPLA  711

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI V+GCPVF
Sbjct  712  SCPTAPGIKVKGCPVF  727



>gb|KCW45990.1| hypothetical protein EUGRSUZ_L00158 [Eucalyptus grandis]
Length=745

 Score =   332 bits (850),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWM+GSIENICD + L  +SPWTCPKF+V FD SVIWGLIGP+RLF P GLYR
Sbjct  550  TVNLAVAWWMIGSIENICDVEGLHRDSPWTCPKFKVAFDYSVIWGLIGPRRLFIPDGLYR  609

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL+GA+LP+P+WVLSK+FPEKKWI  INIP++S+GFAG+PPA+PTNI SWI+TG+
Sbjct  610  NLVWLFLVGALLPLPIWVLSKIFPEKKWIRHINIPLLSFGFAGIPPASPTNIASWIITGM  669

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
             FNYF+ +YRK WWQKYNYVLSAALDAGTAFM V L+FALQN+  +LKWWG+++DHCPLA
Sbjct  670  FFNYFMLRYRKRWWQKYNYVLSAALDAGTAFMGVFLYFALQNQKTDLKWWGTQIDHCPLA  729

Query  214  SCPTAPGIVVEGCPVF  167
            +CPT PG+VV+GCPVF
Sbjct  730  TCPTEPGVVVKGCPVF  745



>ref|XP_010436532.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=726

 Score =   323 bits (829),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 166/196 (85%), Gaps = 11/196 (6%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIWGLIGP+RLFGPGG+YR
Sbjct  542  VVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDASVIWGLIGPRRLFGPGGMYR  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAV           FP KKWIPLINIPVISYGFAGMPPATPTNI SW+VTG 
Sbjct  602  NLVWLFLIGAV-----------FPNKKWIPLINIPVISYGFAGMPPATPTNIASWLVTGT  650

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN   +LKWWG+E+DHCPLA
Sbjct  651  IFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAGHDLKWWGTEVDHCPLA  710

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI  +GCPVF
Sbjct  711  SCPTAPGIKAKGCPVF  726



>ref|XP_010939248.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=729

 Score =   320 bits (821),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VNLAV WWML +IENICDTD L  +SPWTCPK+RVTFDASVIWGLIGP RLF  GGLYR
Sbjct  534  IVNLAVAWWMLENIENICDTDVLPSDSPWTCPKYRVTFDASVIWGLIGPSRLFAHGGLYR  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+W+LSKM+P+KKWIPLINIPVISYGFAGMPPATPTNI SW++TG 
Sbjct  594  NLVWLFLIGAVLPVPIWLLSKMYPKKKWIPLINIPVISYGFAGMPPATPTNIASWLITGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF++RK WW+KYNYVLSAALDAGTAFM VLLF ALQN+  ++ WWG+E+DHCPLA
Sbjct  654  VFNFFVFRFRKEWWRKYNYVLSAALDAGTAFMGVLLFLALQNQDIDVHWWGTEVDHCPLA  713

Query  214  SCPTAPGIVVEGCPVF  167
            SCPT PGI V+GCPVF
Sbjct  714  SCPTEPGIAVKGCPVF  729



>emb|CDP04527.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 160/197 (81%), Gaps = 12/197 (6%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            + NL + WWML SI NICD +AL P+SPWTCPKFRV FD +V+WGLIGP+RLFGP GLYR
Sbjct  494  LANLGMGWWMLESIPNICDVEALHPDSPWTCPKFRVMFDTTVVWGLIGPERLFGPHGLYR  553

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            N++WLF +GA+LP+PVW+LS+ FP+KKWI LINIP+I+ GF G+PPA PTNI SWI    
Sbjct  554  NMIWLFPLGALLPIPVWILSRKFPDKKWISLINIPLITCGFTGIPPAAPTNIASWI----  609

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
                    YRKGWWQKYNYVLS+ALDAGTAFM VLLFFALQN  K LKWWG+E DHCPLA
Sbjct  610  --------YRKGWWQKYNYVLSSALDAGTAFMGVLLFFALQNSGKNLKWWGTEPDHCPLA  661

Query  214  SCPTAPGIVVEGCPVFK  164
            SCPTAPGI V GCPV K
Sbjct  662  SCPTAPGITVAGCPVVK  678



>gb|AAO72613.1| Isp-4-like protein [Oryza sativa Japonica Group]
Length=446

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIWGLIGP RLFG  GLYR
Sbjct  288  VVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPARLFGRHGLYR  347

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGMPPATPTNI SW+VTG 
Sbjct  348  NLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGMPPATPTNIASWLVTGT  407

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFA  278
            IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFA
Sbjct  408  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFA  446



>ref|XP_010087657.1| Oligopeptide transporter 3 [Morus notabilis]
 gb|EXB29550.1| Oligopeptide transporter 3 [Morus notabilis]
Length=724

 Score =   295 bits (755),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 160/196 (82%), Gaps = 16/196 (8%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WWML SI++ICD + L P+SPWTCPK+RVTFDASVIWGLIGPKRLFGPGGLYR
Sbjct  545  TVNLAVAWWMLESIDDICDVEGLHPDSPWTCPKYRVTFDASVIWGLIGPKRLFGPGGLYR  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            NLVWLFLIGAVLPVP+W+LSKM          N+   S+  +        NI SW++TG 
Sbjct  605  NLVWLFLIGAVLPVPIWLLSKM----------NVSRNSHQHSEF------NIASWLITGT  648

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+Y K WWQKYNYVLSAALDAGTAFMAVLLFFALQNE+K LKWWG+ LDHCPLA
Sbjct  649  IFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMAVLLFFALQNENKNLKWWGTSLDHCPLA  708

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI V+GCPVF
Sbjct  709  TCPTAPGIKVDGCPVF  724



>gb|KDP35952.1| hypothetical protein JCGZ_09924 [Jatropha curcas]
Length=254

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y+
Sbjct  59   TINLAVAWWLLNSIHNICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYQ  118

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P  VWVL K FP++ WIPLIN+PV+      MPPAT  N  SWI+ G 
Sbjct  119  AMNWFFLGGAVGPFIVWVLHKSFPKQSWIPLINLPVLLGSTGNMPPATAVNYNSWIIVGT  178

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++  E++ L WWG+E +HC LA
Sbjct  179  IFNFFVFRYRKHWWQRYNYILSAALDAGVAFMAVLLYFSVGMENRSLNWWGTEGEHCDLA  238

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GIVV+GCPV
Sbjct  239  TCPTAKGIVVDGCPV  253



>gb|ABK94821.1| unknown [Populus trichocarpa]
Length=436

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 151/196 (77%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y+
Sbjct  238  TINLAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGNYQ  297

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  298  AMNWFFLGGALGPVIVWLLHKSFPKQSWIPLINLPVLLGATAMMPPATPVNYNAWIIVGT  357

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++  E + L WWG+  +HC LA
Sbjct  358  IFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVGIEDRTLNWWGTNGEHCELA  417

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GI+V+GCP F
Sbjct  418  TCPTAKGIMVDGCPDF  433



>ref|XP_010919977.1| PREDICTED: oligopeptide transporter 4-like [Elaeis guineensis]
Length=356

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 146/196 (74%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+LGSI+NICD   LSPNSPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  161  TINLGVAWWLLGSIKNICDDQLLSPNSPWTCPSDRVFFDASVIWGLVGPRRIFGPLGNYG  220

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ P+ VW   K FP + WIPLIN+PV+    A MPPAT  N  SWIV G 
Sbjct  221  ALNWFFLGGALGPIIVWTFHKFFPAQTWIPLINLPVLLGATASMPPATAVNYNSWIVVGT  280

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FV++YRK WW++YNY+LSAALDAG AFM V L+F L  E+  L WWG+  +HC LA
Sbjct  281  VFNFFVYRYRKKWWERYNYILSAALDAGVAFMGVFLYFTLNLENVTLDWWGTAGEHCELA  340

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA G+ V+GCPVF
Sbjct  341  TCPTAKGVQVDGCPVF  356



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L SIENIC  D L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  543  TINLGVAWWLLDSIENICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGNYG  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ PV VW+L K FP++ WIPLIN+PV+    A MPPAT  N  +WI+ G 
Sbjct  603  ALNWFFLGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATAMMPPATALNYNAWIIVGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFM VL++F+L  E+++L WWG++ +HCPLA
Sbjct  663  IFNFFVFRYRKQWWQRYNYILSAALDAGVAFMGVLIYFSLTMENRDLNWWGTDGEHCPLA  722

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA G+VVEGCP +
Sbjct  723  TCPTAKGVVVEGCPAY  738



>ref|XP_009398499.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 149/196 (76%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+LGSIENIC    L PNSPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  543  TINLGVAWWLLGSIENICHPGLLPPNSPWTCPSDRVFFDASVIWGLVGPRRIFGPKGNYG  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            +L W FL+GA+ P+ VW+  K FP + WIPLIN+PV+      MPPATP N  +WI  G 
Sbjct  603  SLNWFFLVGALGPIIVWLFHKAFPRQSWIPLINLPVLLGATGMMPPATPLNFSAWIAVGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
             FN+FVF+YRK WW++YNY+LSAALDAG AFM VLL+FAL  E+K + WWG+E +HCPLA
Sbjct  663  AFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFALSMENKSITWWGAEGEHCPLA  722

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTA G+ V+GCP F
Sbjct  723  SCPTAKGVQVDGCPQF  738



>gb|KJB58811.1| hypothetical protein B456_009G227200 [Gossypium raimondii]
Length=741

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNLAV WW+L ++ENIC    L PNSPWTCP  RV FDASVIWGL+GPKR+FGP G Y  
Sbjct  547  VNLAVAWWLLTTVENICQDHLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGPLGNYSA  606

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GAV PV VW+  K FP +KWIPLIN+PV+    A MPPAT  N   W++ G I
Sbjct  607  LNWFFLGGAVGPVVVWLFHKAFPNQKWIPLINLPVLLGATAAMPPATSLNFNCWLIIGFI  666

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L      + WWGS+ +HC LAS
Sbjct  667  FNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLTMHGISISWWGSDGEHCDLAS  726

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCPVF
Sbjct  727  CPTAKGIVVDGCPVF  741



>gb|KDO67987.1| hypothetical protein CISIN_1g020208mg [Citrus sinensis]
Length=329

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  134  TINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYP  193

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ PV VW+L K FP++ WIPLIN+PV+      MPPAT  N  SWI+ G 
Sbjct  194  AMNWFFVGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATAVNYNSWIIVGT  253

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E K L WWG+E +HC LA
Sbjct  254  IFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMEDKGLSWWGTEGEHCDLA  313

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+V+GCPV
Sbjct  314  TCPTAKGILVDGCPV  328



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 148/196 (76%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VN+   WW+LGSIENICD   L PNSPWTCP  RV FDASVIWGLIGPKR+FG  G Y+
Sbjct  548  IVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWGLIGPKRMFGSHGEYK  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ PV VW+ S+ FP  KWIPLIN+PVI    A MPPAT  N  SW + G+
Sbjct  608  ELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMPPATSVNYISWSIVGI  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYF+F+Y KGWWQ+YNYV SAA+DAG AFM VLL+  L  E++ L WWG+ +D+CPLA
Sbjct  668  IFNYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENRSLSWWGNNVDNCPLA  727

Query  214  SCPTAPGIVVEGCPVF  167
             CPTA GIV+ GCPV+
Sbjct  728  DCPTAKGIVIAGCPVY  743



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+ V WW+L SIENIC    L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y+
Sbjct  539  TVNIGVAWWLLSSIENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYK  598

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA+ P+ VW+L K FP +KWI LIN+PV+    A MPPAT  N   WIV G 
Sbjct  599  ALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGATAAMPPATTVNFNCWIVVGT  658

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    K + WWG+  +HC LA
Sbjct  659  IFNYFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNEKSISWWGTNGEHCDLA  718

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GIVV+GCPV+
Sbjct  719  TCPTAKGIVVDGCPVY  734



>ref|XP_006351838.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=738

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N++V WW+L SIENIC  D L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  543  TINISVAWWLLNSIENICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGNYS  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GA+ PV VW+L KMFP + WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  603  SMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGATGAMPPATPLNYNAWVIVGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+K + WWG+  +HC LA
Sbjct  663  IFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGVTWWGTNGEHCKLA  722

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI V+GCP 
Sbjct  723  TCPTAKGIAVDGCPT  737



>ref|XP_006472993.1| PREDICTED: oligopeptide transporter 2-like [Citrus sinensis]
Length=742

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V WW+L ++ENIC    L PNSPWTCP  RV +DASVIWGLIGPKR+FG  G+Y  
Sbjct  548  VNLGVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIWGLIGPKRIFGRMGIYSA  607

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL+G + P  VW+L K FP+ KWI LIN+PV+    A MPPAT  N   WIV G I
Sbjct  608  LNWFFLLGTLGPFVVWLLQKAFPKHKWITLINLPVLLGATAQMPPATTVNFNCWIVVGTI  667

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYF+FKYRKGWWQ+YNYV+SAALDAG AFM VLL+F L  E++ + WWGS  +HC LAS
Sbjct  668  FNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENRSINWWGSAGEHCDLAS  727

Query  211  CPTAPGIVVEGCPVF  167
            CPT  G+VVEGCPV+
Sbjct  728  CPTTKGVVVEGCPVY  742



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 148/196 (76%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VN+   WW+LGSIENICD   L PNSPWTCP  RV FDASVIWGLIGPKR+FG  G Y+
Sbjct  548  IVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWGLIGPKRMFGSHGEYK  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ PV VW+ S+ FP  KWIPLIN+PVI    A MPPAT  N  SW + G+
Sbjct  608  ELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMPPATSVNYISWSIVGI  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IF+YF+F+Y KGWWQ+YNYV SAA+DAG AFM VLL+  L  E++ L WWG+ +D+CPLA
Sbjct  668  IFSYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENRSLSWWGNNVDNCPLA  727

Query  214  SCPTAPGIVVEGCPVF  167
             CPTA GIV+ GCPV+
Sbjct  728  DCPTAKGIVIAGCPVY  743



>gb|KJB32168.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=528

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  334  INIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYPA  393

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G I
Sbjct  394  MNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWILVGTI  453

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E++ + WWG+E +HC LA+
Sbjct  454  FNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMENRSVTWWGTEGEHCKLAT  513

Query  211  CPTAPGIVVEGCPV  170
            CPTA GI+V+GCPV
Sbjct  514  CPTAKGIMVDGCPV  527



>ref|XP_006433764.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
 gb|ESR47004.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
Length=742

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V WW+L ++ENIC    L PNSPWTCP  RV +DASVIWGLIGPKR+FG  G+Y  
Sbjct  548  VNLGVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIWGLIGPKRIFGRMGIYSA  607

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL+G + P  VW+L K FP+ KWI LIN+PV+    A MPPAT  N   WIV G I
Sbjct  608  LNWFFLLGTLGPFVVWLLHKAFPKHKWITLINLPVLLGATAQMPPATTVNFNCWIVVGTI  667

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYF+FKYRKGWWQ+YNYV+SAALDAG AFM VLL+F L  E++ + WWGS  +HC LAS
Sbjct  668  FNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENRSIDWWGSAGEHCDLAS  727

Query  211  CPTAPGIVVEGCPVF  167
            CPT  G+VVEGCPV+
Sbjct  728  CPTTKGVVVEGCPVY  742



>gb|KEH36459.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=552

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L S+ENIC  D L   SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  357  TINIGVAWWLLNSVENICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSKGNYS  416

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ P+ VW+L K FP + WI LIN+PV+    A MPPATP N  SWI  G 
Sbjct  417  AMNWFFIGGAIGPIIVWLLHKAFPRQSWIALINLPVLLGATAMMPPATPLNYNSWIFVGT  476

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L  E++ + WWG+E +HCPLA
Sbjct  477  IFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLSLENRSISWWGTEGEHCPLA  536

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA GI V+GCPV
Sbjct  537  SCPTAKGIAVDGCPV  551



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =   266 bits (679),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N++V WW+L SIENIC  D L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  543  TINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYS  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GAV PV VW+L K+FP K WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  603  SMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGATGAMPPATPLNYNAWVIVGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+K L WWG+  +HC LA
Sbjct  663  IFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGLTWWGTNGEHCELA  722

Query  214  SCPTAPGIVVEGCP  173
            +CPTA GI V+GCP
Sbjct  723  TCPTAKGIAVDGCP  736



>ref|XP_009612437.1| PREDICTED: oligopeptide transporter 4 [Nicotiana tomentosiformis]
Length=737

 Score =   266 bits (679),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N++V WW+L SIENIC  D L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  542  TINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYS  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GAV PV VW+L K+FP K WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  602  SMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGATGAMPPATPLNYNAWVIVGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+K L WWG+  +HC LA
Sbjct  662  IFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGLTWWGTNGEHCELA  721

Query  214  SCPTAPGIVVEGCP  173
            +CPTA GI V+GCP
Sbjct  722  TCPTAKGIAVDGCP  735



>ref|XP_007018304.1| Oligopeptide transporter 2 [Theobroma cacao]
 gb|EOY15529.1| Oligopeptide transporter 2 [Theobroma cacao]
Length=738

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +NLAV WW+L ++ENIC    L PNSPWTCP  RV +DASVIWGL+GPKR+FGP G Y  
Sbjct  544  INLAVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIWGLVGPKRIFGPLGNYAA  603

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GA+ PV VW+  K FP +KWI LIN+PV+    A MPPAT  N   WI+ G+I
Sbjct  604  LNWFFLGGALGPVVVWLFHKAFPNQKWISLINLPVLLGATAAMPPATSLNFNCWIIVGVI  663

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L  +   + WWG+E +HC LAS
Sbjct  664  FNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLTMQGISISWWGAEGEHCDLAS  723

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCPV+
Sbjct  724  CPTAKGIVVDGCPVY  738



>ref|XP_004231372.1| PREDICTED: oligopeptide transporter 4 [Solanum lycopersicum]
Length=735

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N++V WW+L SIENIC  D L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  540  TINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGNYS  599

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GA+ PV VW+L KMFP + WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  600  SMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGATGAMPPATPLNYNAWVIVGT  659

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+K + WWG+  +HC LA
Sbjct  660  IFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMENKGVTWWGTNGEHCKLA  719

Query  214  SCPTAPGIVVEGCP  173
            +CPTA GI V+GCP
Sbjct  720  TCPTAKGIAVDGCP  733



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 151/196 (77%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y+
Sbjct  554  TINLAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGNYQ  613

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  614  AMNWFFLGGALGPVIVWLLHKSFPKQSWIPLINLPVLLGATAMMPPATPVNYNAWIIVGT  673

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++  E + L WWG+  +HC LA
Sbjct  674  IFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVGIEDRTLNWWGTNGEHCELA  733

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GI+V+GCP F
Sbjct  734  TCPTAKGIMVDGCPDF  749



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 ref|XP_004164895.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+AV WW+L SIENIC    L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  547  TVNMAVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYA  606

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W F+ GA+ P+ VW+L K FP+ KWI LIN+PV+    A MPPAT  N   WI+ G 
Sbjct  607  ALNWFFIGGAIGPILVWLLQKTFPKHKWISLINLPVLLGSTAIMPPATAVNFNCWIIVGT  666

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F L  E K L WWGS+ +HC LA
Sbjct  667  IFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLTMEDKGLTWWGSDGEHCELA  726

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GIVV+GCPVF
Sbjct  727  NCPTAKGIVVDGCPVF  742



>emb|CDO97359.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N++V WW+L SI+NIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  182  INVSVAWWLLHSIKNICQDDLLPQDSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGNYTE  241

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            + W FL GA+ P+ VW+  K FP++ WIPLIN+PV+      MPPATP N  +WI+ G I
Sbjct  242  MNWFFLGGALGPIIVWLFHKAFPKQSWIPLINLPVLLGATGAMPPATPLNYNAWIIVGTI  301

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F +  E++E+ WWG++ + C LA+
Sbjct  302  FNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFTVGMENREVTWWGTKGEQCDLAT  361

Query  211  CPTAPGIVVEGCPV  170
            CPTA GI V+GCPV
Sbjct  362  CPTAKGITVDGCPV  375



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y+
Sbjct  554  TINLAVAWWLLNSIENICQDDLLPVNSPWTCPGDRVFFDASVIWGLVGPKRIFGTLGNYQ  613

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV +W+L K FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  614  AMNWFFLGGALGPVIIWLLHKSFPKQSWIPLINLPVLLGATAMMPPATPVNYNAWIIVGT  673

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++  E + L WWG+  +HC LA
Sbjct  674  IFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVGIEDRSLNWWGTNGEHCELA  733

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+V+GCPV
Sbjct  734  TCPTAKGIMVDGCPV  748



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 146/196 (74%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+ V W +L SIENIC    L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y+
Sbjct  538  TVNIXVAWXLLSSIENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYK  597

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA+ P+ VW+L K FP +KWI LIN+PV+    A MPPAT  N   WIV G 
Sbjct  598  ALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGATAAMPPATTVNFNCWIVVGT  657

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFNYFVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    K + WWG+  +HC LA
Sbjct  658  IFNYFVFRYRKQWWQRYNYVLSAALDAGVAFMGVLLYFSLTTYEKSISWWGTNGEHCDLA  717

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GIVV+GCPV+
Sbjct  718  TCPTAKGIVVDGCPVY  733



>ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis]
Length=754

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 147/194 (76%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDASVIWGL+GP+R+FG  G Y+
Sbjct  559  TINLAVAWWLLNSITNICQDDLLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGSLGNYQ  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P+ VW+L K FP K WIPLIN+PV+      MPPAT  N  SWI+ G 
Sbjct  619  AMNWFFLGGAVGPIIVWLLHKSFPRKSWIPLINLPVLLGSTGMMPPATAVNYNSWIIVGT  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E++ L WWG++ +HC LA
Sbjct  679  IFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGIENRSLTWWGTDGEHCDLA  738

Query  214  SCPTAPGIVVEGCP  173
            SCPTA GI V GCP
Sbjct  739  SCPTAKGIDVAGCP  752



>ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis]
Length=746

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIWGL+GP+R+FG  G YR
Sbjct  551  TINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPRRIFGTLGNYR  610

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MPPATP N  +W++ G+
Sbjct  611  QMNWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWVLAGV  670

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALDAGTAFMAVLL+F++  E++ + WWG+  +HC LA
Sbjct  671  IFNFFIFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVGMENRSITWWGTNGEHCELA  730

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI V+GCPV
Sbjct  731  ACPTAKGIEVDGCPV  745



>ref|XP_008219191.1| PREDICTED: oligopeptide transporter 2-like [Prunus mume]
Length=729

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN+ V WW+L +IENIC    L PNSPWTCP  RV FDASVIWGL+GP+R+FG  G Y+ 
Sbjct  535  VNVGVAWWLLSTIENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGSLGNYKA  594

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FLIGA+ P+ VW+L K FP KKWI LIN+PV+    A MPPAT  N   WIV G I
Sbjct  595  LNWFFLIGALGPLLVWLLHKAFPSKKWIKLINLPVLLGATAVMPPATTVNFNCWIVVGAI  654

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    K + WWG+  +HC LA+
Sbjct  655  FNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNEKSISWWGTNGEHCELAT  714

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCPV+
Sbjct  715  CPTAKGIVVDGCPVY  729



>ref|XP_010933427.1| PREDICTED: oligopeptide transporter 4-like [Elaeis guineensis]
Length=764

 Score =   264 bits (675),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 149/196 (76%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+LGSIENIC +D L  NSPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  569  TINLAVAWWLLGSIENICQSDLLPENSPWTCPGDRVFFDASVIWGLVGPRRIFGPLGNYG  628

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL+GA+ P+ VW+  ++FP + WIPLIN+PV+    A MPPAT  N  +W+  G 
Sbjct  629  ALNWFFLVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGATANMPPATAVNYTAWVTVGT  688

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRK WW++YNY+LSAALDAG AFM V L+FAL  E+  + WWG+  +HC LA
Sbjct  689  VFNFFVFRYRKRWWERYNYILSAALDAGVAFMGVFLYFALNMENTSINWWGTGGEHCDLA  748

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA G+ V+GCPVF
Sbjct  749  TCPTAKGVQVDGCPVF  764



>ref|XP_004485624.1| PREDICTED: oligopeptide transporter 4-like [Cicer arietinum]
Length=740

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L SIENIC  D L P SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  545  TINIGVAWWLLNSIENICHDDLLPPGSPWTCPGDRVFFDASVIWGLVGPKRIFGSKGNYS  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+  + FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  605  AMNWFFLGGAIGPIIVWLFHRAFPKQSWIPLINLPVLLGATAMMPPATPLNYNAWILVGT  664

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L  E++ + WWG++ +HCPLA
Sbjct  665  IFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLGLENRSISWWGNDGEHCPLA  724

Query  214  SCPTAPGIVVEGCP  173
            SCPTA GIVV+GCP
Sbjct  725  SCPTAEGIVVDGCP  738



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 146/196 (74%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+AV WW+L SIENIC    L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  546  TVNMAVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYA  605

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W F+ GA+ P+ VW+L K FP  KWI LIN+PV+    A MPPAT  N   WI+ G 
Sbjct  606  ALNWFFVGGAIGPLLVWLLQKAFPNHKWISLINLPVLLGSTAIMPPATAVNFNCWIIVGT  665

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F L  E K L WWGS+ +HC LA
Sbjct  666  IFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLTMEDKGLTWWGSDGEHCDLA  725

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GIVV+GCPVF
Sbjct  726  NCPTAKGIVVDGCPVF  741



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =   263 bits (673),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 150/196 (77%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+AV WW+L SI NIC  D L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  549  TVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYS  608

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GA+ PV VW+  K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  609  SMNWFFLGGALGPVLVWLFHKAFPKQSWIPLINLPVLLGATGIMPPATPLNYNAWIIIGT  668

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAV L+F+L  E+KE+ WWG+  +HC LA
Sbjct  669  IFNFFVFRYRKSWWQRYNYILSAALDAGVAFMAVALYFSLGMENKEIHWWGTSGEHCKLA  728

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GI V+GCPV+
Sbjct  729  TCPTAKGIQVDGCPVY  744



>gb|EYU18387.1| hypothetical protein MIMGU_mgv1a0036351mg, partial [Erythranthe 
guttata]
Length=569

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+AV WW+L SI NIC  D L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  374  TVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYS  433

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GA+ PV VW L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  434  SMNWFFLGGAIGPVLVWFLHKAFPKQSWIPLINLPVLLGATGAMPPATPLNYNAWIIIGT  493

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAV L+F L  E K + WWG+  +HC LA
Sbjct  494  IFNFFVFRYRKIWWQRYNYILSAALDAGVAFMAVGLYFTLGMEEKGIDWWGTSGEHCKLA  553

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GI V+GCP++
Sbjct  554  TCPTAKGIRVDGCPIY  569



>ref|XP_007225210.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
 gb|EMJ26409.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
Length=729

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V WW+L +IENIC    L PNSPWTCP  RV FDASVIWGL+GP+R+FG  G Y+ 
Sbjct  535  VNLGVAWWLLSTIENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGSLGNYKA  594

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FLIGA  P+ VW+L K FP KKWI LIN+PV+    A MPPAT  N   WIV G I
Sbjct  595  LNWFFLIGASGPLLVWLLHKAFPSKKWIKLINLPVLLGATAVMPPATTVNFNCWIVVGAI  654

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    K + WWG+  +HC LA+
Sbjct  655  FNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNEKSISWWGTNGEHCELAT  714

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCP++
Sbjct  715  CPTAKGIVVDGCPLY  729



>ref|XP_007042780.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOX98611.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=941

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G YR
Sbjct  746  TINLAVAWWLLNSIENICHDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYR  805

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GAV PV VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  806  AMNWFFVGGAVGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIIVGT  865

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E++ L WWG+  +HC LA
Sbjct  866  IFNFFIFRYRKHWWQRYNYILSAALDAGVAFMAILLYFSVGMENRSLTWWGTGGEHCELA  925

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI VEGCPV
Sbjct  926  TCPTAKGIAVEGCPV  940



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L SIENIC  D L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  558  TINIAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYP  617

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  618  AMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWILVGT  677

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E++ + WWG+E +HC LA
Sbjct  678  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMENRSVTWWGTEGEHCELA  737

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+V+GCPV
Sbjct  738  TCPTAKGIMVDGCPV  752



>gb|AES90550.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=718

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 148/196 (76%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L S++NIC+ D L   SPWTCP  RV FDASV+WGL+GPKR+FG  G Y 
Sbjct  523  TINIGVAWWLLDSVKNICNKDLLPKGSPWTCPSDRVFFDASVVWGLVGPKRIFGSLGEYS  582

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MPPAT  N  SWI+ G 
Sbjct  583  TLNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATALNYNSWIIVGT  642

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+ AL  E+  L WWG+  +HCPLA
Sbjct  643  IFNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYLALGLENVSLNWWGTAGEHCPLA  702

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GIVV+GCPVF
Sbjct  703  ACPTAKGIVVDGCPVF  718



>ref|XP_010030910.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56910.1| hypothetical protein EUGRSUZ_I02586 [Eucalyptus grandis]
Length=742

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+AV WW+L S+ NIC  D L  +SPWTCP  RV FDASVIWGL GP+R+FG  G YR
Sbjct  547  TVNIAVAWWLLNSVTNICQDDLLPLDSPWTCPSDRVFFDASVIWGLAGPRRIFGALGDYR  606

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    A MPPATP N  +W++ G 
Sbjct  607  EINWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATAMMPPATPLNYNAWVLVGT  666

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALDAGTAFMAVLL+FA+  E+K + WWG+  +HC LA
Sbjct  667  IFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFAVGMENKSITWWGTNGEHCELA  726

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI V+GCP+
Sbjct  727  ACPTAKGIEVDGCPI  741



>ref|XP_008800083.1| PREDICTED: oligopeptide transporter 4-like [Phoenix dactylifera]
Length=748

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +NLAV WW+LGS+ENIC+   L  NSPWTCP  RV FDASVIWGL+GP+R+FGP G Y  
Sbjct  554  INLAVAWWLLGSVENICNDQLLPANSPWTCPGDRVFFDASVIWGLVGPRRIFGPLGNYGA  613

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W F+ GA+ P+ VW+  K+FP + WIPLIN+PV+    A MPPAT  N  SWIV G +
Sbjct  614  LNWFFVGGALGPIIVWIFHKIFPGQTWIPLINLPVLLGATAAMPPATSVNYNSWIVVGTV  673

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FV++YRK WW++YNY+LSAALDAG AFM V+L+FAL  E+  + WWG+  +HCPLA+
Sbjct  674  FNFFVYRYRKKWWERYNYILSAALDAGVAFMGVVLYFALSLENVSIDWWGTAGEHCPLAT  733

Query  211  CPTAPGIVVEGCPVF  167
            CPTA G+ V+GCPVF
Sbjct  734  CPTARGVQVDGCPVF  748



>ref|XP_003593303.1| Oligopeptide transporter [Medicago truncatula]
 gb|ABN05713.1| Peptidase aspartic, active site; Oligopeptide transporter OPT 
superfamily [Medicago truncatula]
 gb|AES63554.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=729

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L S+ENIC  D L   SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINIGVAWWLLNSVENICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSKGNYS  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ P+ VW+L K FP + WI LIN+PV+    A MPPATP N  SWI  G 
Sbjct  594  AMNWFFIGGAIGPIIVWLLHKAFPRQSWIALINLPVLLGATAMMPPATPLNYNSWIFVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L  E++ + WWG+E +HCPLA
Sbjct  654  IFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLSLENRSISWWGTEGEHCPLA  713

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA GI V+GCPV
Sbjct  714  SCPTAKGIAVDGCPV  728



>ref|XP_006486776.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=736

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  541  TINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYP  600

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ PV VW+L K FP++ WIPLIN+PV+      MPPAT  N  SWI+ G 
Sbjct  601  AMNWFFVGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATAVNYNSWIIVGT  660

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E K L WWG+E +HC LA
Sbjct  661  IFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMEDKGLSWWGTEGEHCDLA  720

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+V+GCPV
Sbjct  721  TCPTAKGILVDGCPV  735



>ref|XP_003608353.1| Oligopeptide transporter [Medicago truncatula]
Length=739

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N+ V WW+L S++NIC+ D L   SPWTCP  RV FDASV+WGL+GPKR+FG  G Y  
Sbjct  545  INIGVAWWLLDSVKNICNKDLLPKGSPWTCPSDRVFFDASVVWGLVGPKRIFGSLGEYST  604

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MPPAT  N  SWI+ G I
Sbjct  605  LNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATALNYNSWIIVGTI  664

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+ AL  E+  L WWG+  +HCPLA+
Sbjct  665  FNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYLALGLENVSLNWWGTAGEHCPLAA  724

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCPVF
Sbjct  725  CPTAKGIVVDGCPVF  739



>gb|KJB58808.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 147/200 (74%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+L ++ENIC  D L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G+Y 
Sbjct  555  TVNLGVAWWLLTTVENICHRDLLPANSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGVYS  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            +L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPATP N  SWI+ G 
Sbjct  615  SLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNMPPATPLNYTSWILIGT  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFM VLL+FAL  E+K L WWG+  D    H
Sbjct  675  IFNFFVFRYRKRWWQRYNYILSAALDAGVAFMTVLLYFALGIENKSLNWWGASPDFFPEH  734

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LASCPTA GI  EGCP+F
Sbjct  735  CDLASCPTAKGISAEGCPIF  754



>emb|CBI35438.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y +
Sbjct  499  INIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYPS  558

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            + W FL GA+ PV VWV  K FP++ WIPLIN+PV+    + MPPAT  N  SWI+ G I
Sbjct  559  MNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGATSMMPPATSLNYNSWILVGTI  618

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L  E K L WWG++ +HC LA+
Sbjct  619  FNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLGIEEKGLTWWGTDGEHCKLAT  678

Query  211  CPTAPGIVVEGCPV  170
            CPTA GIVV+GCPV
Sbjct  679  CPTAKGIVVDGCPV  692



>gb|KJB32170.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=754

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  559  TINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYP  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  619  AMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWILVGT  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E++ + WWG+E +HC LA
Sbjct  679  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMENRSVTWWGTEGEHCKLA  738

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+V+GCPV
Sbjct  739  TCPTAKGIMVDGCPV  753



>gb|KJB58809.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=482

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDASVIWGL+GPKR+FG  G Y 
Sbjct  283  TINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDASVIWGLVGPKRIFGSLGEYS  342

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPATP N  SWI+ G 
Sbjct  343  TLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNMPPATPLNYTSWIIVGT  402

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL  E K L WWG+  D    H
Sbjct  403  IFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALGVESKSLHWWGASPDVVPEH  462

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LA+CPTA GI+VEGCP+F
Sbjct  463  CDLATCPTAKGILVEGCPIF  482



>ref|XP_007159179.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
 gb|ESW31173.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
Length=738

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N  V WW+L S+ NIC  D L  +SPWTCP   V FDASVIWGL+GP+R+FG  G Y+ 
Sbjct  544  INTGVAWWLLNSVHNICHRDLLPEDSPWTCPSDHVFFDASVIWGLVGPRRIFGSHGNYQA  603

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MPPAT  N  +WI+ G I
Sbjct  604  LNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATALNYNAWIIIGTI  663

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+K + WWG++ +HCPLA+
Sbjct  664  FNFFVFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYFAVGLENKSISWWGNDGEHCPLAT  723

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCPV+
Sbjct  724  CPTAKGIVVDGCPVY  738



>ref|XP_010104576.1| Oligopeptide transporter 2 [Morus notabilis]
 gb|EXC01177.1| Oligopeptide transporter 2 [Morus notabilis]
Length=724

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN+ V WW+L ++ENIC    L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  530  VNIGVAWWLLHTVENICQDQLLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSEGNYSQ  589

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FLIG + P+ VW+L K FP +KWI  +N+PV+    A MPPAT  N   WI+ G +
Sbjct  590  LNWFFLIGVMGPLLVWLLHKAFPSQKWIKFVNLPVLFGATAVMPPATTVNFNCWIIVGTV  649

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQKYNYVLSAALDAG AFM V+L+F L  E + L WWG++ +HC LA+
Sbjct  650  FNFFVFRYRKQWWQKYNYVLSAALDAGLAFMGVVLYFTLTMEDRSLSWWGADGEHCELAT  709

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCPVF
Sbjct  710  CPTAKGIVVDGCPVF  724



>ref|XP_010030911.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=739

 Score =   261 bits (668),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIWGL+GP+R+FG  G Y+
Sbjct  544  TINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPRRIFGTLGNYQ  603

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  604  AMNWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWVLVGT  663

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALDAGTAFMAVLL+F++  E+K + WWG+  +HC LA
Sbjct  664  IFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVGMENKSITWWGTNGEHCELA  723

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI V+GCP+
Sbjct  724  ACPTAKGIEVDGCPI  738



>emb|CAN61122.1| hypothetical protein VITISV_038682 [Vitis vinifera]
Length=583

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  388  TINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYP  447

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    + MPPAT  N  SWI+ G 
Sbjct  448  SMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGATSMMPPATSLNYNSWILVGT  507

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L  E K L WWG+  +HC LA
Sbjct  508  IFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLGIEEKGLTWWGTXGEHCKLA  567

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GIVV GCPV
Sbjct  568  TCPTAKGIVVXGCPV  582



>gb|KJB32169.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=753

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  558  TINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYP  617

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  618  AMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWILVGT  677

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E++ + WWG+E +HC LA
Sbjct  678  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMENRSVTWWGTEGEHCKLA  737

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+V+GCPV
Sbjct  738  TCPTAKGIMVDGCPV  752



>ref|XP_010112260.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC33016.1| Oligopeptide transporter 4 [Morus notabilis]
Length=742

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L ++ENIC  + L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  547  TINLAVAWWLLTTVENICQDNLLPTNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  606

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV PV +W+L K FP++ WIPLIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  607  AMNWFFLGGAVGPVIIWLLHKAFPKQTWIPLINLPVLLGATAMMPPATSLNFNSWIIVGT  666

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++  E K L WWG++ +HC LA
Sbjct  667  IFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSVGLEDKSLTWWGTDGEHCELA  726

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+ +GCP+
Sbjct  727  TCPTAKGIIKDGCPL  741



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  549  TINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYP  608

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    + MPPAT  N  SWI+ G 
Sbjct  609  SMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGATSMMPPATSLNYNSWILVGT  668

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L  E K L WWG++ +HC LA
Sbjct  669  IFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLGIEEKGLTWWGTDGEHCKLA  728

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GIVV+GCPV
Sbjct  729  TCPTAKGIVVDGCPV  743



>ref|XP_003528403.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=746

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N+ V WW+L SI NIC  D L   SPWTCP  RV FDASVIWGL+GP R+FG  G Y+ 
Sbjct  552  INICVAWWLLNSINNICHKDLLPEGSPWTCPSDRVFFDASVIWGLVGPLRIFGSHGDYQA  611

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W F  GA+ P+ VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G I
Sbjct  612  LNWFFFGGAIGPILVWILHKSFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIIVGTI  671

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+F L  E+  L WWG+  +HCPLA+
Sbjct  672  FNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYFTLGLENTSLNWWGTAGEHCPLAT  731

Query  211  CPTAPGIVVEGCPVF  167
            CPTA GIVV+GCPV+
Sbjct  732  CPTAKGIVVDGCPVY  746



>emb|CAN81605.1| hypothetical protein VITISV_025060 [Vitis vinifera]
Length=739

 Score =   261 bits (666),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 146/194 (75%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN+ V WW+L SIENIC    L PNSPWTCP  RV +DASVIWGL+GP+R+FG  G Y  
Sbjct  545  VNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIWGLVGPRRIFGDLGDYSA  604

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL+GA+ PV VW+L K FP +KWI L+N+PV+      MPPAT  N  +WI  G I
Sbjct  605  LNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPATTLNFNAWIFVGTI  664

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L   ++ + WWG+E +HC LAS
Sbjct  665  FNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSISWWGAEGEHCGLAS  724

Query  211  CPTAPGIVVEGCPV  170
            CPTA GIVV+GCPV
Sbjct  725  CPTAKGIVVDGCPV  738



>ref|XP_001767301.1| predicted protein [Physcomitrella patens]
 gb|EDQ67982.1| predicted protein [Physcomitrella patens]
Length=690

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 142/196 (72%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            V+NL   WW+L S+ +IC  D L  NSPWTCP   + +DASVIWGLIGPKR+FG  GLY 
Sbjct  495  VLNLGTAWWLLTSVPDICQQDLLPANSPWTCPGDTIFYDASVIWGLIGPKRMFGSLGLYN  554

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PVP WVL K+FP+KKWI  I  PV+      MPPAT  N  SW + G 
Sbjct  555  AVNWFFLFGALAPVPFWVLHKIFPDKKWITYIYTPVLIGATGMMPPATAVNYTSWFLIGY  614

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+ VFKYRKGWWQ+YNY+LSAALDAG AFM VLL+F LQ E K + WWG  LD+CPLA
Sbjct  615  IFNHLVFKYRKGWWQRYNYILSAALDAGLAFMGVLLYFVLQLEDKNMSWWGENLDNCPLA  674

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPG+   GCPVF
Sbjct  675  ACPTAPGVTRNGCPVF  690



>ref|XP_002967106.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
 gb|EFJ31705.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
Length=739

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN+ V WW+L  I+NICDT+ L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  543  VNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGEYSQ  602

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FLIG + P+PVW+LS+  P+ +++  +NIPVI      MPPAT  N  +WI  G++
Sbjct  603  LSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYMPPATSVNYTTWITLGVV  662

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWG-SELDHCPLA  215
            FNYFV+KYRK WW++YNYVLSAALDAG+AFMAV+L+F+L  E   L WWG S+ DHCPLA
Sbjct  663  FNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLEDVSLTWWGTSDRDHCPLA  722

Query  214  SCPTAPGIVVEGCPVFK  164
             CPT PGIVV+GCPV+ 
Sbjct  723  KCPTQPGIVVDGCPVYS  739



>ref|XP_002960906.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
 gb|EFJ38445.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
Length=739

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN+ V WW+L  I+NICDT+ L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  543  VNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGEYSQ  602

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FLIG + P+PVW+LS+  P+ +++  +NIPVI      MPPAT  N  +WI  G++
Sbjct  603  LSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYMPPATSVNYTTWITLGVV  662

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWG-SELDHCPLA  215
            FNYFV+KYRK WW++YNYVLSAALDAG+AFMAV+L+F+L  E   L WWG S+ DHCPLA
Sbjct  663  FNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLEDVSLTWWGTSDRDHCPLA  722

Query  214  SCPTAPGIVVEGCPVFK  164
             CPT PGIVV+GCPV+ 
Sbjct  723  KCPTQPGIVVDGCPVYS  739



>gb|KCW56911.1| hypothetical protein EUGRSUZ_I02587 [Eucalyptus grandis]
Length=739

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIWGL+GP+R+FG  G Y+
Sbjct  544  TINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIWGLVGPRRIFGTLGNYQ  603

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MP ATP N  +WI+ G 
Sbjct  604  AMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMMPAATPLNYSAWILVGT  663

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+K L WWG+  +HC LA
Sbjct  664  IFNFFIFRYRKQWWQRYNYVLSAALDAGVAFMAVLLYFAVNIENKSLTWWGTNGEHCELA  723

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI V+GCPV
Sbjct  724  ACPTAKGIEVDGCPV  738



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 146/194 (75%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN+ V WW+L SIENIC    L PNSPWTCP  RV +DASVIWGL+GP+R+FG  G Y  
Sbjct  546  VNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIWGLVGPRRIFGDLGDYSA  605

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL+GA+ PV VW+L K FP +KWI L+N+PV+      MPPAT  N  +WI  G I
Sbjct  606  LNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPATTLNFNAWIFVGTI  665

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L   ++ + WWG+E +HC LAS
Sbjct  666  FNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSISWWGAEGEHCGLAS  725

Query  211  CPTAPGIVVEGCPV  170
            CPTA GIVV+GCPV
Sbjct  726  CPTAKGIVVDGCPV  739



>ref|XP_010461766.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  KCPTARGVIVDGCPV  728



>ref|NP_201246.1| oligopeptide transporter 4 [Arabidopsis thaliana]
 sp|Q9FME8.1|OPT4_ARATH RecName: Full=Oligopeptide transporter 4; Short=AtOPT4 [Arabidopsis 
thaliana]
 dbj|BAB09872.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAM20694.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAN15658.1| Isp4-like protein [Arabidopsis thaliana]
 dbj|BAE99084.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AED97890.1| oligopeptide transporter 4 [Arabidopsis thaliana]
Length=729

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  KCPTARGVIVDGCPV  728



>gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana]
Length=729

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  KCPTARGVIVDGCPV  728



>ref|XP_002866614.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42873.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  KCPTARGVIVDGCPV  728



>ref|XP_010444374.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  KCPTARGVIVDGCPV  728



>ref|XP_008803571.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+LGSI NIC +D L  NSPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  568  TINLAVAWWLLGSITNICQSDLLPENSPWTCPSDRVFFDASVIWGLVGPRRIFGPLGNYA  627

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W F +GA+ P+ VW+  ++FP + WIPLIN+PV+    A MPPAT  N  +W+  G 
Sbjct  628  ALNWFFAVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGATAYMPPATALNYTAWVTVGT  687

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRK WW++YNY+LSAALDAG AFM VLL+F L  E+  L WWG+  +HC LA
Sbjct  688  VFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFTLNLENTSLNWWGTGGEHCDLA  747

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA G+ V+GCPVF
Sbjct  748  TCPTAKGVRVDGCPVF  763



>ref|XP_010484229.1| PREDICTED: oligopeptide transporter 4 [Camelina sativa]
Length=729

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  KCPTARGVIVDGCPV  728



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKTLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA G++V+GCPV
Sbjct  714  TCPTARGVIVDGCPV  728



>ref|XP_006280078.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
 gb|EOA12976.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
Length=729

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  KCPTARGVIVDGCPV  728



>ref|XP_010520694.1| PREDICTED: oligopeptide transporter 4 [Tarenaya hassleriana]
Length=756

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL+V WW L SIENIC  D L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  561  TVNLSVAWWQLSSIENICQEDLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  620

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ P+ VW+L K FP + WIPLIN+PV+    + MPPAT  N  SWI+ G 
Sbjct  621  AMNWFFVGGALGPIIVWMLHKSFPNQSWIPLINLPVLLGATSMMPPATAVNYNSWILVGT  680

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+F L  E   L WWG++ +HC LA
Sbjct  681  VFNFFVFRYRKQWWQRYNYVLSAALDAGVAFMAVLLYFTLGMEGIRLSWWGTDGEHCNLA  740

Query  214  SCPTAPGIVVEGCPV  170
             CPTA GI V+GCPV
Sbjct  741  KCPTAEGISVDGCPV  755



>ref|XP_003545740.1| PREDICTED: oligopeptide transporter 4 [Glycine max]
Length=736

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 146/194 (75%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  541  TINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYS  600

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P+ VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI  G 
Sbjct  601  AMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIFVGT  660

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+FAL  E+K L WWG++ +HCPLA
Sbjct  661  IFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFALGLENKSLNWWGNDGEHCPLA  720

Query  214  SCPTAPGIVVEGCP  173
             CPTA G++V+GCP
Sbjct  721  VCPTAKGVIVDGCP  734



>gb|KJB32171.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=951

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  756  TINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGNYP  815

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  816  AMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWILVGT  875

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E++ + WWG+E +HC LA
Sbjct  876  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMENRSVTWWGTEGEHCKLA  935

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+V+GCPV
Sbjct  936  TCPTAKGIMVDGCPV  950



>gb|KHN33580.1| Oligopeptide transporter 4 [Glycine soja]
Length=773

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 146/194 (75%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  578  TINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYS  637

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P+ VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI  G 
Sbjct  638  AMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIFVGT  697

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+FAL  E+K L WWG++ +HCPLA
Sbjct  698  IFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFALGLENKSLNWWGNDGEHCPLA  757

Query  214  SCPTAPGIVVEGCP  173
             CPTA G++V+GCP
Sbjct  758  VCPTAKGVIVDGCP  771



>ref|XP_007148333.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
 gb|ESW20327.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
Length=738

 Score =   259 bits (661),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L SI+NIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  543  TINIGVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYS  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+P++      MPPATP N  +WI+ G 
Sbjct  603  AMNWFFLGGALGPVIVWLLHKAFPKQSWIPLINLPILLGATGMMPPATPLNYNAWILVGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+F L  E++ L WWG++ +HCPLA
Sbjct  663  IFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLGLENRSLNWWGNDGEHCPLA  722

Query  214  SCPTAPGIVVEGCP  173
            +CPTA GI+V+GCP
Sbjct  723  ACPTAKGIIVDGCP  736



>emb|CBI19305.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 150/200 (75%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  501  TVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRVFFDASVIWGLVGPKRVFGSLGNYG  560

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  561  ALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPVLLGATASMPPATPVNYNAWILIGT  620

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++ +L  E+K L WWG++ D    H
Sbjct  621  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYVSLGIENKNLHWWGADPDIDPEH  680

Query  226  CPLASCPTAPGIVVEGCPVF  167
            CPLASCPTA G++V+GCPVF
Sbjct  681  CPLASCPTAKGVIVDGCPVF  700



>gb|EMS45133.1| Oligopeptide transporter 4 [Triticum urartu]
Length=681

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 149/199 (75%), Gaps = 3/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDASVIWGL+GPKR+FGP G Y 
Sbjct  483  TVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGPHGNYE  542

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FLIGA  PV V++  ++FP ++WI +IN+PV+    A MPPAT  N  SW++ G 
Sbjct  543  AVNWFFLIGAAGPVIVYIFHRIFPSQRWILMINLPVLIGATANMPPATAVNYNSWLLIGT  602

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E++ + WWG+  +HCPLA
Sbjct  603  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLTMENRTVNWWGTAGEHCPLA  662

Query  214  SCPTAPGIVV---EGCPVF  167
            SCPTA G+ +     CPVF
Sbjct  663  SCPTAKGVDLGPDSVCPVF  681



>gb|EPS59040.1| hypothetical protein M569_15770, partial [Genlisea aurea]
Length=538

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 146/196 (74%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L +I++IC  D L PNSPWTCP  RV FDASVIWGL+GP+R+FG  G Y 
Sbjct  343  TINIGVAWWLLTTIKDICHPDLLPPNSPWTCPSDRVFFDASVIWGLVGPRRIFGKLGNYG  402

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            ++ W FL GA+ P  VW+L K FP + WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  403  SMNWFFLGGAIGPFFVWLLHKAFPRQAWIPLINLPVLLGATGAMPPATPLNYNAWIIVGT  462

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSA LDAG AFMAVL++FAL  E+  + WWG+  DHC  A
Sbjct  463  IFNFFVFRYRKRWWQRYNYILSAGLDAGVAFMAVLVYFALGIENVSINWWGTAGDHCTFA  522

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA GI V+GCP++
Sbjct  523  TCPTAKGIQVDGCPIY  538



>ref|XP_006422647.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35887.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=692

 Score =   258 bits (658),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIWGL GPKR+FG  G Y 
Sbjct  497  TINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIWGLAGPKRIFGSQGNYP  556

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ PV VW+L K FP++ WI LIN+PV+      MPPAT  N  SWI+ G 
Sbjct  557  AMNWFFVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGATGMMPPATAVNYNSWIIVGT  616

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E K L WWG+E +HC LA
Sbjct  617  IFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMEDKGLSWWGTEGEHCDLA  676

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+++GCPV
Sbjct  677  TCPTAKGILIDGCPV  691



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =   260 bits (665),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+ V WW+L SIENIC    L PNSPWTCP  RV +DASVIWGL+GP+R+FG  G Y 
Sbjct  664  TVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIWGLVGPRRIFGDLGDYS  723

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL+GA+ PV VW+L K FP +KWI L+N+PV+      MPPAT  N  +WI  G 
Sbjct  724  ALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAMPPATTLNFNAWIFVGT  783

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L   ++ + WWG+E +HC LA
Sbjct  784  IFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMANRSISWWGAEGEHCGLA  843

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA GIVV+GCPV
Sbjct  844  SCPTAKGIVVDGCPV  858



>gb|KCW63396.1| hypothetical protein EUGRSUZ_G01042, partial [Eucalyptus grandis]
Length=720

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+AV WW+L SI NIC  + L P+SPWTCP  RV FDASVIWGL GPKR+FG  G Y+
Sbjct  525  TVNMAVAWWLLNSITNICQIELLPPDSPWTCPNDRVFFDASVIWGLAGPKRIFGVQGNYQ  584

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P  VW+L K FP+K WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  585  AMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNMPPATPLNYNAWVLVGT  644

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L  E+K L WWG+  +HC LA
Sbjct  645  IFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMENKGLNWWGTGGEHCDLA  704

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA GI ++GCP 
Sbjct  705  SCPTAKGISMDGCPT  719



>ref|XP_007148334.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
 gb|ESW20328.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
Length=734

 Score =   258 bits (659),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 148/194 (76%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L SI+NIC  D L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  539  TINIGVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYS  598

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI+ G 
Sbjct  599  AMNWFFLGGALGPVIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWILVGT  658

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+F L  E++ L WWG++ +HCPLA
Sbjct  659  IFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLGLENRSLNWWGNDGEHCPLA  718

Query  214  SCPTAPGIVVEGCP  173
            +CPTA G++V+GCP
Sbjct  719  ACPTAKGVIVDGCP  732



>ref|XP_010244695.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=743

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 147/196 (75%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV  W+L SI NICD   L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  548  TINIAVAMWLLNSIPNICDDQILPPDSPWTCPSDRVFFDASVIWGLVGPKRIFGTLGNYT  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ P+ VW+L K FP++ WIP IN+PV+    A MPPAT  N  SW++ G 
Sbjct  608  ALNWFFLGGALGPLLVWLLHKTFPKQTWIPQINLPVLLGATAMMPPATTVNYTSWVLVGT  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L  E K L WWG+  +HC LA
Sbjct  668  IFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMGVLLYFSLNMEGKGLDWWGAGGEHCDLA  727

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTA GIVV+GCPVF
Sbjct  728  SCPTAKGIVVDGCPVF  743



>ref|XP_003547106.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=737

 Score =   258 bits (659),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 147/194 (76%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  542  TINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYS  601

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MPPATP N  +WI  G 
Sbjct  602  AMNWFFLGGALGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMMPPATPLNYNAWIFVGT  661

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM V+L+F+L  E+K L WWG++ +HCPLA
Sbjct  662  IFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVMLYFSLGLENKSLNWWGNDGEHCPLA  721

Query  214  SCPTAPGIVVEGCP  173
            +CPTA GI+V+GCP
Sbjct  722  ACPTAKGIIVDGCP  735



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L +I NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG++ +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTQGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  RCPTARGVIVKGCPV  728



>ref|XP_010065749.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=756

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+AV WW+L SI NIC  + L P+SPWTCP  RV FDASVIWGL GPKR+FG  G Y+
Sbjct  561  TVNMAVAWWLLNSITNICQIELLPPDSPWTCPNDRVFFDASVIWGLAGPKRIFGVQGNYQ  620

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P  VW+L K FP+K WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  621  AMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNMPPATPLNYNAWVLVGT  680

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L  E+K L WWG+  +HC LA
Sbjct  681  IFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMENKGLNWWGTGGEHCDLA  740

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA GI ++GCP 
Sbjct  741  SCPTAKGISMDGCPT  755



>ref|XP_006422648.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35888.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=736

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIWGL GPKR+FG  G Y 
Sbjct  541  TINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIWGLAGPKRIFGSQGNYP  600

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ PV VW+L K FP++ WI LIN+PV+      MPPAT  N  SWI+ G 
Sbjct  601  AMNWFFVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGATGMMPPATAVNYNSWIIVGT  660

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E K L WWG+E +HC LA
Sbjct  661  IFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMEDKGLSWWGTEGEHCDLA  720

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI+++GCPV
Sbjct  721  TCPTAKGILIDGCPV  735



>ref|XP_002283674.1| PREDICTED: oligopeptide transporter 4-like [Vitis vinifera]
Length=754

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 150/200 (75%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  555  TVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRVFFDASVIWGLVGPKRVFGSLGNYG  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  615  ALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPVLLGATASMPPATPVNYNAWILIGT  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++ +L  E+K L WWG++ D    H
Sbjct  675  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYVSLGIENKNLHWWGADPDIDPEH  734

Query  226  CPLASCPTAPGIVVEGCPVF  167
            CPLASCPTA G++V+GCPVF
Sbjct  735  CPLASCPTAKGVIVDGCPVF  754



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 146/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L SI NIC+ + L  +SPWTCP  RV FDASVIWGL+GPKR+FG  G Y+
Sbjct  551  TINIAVAWWLLNSIHNICEDNLLPADSPWTCPGDRVFFDASVIWGLVGPKRIFGDLGTYK  610

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W F+ GA+ P+ VW+  K FP+K WIPLIN+PV+    A MPPAT  N  +WI+ G 
Sbjct  611  AMNWFFIGGAIGPIIVWLFHKAFPKKSWIPLINLPVLLGATAYMPPATTVNYNAWIIVGT  670

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNY+LSAALDAG AFM VLL+F+L  E K L WWG+  +HC LA
Sbjct  671  IFNLFVFRYRKQWWQRYNYILSAALDAGVAFMGVLLYFSLGVEDKSLTWWGTNGEHCNLA  730

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA GI V+GCP+
Sbjct  731  SCPTAKGIAVDGCPI  745



>ref|XP_008454451.1| PREDICTED: oligopeptide transporter 4 [Cucumis melo]
Length=738

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIWGLIGPKR+FG  G Y 
Sbjct  543  TINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIWGLIGPKRIFGSHGFYG  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  603  TMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMMPPATPVNYNAWILIGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++  E + ++WWG+  +HC LA
Sbjct  663  IFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEERSVEWWGTAGEHCDLA  722

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA G+VV+ CPV
Sbjct  723  ACPTAKGVVVDSCPV  737



>gb|KGN53886.1| hypothetical protein Csa_4G179700 [Cucumis sativus]
Length=738

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIWGLIGPKR+FG  G Y 
Sbjct  543  TINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIWGLIGPKRIFGSHGFYG  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  603  TMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMMPPATPVNYNAWILIGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++  E + ++WWG+  +HC LA
Sbjct  663  IFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEERSVEWWGTAGEHCDLA  722

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA G+VV+ CPV
Sbjct  723  ACPTAKGVVVDSCPV  737



>ref|XP_010029956.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=743

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIWGL+GP+R+FG  G Y+
Sbjct  548  TINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDASVIWGLVGPRRIFGTLGNYQ  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MP ATP N  +WI+ G 
Sbjct  608  AMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMMPAATPLNYNAWILVGT  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+K + WWG+  +HC LA
Sbjct  668  IFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVNIENKSITWWGTNGEHCELA  727

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI  +GCPV
Sbjct  728  ACPTAKGIEGDGCPV  742



>gb|EMT16469.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=790

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 149/199 (75%), Gaps = 3/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDASVIWGL+GPKR+FGP G Y 
Sbjct  592  TVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGPHGNYE  651

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FLIGA  PV V++  ++FP ++WI +IN+PV+    A MPPAT  N  SW++ G 
Sbjct  652  AVNWFFLIGAAGPVIVYIFHRIFPSQRWILMINLPVLIGATANMPPATAVNYNSWLLIGT  711

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E++ + WWG+  +HCPLA
Sbjct  712  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLTMENRTVNWWGTAGEHCPLA  771

Query  214  SCPTAPGIVV---EGCPVF  167
            SCPTA G+ +     CPVF
Sbjct  772  SCPTAKGVDLGPDSVCPVF  790



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 ref|XP_004170983.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=738

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 147/195 (75%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIWGLIGPKR+FG  G Y 
Sbjct  543  TINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIWGLIGPKRIFGSHGFYG  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    A MPPATP N  +WI+ G 
Sbjct  603  TMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMMPPATPVNYNAWILIGT  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++  E + ++WWG+  +HC LA
Sbjct  663  IFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEERSVEWWGTAGEHCDLA  722

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA G+VV+ CPV
Sbjct  723  ACPTAKGVVVDSCPV  737



>gb|EMT13287.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=521

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V WW+LGS+ENIC    L PNSPWTCP  RV FDASVIWGL+GP R+FG  G Y  
Sbjct  324  VNLIVGWWLLGSVENICQDQLLPPNSPWTCPNDRVFFDASVIWGLVGPNRIFGSNGNYIA  383

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GA  PV V++L ++FP  KWI LINIPV++   A MPPA+  N  SW++ G+I
Sbjct  384  LNWFFLFGAAGPVIVYILHRIFPTHKWILLINIPVLTGATALMPPASTLNFNSWLLYGII  443

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNY+LSA LDAG AFM VLL+F L  E++ +KWWG+  +HCPLAS
Sbjct  444  FNFFVFRYRKKWWQRYNYILSAGLDAGAAFMGVLLYFTLTMENRTIKWWGTGGEHCPLAS  503

Query  211  CPTAPGIVV---EGCPVF  167
            CPTA G+ +     CPVF
Sbjct  504  CPTAKGVDLGPDSVCPVF  521



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  540  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYSA  599

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K FP K WI LIN+PV+    A MPPAT  N   WI+ G+I
Sbjct  600  LNWFFLGGLIGPVLVWLLQKAFPTKTWISLINLPVLLGATAAMPPATSVNFNCWIIVGVI  659

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKEL-KWWGSELDHCPLA  215
            FNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG+  ++CPLA
Sbjct  660  FNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGANGENCPLA  719

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI VEGCPVF
Sbjct  720  SCPTAPGIQVEGCPVF  735



>gb|KHG27446.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=755

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDASVIWGL+GPKR+FG  G Y 
Sbjct  556  TINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDASVIWGLVGPKRIFGSLGEYS  615

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPATP N  SWI+ G 
Sbjct  616  TLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNMPPATPLNYTSWIIVGT  675

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL  E K L WWG+  D    H
Sbjct  676  IFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALGVESKSLHWWGASPDVVPEH  735

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LA+CPTA GI+VEGCP+F
Sbjct  736  CDLATCPTAKGILVEGCPIF  755



>gb|KCW56912.1| hypothetical protein EUGRSUZ_I02589 [Eucalyptus grandis]
Length=770

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 148/195 (76%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIWGL+GP+R+FG  G Y+
Sbjct  575  TINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDASVIWGLVGPRRIFGTLGNYQ  634

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      MP ATP N  +WI+ G 
Sbjct  635  AMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMMPAATPLNYNAWILVGT  694

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+K + WWG+  +HC LA
Sbjct  695  IFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVNIENKSITWWGTNGEHCELA  754

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI  +GCPV
Sbjct  755  ACPTAKGIEGDGCPV  769



>gb|KJB58807.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDASVIWGL+GPKR+FG  G Y 
Sbjct  555  TINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDASVIWGLVGPKRIFGSLGEYS  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPATP N  SWI+ G 
Sbjct  615  TLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNMPPATPLNYTSWIIVGT  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL  E K L WWG+  D    H
Sbjct  675  IFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALGVESKSLHWWGASPDVVPEH  734

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LA+CPTA GI+VEGCP+F
Sbjct  735  CDLATCPTAKGILVEGCPIF  754



>gb|EMT05383.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=570

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 149/199 (75%), Gaps = 3/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL+V WW+LGS+ENIC  + LS NSPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  372  TINLSVAWWLLGSVENICHIEKLSANSPWTCPNDRVFFDASVIWGLVGPRRIFGPLGNYA  431

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + + FLIGA  P  V++  ++FP+KKWI LIN+PV+    A MPPAT  N  SW++ G 
Sbjct  432  AINYFFLIGAASPFVVYIFHRIFPDKKWILLINLPVLINATASMPPATAVNYNSWLLVGT  491

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+ SAA+DAG AFMAVLL+FAL  +++ + WWG+  +HCPLA
Sbjct  492  IFNFFVFRYRKRWWQRYNYIFSAAMDAGVAFMAVLLYFALTMQNRSIVWWGTAGEHCPLA  551

Query  214  SCPTAPGIVV---EGCPVF  167
             CPT+ G+ +     CPVF
Sbjct  552  ICPTSKGVDLGPESVCPVF  570



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L +I NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+  K FP+  WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  RCPTARGVIVKGCPV  728



>emb|CDP19591.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   253 bits (646),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 147/198 (74%), Gaps = 2/198 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+L ++E+IC  D ++ NSPWTCP  RV FDASVIWGL+GPKR+FGP G Y 
Sbjct  395  TVNLGVAWWLLHTVEDICHPD-MASNSPWTCPGDRVFFDASVIWGLVGPKRIFGPHGNYS  453

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + P+ +W+L K FP++ WIPLIN+PVI    A MPPAT  N  SWIV G 
Sbjct  454  ALNWFFLGGLLGPLAIWLLHKQFPKQSWIPLINLPVILGATASMPPATALNYNSWIVVGT  513

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSEL-DHCPL  218
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA LL+F +  E++ + WWG+   +HC L
Sbjct  514  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAFLLYFTVGMENRSISWWGNNNPEHCDL  573

Query  217  ASCPTAPGIVVEGCPVFK  164
            A+CPTA GI V+GCP F 
Sbjct  574  ATCPTAKGISVDGCPTFH  591



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L +I NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+  K FP+  WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEDKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++V+GCPV
Sbjct  714  RCPTARGVIVKGCPV  728



>dbj|BAJ90957.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   256 bits (654),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 148/199 (74%), Gaps = 3/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  551  TVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGSHGNYE  610

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FLIGA  PV V++  ++FP ++WI +IN+PV+    A MPPAT  N  SW++ G 
Sbjct  611  AVNWFFLIGAAGPVIVYIFHRIFPRQRWILMINLPVLIGATANMPPATAVNYNSWLLIGT  670

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E++ + WWG+  +HCPLA
Sbjct  671  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLTMENRTVNWWGTAGEHCPLA  730

Query  214  SCPTAPGIVV---EGCPVF  167
            SCPTA G+ +     CPVF
Sbjct  731  SCPTAKGVDLGPDSACPVF  749



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   256 bits (653),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 144/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L ++ENIC  + L PNSPWTCP  RV FDASVIWGL+GP+R+FG  G Y  
Sbjct  540  VNVSVAWYLLTTVENICQKELLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGNLGNYPE  599

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GA+ P+ VW+L K FP +KWI  IN+PV+    A MPPAT  N   WI+ G+I
Sbjct  600  LNWFFLFGALGPLIVWILHKAFPNQKWISQINLPVLLGSTAAMPPATSVNFNCWIIIGVI  659

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYFVFKYRK WWQ+YNYVLSAALDAG AFM VLL+F L      + WWGS  ++CPLAS
Sbjct  660  FNYFVFKYRKSWWQRYNYVLSAALDAGLAFMGVLLYFTLSMNDISISWWGSNGENCPLAS  719

Query  211  CPTAPGIVVEGCPVF  167
            CPTA G+ VEGCP F
Sbjct  720  CPTAEGVEVEGCPAF  734



>gb|KFK28135.1| hypothetical protein AALP_AA8G476800 [Arabis alpina]
Length=990

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 147/200 (74%), Gaps = 0/200 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  534  TINITVAWWQLTSIKNICQEELLPPNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYA  593

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    A MPPAT  N  SWI+ G 
Sbjct  594  AMNWFFLGGAIGPVIVWLCHKAFPKRTWIPLVNLPVLLGATAMMPPATAVNYNSWILVGT  653

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+F++  E K L WWG+  +HC LA
Sbjct  654  IFNLFVFRYRKSWWQRYNYVLSAALDAGVAFMAVLLYFSVGMEEKSLDWWGTRGEHCDLA  713

Query  214  SCPTAPGIVVEGCPVFK*AS  155
             CPTA G++V+GCP+   A+
Sbjct  714  RCPTARGVIVDGCPILHLAN  733



>gb|EMS53301.1| Oligopeptide transporter 4 [Triticum urartu]
Length=636

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 145/199 (73%), Gaps = 3/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+LGS+ENIC    L PNSPWTCP  RV FDASVIWGL+GP R+FG  G Y 
Sbjct  438  TVNLIVGWWLLGSVENICQDQLLPPNSPWTCPNDRVFFDASVIWGLVGPNRIFGSNGNYI  497

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V++L + FP  KWI LINIPV++   A MPPAT  N  SW++ G+
Sbjct  498  ALNWFFLIGAAGPVIVYILHRTFPTHKWILLINIPVLTGATALMPPATTVNFNSWLLYGI  557

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSA LDAG AFM VLL+F L  E++ + WWG+  +HCPLA
Sbjct  558  IFNFFVFRYRKKWWQRYNYILSAGLDAGAAFMGVLLYFTLTMENRTINWWGTGGEHCPLA  617

Query  214  SCPTAPGIVV---EGCPVF  167
            SCPTA G+ +     CPVF
Sbjct  618  SCPTAKGVDLGPDSVCPVF  636



>ref|XP_006847459.1| hypothetical protein AMTR_s03508p00001080 [Amborella trichopoda]
 gb|ERN09040.1| hypothetical protein AMTR_s03508p00001080 [Amborella trichopoda]
Length=368

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 139/195 (71%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +NL V WW+L SIENIC+  AL   SPWTCP  RV FDASVIWGL+GPKR+FGP G Y  
Sbjct  174  INLGVAWWLLESIENICNKAALPKGSPWTCPGDRVFFDASVIWGLVGPKRIFGPLGAYPA  233

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPAT  N  +W+  G +
Sbjct  234  LNWFFLGGVLGPVLVWLLHKAFPSQTWIPLINLPVLLGATNYMPPATALNYNAWVAVGTV  293

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F L  E+    WWG++ +HC  A 
Sbjct  294  FNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFLLSMENNSFNWWGTDGEHCDFAV  353

Query  211  CPTAPGIVVEGCPVF  167
            CPTA G++ +GCPV 
Sbjct  354  CPTAKGVIAKGCPVL  368



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 144/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+AV WW+L SI NIC    L P+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  557  TINMAVAWWLLNSITNICQDQLLPPDSPWTCPGDRVFFDASVIWGLVGPKRIFGVQGNYP  616

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P  VW+L K FP+K WIPLIN+PV+      MPPATP N  +W++ G 
Sbjct  617  AMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNMPPATPLNYNAWVLVGT  676

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L  E++ L WWG+  +HC LA
Sbjct  677  IFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMENRGLNWWGTGGEHCDLA  736

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA GI  +GCP+
Sbjct  737  SCPTAKGISADGCPM  751



>gb|EMS64171.1| Oligopeptide transporter 4 [Triticum urartu]
Length=648

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 146/199 (73%), Gaps = 3/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL+  WW+LGS+ENIC    LSP+SPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  450  TVNLSTAWWLLGSVENICQDQLLSPDSPWTCPGDRVFFDASVIWGLVGPKRIFGTHGNYE  509

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FLIGA  PV V++  ++FP  KWI +IN+PV+    A MP AT  N  SW++ G 
Sbjct  510  AVNWFFLIGAAGPVIVYIFHRIFPSHKWILMINLPVLIGATAQMPAATAMNYNSWLLIGT  569

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E++ + WWG+  +HCPLA
Sbjct  570  IFNFFVFRYRKMWWQRYNYILSAALDAGVAFMAVLLYFTLTMENRTVDWWGTGGEHCPLA  629

Query  214  SCPTAPGIVV---EGCPVF  167
            SCPTA G+ +     CPVF
Sbjct  630  SCPTAKGVDLGPDSVCPVF  648



>ref|XP_007018306.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOY15531.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=752

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+L S+++IC  D L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  553  TVNLGVAWWLLTSVDSICHKDLLPKNSPWTCPGDRVFFDASVIWGLVGPKRIFGSLGQYS  612

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPA+P N  SWI+ G 
Sbjct  613  TLNWFFLGGLLGPVVVWLLHKAFPSQSWIPLINLPVLLGATGNMPPASPLNYTSWILVGT  672

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+Y+K WWQ+YNY+LSAALDAG AFM VLL+FAL  E+K L WWGS  D    H
Sbjct  673  IFNFFVFRYQKQWWQRYNYILSAALDAGVAFMTVLLYFALGLENKSLNWWGSSPDYIPEH  732

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LA CPTA GI V+GCP F
Sbjct  733  CDLAGCPTAKGISVDGCPTF  752



>gb|KHN33579.1| Oligopeptide transporter 4 [Glycine soja]
Length=666

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 144/194 (74%), Gaps = 0/194 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ V WW+L SI+NIC  D L   SPWTCP   V FDASVIWGL+GPKR+FG  G Y 
Sbjct  471  TINIGVAWWLLNSIKNICHDDLLPEGSPWTCPNDLVFFDASVIWGLVGPKRIFGSQGNYG  530

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV P+ VW+L K FP++ WIPLIN+PV+      MPPA P N  +WI  G 
Sbjct  531  AMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGIMPPARPLNYNAWIFVGT  590

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+F+F+YRK WWQ+YNYVLSAALD+G  FM V+L+F+L  E+K L WWG++ +HCPLA
Sbjct  591  IFNFFIFRYRKKWWQRYNYVLSAALDSGVVFMTVMLYFSLGLENKSLNWWGNDGEHCPLA  650

Query  214  SCPTAPGIVVEGCP  173
            +CPTA GI+V+GCP
Sbjct  651  ACPTAKGIIVDGCP  664



>ref|XP_009413226.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 148/195 (76%), Gaps = 1/195 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N+ V  WMLGSI+NICD   L PNSPWTCP  RV FDASVIWGL+GP+R+FGP G Y +
Sbjct  553  INITVAHWMLGSIDNICDRARLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGPLGNYGS  612

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GA+ PV VW L + FP + WIPL+N+PV+      MPPA+P N  +W+V G +
Sbjct  613  LNWFFLGGAIGPVLVWGLHRAFPARSWIPLVNLPVLLGATGIMPPASPINFTAWVVVGTV  672

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNY V++ RK WW+++NY+LSAA+DAG AFM VLL+FAL  E+  + WWG++ +HCPLA+
Sbjct  673  FNYAVYRRRKKWWERFNYILSAAMDAGVAFMGVLLYFALNMENTSIDWWGTD-EHCPLAT  731

Query  211  CPTAPGIVVEGCPVF  167
            CPTA G+ VEGCPVF
Sbjct  732  CPTAKGVQVEGCPVF  746



>ref|NP_001266848.1| uncharacterized protein LOC101027225 [Zea mays]
 gb|ACN36454.1| unknown [Zea mays]
Length=370

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  174  TVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDASVIWGLVGPRRIFGPDGNYG  232

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    A MPPAT  N  SW++ G 
Sbjct  233  ALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGATAYMPPATAVNYNSWLLVGT  292

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L  ++K + WWG+  +HCPLA
Sbjct  293  VFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMQNKSIDWWGTAGEHCPLA  352

Query  214  SCPTAPGIVVEG--CPVF  167
             CPTA G+ +    CPVF
Sbjct  353  RCPTAKGVDLGDGVCPVF  370



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =   253 bits (646),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 145/196 (74%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  540  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  599

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K FP K WI  IN+PV+    A MPPAT  N   WI+ G+I
Sbjct  600  LNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVI  659

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKEL-KWWGSELDHCPLA  215
            FNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG+  ++CPLA
Sbjct  660  FNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGANGENCPLA  719

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI VEGCPVF
Sbjct  720  SCPTAPGIQVEGCPVF  735



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  541  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  600

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K FP + WI  IN+PV+    A MPPAT  N   WI+ G+I
Sbjct  601  LNWFFLGGLIGPVLVWLLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVI  660

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKEL-KWWGSELDHCPLA  215
            FNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG++ ++CPLA
Sbjct  661  FNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGAKGENCPLA  720

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI VEGCPVF
Sbjct  721  ACPTAPGIQVEGCPVF  736



>ref|XP_003570148.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=753

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL+V WW+LGSIENIC    L P+SPWTCP  RV FDASVIWGL+GP R+FGP G Y 
Sbjct  554  TVNLSVAWWLLGSIENICQDTLLPPDSPWTCPGDRVFFDASVIWGLVGPMRIFGPRGNYE  613

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L   FLIGA  PV V+V  ++FP +KWI LIN+PV+    A MPPAT  N  +W++ G 
Sbjct  614  ALNLFFLIGAAGPVIVYVFHRIFPNQKWILLINLPVLIGATASMPPATAVNYNAWLLIGT  673

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
             FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E++ + WWG+  +HCPLA
Sbjct  674  FFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLSMENRSIDWWGTAGEHCPLA  733

Query  214  SCPTAPGIVV---EGCPVFK  164
            +CPTA G+ +     CPVF+
Sbjct  734  TCPTAKGVDLGPDSLCPVFR  753



>gb|AFW63465.1| hypothetical protein ZEAMMB73_812110 [Zea mays]
Length=482

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  286  TVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDASVIWGLVGPRRIFGPDGNYG  344

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    A MPPAT  N  SW++ G 
Sbjct  345  ALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGATAYMPPATAVNYNSWLLVGT  404

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L  ++K + WWG+  +HCPLA
Sbjct  405  VFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMQNKSIDWWGTAGEHCPLA  464

Query  214  SCPTAPGIVVEG--CPVF  167
             CPTA G+ +    CPVF
Sbjct  465  RCPTAKGVDLGDGVCPVF  482



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  540  VNVSVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  599

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K FP + WI  IN+PV+    A MPPAT  N   WI+ G+I
Sbjct  600  LNWFFLGGLIGPVLVWLLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVI  659

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKEL-KWWGSELDHCPLA  215
            FNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG++ ++CPLA
Sbjct  660  FNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIDHWWGAKGENCPLA  719

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTAPGI VEGCPVF
Sbjct  720  ACPTAPGIQVEGCPVF  735



>gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN  V WW+L S++NIC    L P+SPWTCP  RV +DASVIWGL+GP+R+FG  G Y  
Sbjct  536  VNTGVAWWLLTSVKNICQDSLLPPDSPWTCPSDRVFYDASVIWGLVGPRRIFGHLGNYSA  595

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GA+ PV VW+L K FP++KWIPLIN+PV+    A +PPAT  N   WI+ G  
Sbjct  596  LNWFFLGGAIGPVIVWLLHKAFPKQKWIPLINLPVLLGATAILPPATTVNFNCWILVGTT  655

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYFVFKY K WWQ+YNYVLSAALDAG AFM V+L+F L  E K + WWG++ +HCPLAS
Sbjct  656  FNYFVFKYHKKWWQRYNYVLSAALDAGLAFMGVILYFTLTMEGKFISWWGNDGEHCPLAS  715

Query  211  CPTAPGIVVEGCPV  170
            CPTA GI V+GC V
Sbjct  716  CPTAEGIAVDGCVV  729



>ref|XP_003522744.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 2-like 
[Glycine max]
Length=730

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 145/195 (74%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +++ V WW+LGS++NIC+ D L  +SPWTCP  +V FDASVIWGL+GPKR+FG  G Y  
Sbjct  536  MDVGVAWWLLGSVKNICNQDLLPADSPWTCPGDKVFFDASVIWGLVGPKRIFGTLGNYPK  595

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FLIGA+ P+ +W+L K F ++ WI LI++PV+    A MPPA+  N  +WI  G I
Sbjct  596  LNWFFLIGALGPLVIWLLQKAFRKQTWISLIHLPVLLGATANMPPASSVNFNAWITVGTI  655

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYFVFKYRK WWQ+YNYVL AALDAG AFM VLL+FA+  E K + WWG++ D C LA 
Sbjct  656  FNYFVFKYRKNWWQRYNYVLPAALDAGLAFMTVLLYFAVNVEEKGIVWWGNDGDQCKLAK  715

Query  211  CPTAPGIVVEGCPVF  167
            CPTA G+V EGCPVF
Sbjct  716  CPTAKGVVTEGCPVF  730



>dbj|BAD08158.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=751

 Score =   251 bits (642),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDASVIWGLIGP R+FGP G Y 
Sbjct  554  TVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDASVIWGLIGPIRIFGPHGNYS  612

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V++  KMFP KKWI L N+PV+    A MPPAT  N  SW++ G 
Sbjct  613  ALNWFFLIGAAGPVIVYIFHKMFPNKKWITLTNLPVLIGATASMPPATAVNYNSWLLFGT  672

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E++ + WWG+  +HCPLA
Sbjct  673  IFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMENRSIDWWGTAGEHCPLA  732

Query  214  SCPTAPGIVV---EGCPVF  167
            +CPTA G+ +     CPVF
Sbjct  733  TCPTAKGVDLGPTSVCPVF  751



>gb|EEE57620.1| hypothetical protein OsJ_08019 [Oryza sativa Japonica Group]
Length=748

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDASVIWGLIGP R+FGP G Y 
Sbjct  551  TVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDASVIWGLIGPIRIFGPHGNYS  609

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V++  KMFP KKWI L N+PV+    A MPPAT  N  SW++ G 
Sbjct  610  ALNWFFLIGAAGPVIVYIFHKMFPNKKWITLTNLPVLIGATASMPPATAVNYNSWLLFGT  669

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E++ + WWG+  +HCPLA
Sbjct  670  IFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMENRSIDWWGTAGEHCPLA  729

Query  214  SCPTAPGIVV---EGCPVF  167
            +CPTA G+ +     CPVF
Sbjct  730  TCPTAKGVDLGPTSVCPVF  748



>emb|CDP19592.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 146/198 (74%), Gaps = 2/198 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+L ++++IC  D  S NSPWTCP  RV FDASVIWGL+GPKR+FGP G Y 
Sbjct  511  TVNLGVAWWLLHTVKDICHQDRTS-NSPWTCPGDRVFFDASVIWGLVGPKRIFGPHGNYS  569

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + P+ +W+L K FP++ WIPLIN+PVI    A MPPAT  N  SWI+ G 
Sbjct  570  ALNWFFLGGLLGPLAIWLLHKQFPKQTWIPLINLPVILGATAYMPPATALNYNSWILVGT  629

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSEL-DHCPL  218
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL F +  E++ + WWG+   +HC L
Sbjct  630  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLHFTVGMENRSISWWGNNNPEHCDL  689

Query  217  ASCPTAPGIVVEGCPVFK  164
            A+CPTA GI V+GCP F 
Sbjct  690  ATCPTAKGISVDGCPTFH  707



>ref|XP_002527347.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF35019.1| Oligopeptide transporter, putative [Ricinus communis]
Length=744

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L SI+ IC    L  NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  545  TINLGVAWWLLDSIDYICQDQLLPSNSPWTCPGSRVFFDASVIWGLVGPKRIFGSLGEYS  604

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+  K FP + WIPLIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  605  ALNWFFLGGLLGPVVVWLFHKKFPNQTWIPLINLPVLFGATAIMPPATAVNFNSWILVGT  664

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGS----ELDH  227
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVL++F L  E+  + WWGS    + +H
Sbjct  665  IFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMAVLIYFTLGLENVNMHWWGSDPNIDPEH  724

Query  226  CPLASCPTAPGIVVEGCPVF  167
            CPLASCPTA GI+ +GCP+F
Sbjct  725  CPLASCPTAKGIISDGCPIF  744



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 147/196 (75%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  539  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  598

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + P+ VW+L K FP K WI  IN+PV+    A MPPAT  N   WI+ G+I
Sbjct  599  LNWFFLGGLIGPLLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVI  658

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELK-WWGSELDHCPLA  215
            FNYFVFK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L    K ++ WWG++ ++CPLA
Sbjct  659  FNYFVFKHCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGKSIEHWWGAKGENCPLA  718

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI VEGCPVF
Sbjct  719  SCPTAPGIHVEGCPVF  734



>ref|XP_006856596.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
 gb|ERN18063.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
Length=732

 Score =   250 bits (639),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L SIENIC+  AL   SPWTCP  RV FDASVIWGL+GPKR+FGP G Y 
Sbjct  537  TINLGVAWWLLDSIENICNKAALPKGSPWTCPGDRVFFDASVIWGLVGPKRIFGPLGAYP  596

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ PV VW+L K FP + WIPLIN+PV+    A MP AT  N  +W+  G 
Sbjct  597  ALNWFFLGGALGPVLVWLLHKAFPSQTWIPLINLPVLLGATAYMPAATALNYNAWVAVGT  656

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F+L  E+    WWG++ +HC  A
Sbjct  657  VFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFSLSMENNSFNWWGTDGEHCDFA  716

Query  214  SCPTAPGIVVEGCPV  170
             CPTA G++ +GCPV
Sbjct  717  VCPTAKGVIAKGCPV  731



>ref|XP_002306519.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
 gb|EEE93515.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
Length=747

 Score =   250 bits (639),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 145/200 (73%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L S+E+IC  + L+ NSPWTCP  RV FDASVIWGL+GP+R+FG  G Y 
Sbjct  548  TINLGVAWWLLNSVEHICQDNLLAANSPWTCPSDRVFFDASVIWGLVGPRRIFGSLGEYA  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + P  VW+L K FP + WIPLIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  608  ALNWFFLGGLLGPFIVWLLHKAFPGQSWIPLINLPVLLGATASMPPATAINYNSWILVGT  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVL++  +  E+K L WWGS+ D    H
Sbjct  668  IFNFFIFRYRKAWWQRYNYVLSAALDAGVAFMAVLIYVTVGLENKNLYWWGSDPDVFPEH  727

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LA+CPTA GI V+GCP F
Sbjct  728  CSLATCPTAKGISVDGCPTF  747



>gb|EEC73829.1| hypothetical protein OsI_08562 [Oryza sativa Indica Group]
Length=757

 Score =   250 bits (639),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDASVIWGLIGP R+FGP G Y 
Sbjct  560  TVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDASVIWGLIGPIRIFGPHGNYS  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V++  KMFP KKWI LIN+PV+    A MPPAT  N  SW++ G 
Sbjct  619  ALNWFFLIGAAGPVIVYIFHKMFPNKKWITLINLPVLIGATASMPPATAVNYNSWLLFGT  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E++ + WWG+  +HC LA
Sbjct  679  IFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMENRSIDWWGTAGEHCALA  738

Query  214  SCPTAPGIVV---EGCPVF  167
            +CPTA G+ +     CPVF
Sbjct  739  TCPTAKGVDLGPTSVCPVF  757



>emb|CBI19304.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIWGL+ P+R+FG  G Y  
Sbjct  551  VNLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDASVIWGLVAPQRIFGTLGNYGA  610

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L  +FP + WIPL+N+PV+    A MPPATP N  +WI+ G I
Sbjct  611  LNWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGATASMPPATPVNYNAWILVGTI  670

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----HC  224
            FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++F +  E K L WWG+  D    HC
Sbjct  671  FNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVGIEEKNLYWWGANPDIDPEHC  730

Query  223  PLASCPTAPGIVVEGCPVF  167
            PLASCPTA G++V+GCP F
Sbjct  731  PLASCPTAKGVIVDGCPRF  749



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 146/195 (75%), Gaps = 1/195 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV  W+L SI NIC  D  S +SPWTCP  RV FDASVIWGL GPKR+FG  G+Y 
Sbjct  549  TVNLAVAHWLLNSITNICVDDPHS-DSPWTCPGDRVFFDASVIWGLAGPKRIFGTLGIYG  607

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV PV VWVL K +P++ WI LIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  608  AINWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGATASMPPATALNYNSWIIVGT  667

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+ ++  E+K + WWG+  +HC LA
Sbjct  668  IFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVGMENKSVAWWGTNGEHCTLA  727

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GIVV+GCPV
Sbjct  728  TCPTAKGIVVDGCPV  742



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIWGL+ P+R+FG  G Y  
Sbjct  559  VNLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDASVIWGLVAPQRIFGTLGNYGA  618

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L  +FP + WIPL+N+PV+    A MPPATP N  +WI+ G I
Sbjct  619  LNWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGATASMPPATPVNYNAWILVGTI  678

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----HC  224
            FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++F +  E K L WWG+  D    HC
Sbjct  679  FNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVGIEEKNLYWWGANPDIDPEHC  738

Query  223  PLASCPTAPGIVVEGCPVF  167
            PLASCPTA G++V+GCP F
Sbjct  739  PLASCPTAKGVIVDGCPRF  757



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  539  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  598

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K FP K WI  IN+PV+    A MPPAT  N   WI+ G+I
Sbjct  599  LNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVI  658

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELK-WWGSELDHCPLA  215
            FNYFVFKY K WWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG++ ++CPLA
Sbjct  659  FNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISINHWWGAKGENCPLA  718

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPG++V+GCPVF
Sbjct  719  SCPTAPGVLVDGCPVF  734



>emb|CDP04528.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 141/197 (72%), Gaps = 34/197 (17%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            + NL + WWML SI NICD +AL P SPWTCP+FR+TFD +V+WGLIGP+RLFGP GLYR
Sbjct  475  LANLGIGWWMLRSIPNICDVEALHPESPWTCPRFRLTFDTTVVWGLIGPERLFGPKGLYR  534

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            N+VWLF +GA+LP+PVW+LS++FP+KKWI LINIP+I+ GF                   
Sbjct  535  NMVWLFPVGALLPLPVWILSRIFPDKKWISLINIPLITCGF-------------------  575

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
                           KYNYVLS+ALDAGTAFM VL+FFALQN  K LKWWG+E DHCPLA
Sbjct  576  ---------------KYNYVLSSALDAGTAFMGVLVFFALQNSGKNLKWWGTEPDHCPLA  620

Query  214  SCPTAPGIVVEGCPVFK  164
            SCPTA GIV  GCP FK
Sbjct  621  SCPTAAGIVAAGCPAFK  637



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 143/196 (73%), Gaps = 0/196 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N AV WW+L  IENIC  + L PNSPWTCP  RV +DASVIWGLIGP R+FG  G Y 
Sbjct  543  TLNTAVAWWLLTGIENICQDELLPPNSPWTCPGDRVFYDASVIWGLIGPARIFGRLGNYT  602

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW L ++FP++KWI LIN+PV+    A MPPAT  N   WIV  +
Sbjct  603  ALNWFFLGGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGSTAAMPPATTVNFNCWIVVAI  662

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
             FNYFVFK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L  +   L WWG+  +HCPLA
Sbjct  663  TFNYFVFKFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLTMKEISLNWWGAAGEHCPLA  722

Query  214  SCPTAPGIVVEGCPVF  167
            +CPTA G++V+GCPV+
Sbjct  723  TCPTAKGVIVDGCPVY  738



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+LGSI+NIC  D  S NSPWTCP   V FDASVIWGL+ PKR+FG  G Y 
Sbjct  560  TVNLTVAWWLLGSIDNICHQDKFS-NSPWTCPGDHVFFDASVIWGLVSPKRIFGHLGNYS  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP++ WIPLIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  619  ALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGATAFMPPATALNYNSWILVGT  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWG-SELDHCPL  218
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F +  E + + WWG S+ +HC L
Sbjct  679  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVGMEDRSINWWGNSDPEHCDL  738

Query  217  ASCPTAPGIVVEGCPVF  167
            A+CPTA GI + GCP F
Sbjct  739  ATCPTAKGITINGCPTF  755



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 146/196 (74%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  539  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  598

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K FP K WI  IN+PV+    A MPPAT  N   WI+ G+I
Sbjct  599  LNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVI  658

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELK-WWGSELDHCPLA  215
            FNYFVFKY K WWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG++ ++CPLA
Sbjct  659  FNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISINHWWGAKGENCPLA  718

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPG++V+GCPVF
Sbjct  719  SCPTAPGVLVDGCPVF  734



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N AV WW+L  IENIC  + L PNSPWTCP  RV +DASVIWGLIGP R+FG  G Y  
Sbjct  530  LNTAVAWWLLTGIENICQDELLPPNSPWTCPGDRVFYDASVIWGLIGPARIFGRLGNYTA  589

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW L ++FP++KWI LIN+PV+    A MPPAT  N   WIV  + 
Sbjct  590  LNWFFLGGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGSTAAMPPATTVNFNCWIVVAIT  649

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FNYF+FK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L  +   L WWG+  +HCPLA+
Sbjct  650  FNYFIFKFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLTMKEISLNWWGAAGEHCPLAT  709

Query  211  CPTAPGIVVEGCPVF  167
            CPTA G++V+GCPV+
Sbjct  710  CPTAKGVIVDGCPVY  724



>emb|CDY69955.1| BnaCnng66090D [Brassica napus]
Length=732

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  537  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGSLGNYPA  596

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G V PV VW+L K FP + WI  IN+PV+    A MPPAT  N   WI+ G++
Sbjct  597  LNWFFLGGLVGPVLVWLLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVV  656

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKEL-KWWGSELDHCPLA  215
            FNYFVFK  K WWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG+E ++CPLA
Sbjct  657  FNYFVFKNYKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIGHWWGAEGENCPLA  716

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPG+ VEGCPVF
Sbjct  717  SCPTAPGVHVEGCPVF  732



>gb|KDP41519.1| hypothetical protein JCGZ_15926 [Jatropha curcas]
Length=441

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 143/200 (72%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L SI++IC    L  NSPWTCP  +V FDASVIWGL+GP+R+FG  G Y 
Sbjct  242  TINLGVAWWLLTSIDHICQDTLLPSNSPWTCPSDQVFFDASVIWGLVGPRRIFGSLGEYP  301

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VWV  K FP + WIPLIN+PV+    A MPPA+  N  SWI+ G 
Sbjct  302  ALNWCFLGGFLGPVIVWVFHKAFPSQSWIPLINLPVLLGATAMMPPASSINYTSWILIGT  361

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+F+F+YRKGWWQ+YNYVLSAALDAG AFMAVL++  L   +  + WWG++ D    H
Sbjct  362  IFNFFIFRYRKGWWQRYNYVLSAALDAGVAFMAVLIYLTLGLGNVNIHWWGADPDIDPEH  421

Query  226  CPLASCPTAPGIVVEGCPVF  167
            CPLASCPTA GI ++GCP F
Sbjct  422  CPLASCPTAKGINIDGCPTF  441



>ref|XP_009118291.1| PREDICTED: oligopeptide transporter 2 [Brassica rapa]
Length=732

 Score =   248 bits (632),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 144/196 (73%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  537  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  596

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G V PV VW+L K FP + WI  IN+PV+    A MPPAT  N   WI+ G++
Sbjct  597  LNWFFLGGLVGPVLVWLLQKAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVV  656

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKEL-KWWGSELDHCPLA  215
            FNYFVFK  K WWQ+YNYVLSAALDAG AFM VLL+F+L      +  WWG+E ++CPLA
Sbjct  657  FNYFVFKNYKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNGISIGHWWGAEGENCPLA  716

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPG+ VEGCPVF
Sbjct  717  SCPTAPGVHVEGCPVF  732



>ref|XP_004953568.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Setaria 
italica]
Length=754

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 148/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL   WW+LGSI++IC +D+L P SPWTCP  RV FDASVIWGL+GP+R+FG  G Y 
Sbjct  557  TVNLGTAWWLLGSIKDIC-SDSLPPESPWTCPSDRVFFDASVIWGLVGPRRIFGSAGNYG  615

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V+ L +M+P ++WIPLIN+PV+    A MPPAT  N  SW++ G 
Sbjct  616  ALNWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGATASMPPATAVNYNSWLLIGT  675

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+Y+K WW +YNY+LSAALDAG AFM V+L+F+L  E+K + WWG+  +HCPLA
Sbjct  676  IFNFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMENKTIDWWGTAGEHCPLA  735

Query  214  SCPTAPGIVV---EGCPVF  167
            SCPTA G+ +     CPVF
Sbjct  736  SCPTAKGMDLGPDSVCPVF  754



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =   248 bits (632),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 145/195 (74%), Gaps = 1/195 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV +W+L SI NIC  D  S +SPWTCP  RV FDASVIWGL GPKR+FG  G+Y 
Sbjct  553  TVNLAVAYWLLNSITNICVDDPQS-DSPWTCPSDRVFFDASVIWGLAGPKRIFGTLGIYG  611

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV PV VWVL K +P++ WI LIN+PV+      MPPAT  N  SWI+ G 
Sbjct  612  AMNWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGATGSMPPATALNYNSWIIVGT  671

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+ ++  E+  + WWG+  +HC LA
Sbjct  672  IFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVGMENISVAWWGTNGEHCDLA  731

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GIVV+GCPV
Sbjct  732  TCPTAKGIVVDGCPV  746



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =   248 bits (632),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 147/197 (75%), Gaps = 2/197 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL+V WW+L SI+NIC  D  S NSPWTCP   V FDASVIWGL+ PKR+FG  G Y 
Sbjct  558  TVNLSVAWWLLDSIDNICHQDKFS-NSPWTCPGDHVFFDASVIWGLVSPKRIFGHLGNYS  616

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K+FP++ WIPLIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  617  ALNWFFLGGMIGPVVVWLLHKLFPKQTWIPLINLPVLLGATAWMPPATALNYNSWILVGT  676

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWG-SELDHCPL  218
            +FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++  E++ + WWG ++ +HC L
Sbjct  677  VFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFSVGMENRSINWWGNNDPEHCDL  736

Query  217  ASCPTAPGIVVEGCPVF  167
            A CPTA GI V+GCP F
Sbjct  737  AYCPTAKGISVDGCPTF  753



>ref|XP_004953567.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Setaria 
italica]
Length=797

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 148/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL   WW+LGSI++IC +D+L P SPWTCP  RV FDASVIWGL+GP+R+FG  G Y 
Sbjct  600  TVNLGTAWWLLGSIKDIC-SDSLPPESPWTCPSDRVFFDASVIWGLVGPRRIFGSAGNYG  658

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V+ L +M+P ++WIPLIN+PV+    A MPPAT  N  SW++ G 
Sbjct  659  ALNWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGATASMPPATAVNYNSWLLIGT  718

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+Y+K WW +YNY+LSAALDAG AFM V+L+F+L  E+K + WWG+  +HCPLA
Sbjct  719  IFNFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMENKTIDWWGTAGEHCPLA  778

Query  214  SCPTAPGIVV---EGCPVF  167
            SCPTA G+ +     CPVF
Sbjct  779  SCPTAKGMDLGPDSVCPVF  797



>dbj|BAB89477.1| isp4 protein-like [Oryza sativa Japonica Group]
 gb|EAZ12783.1| hypothetical protein OsJ_02700 [Oryza sativa Japonica Group]
Length=755

 Score =   248 bits (632),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V +W+LGSI NIC    L  +SPWTCP  RV FDASVIWGL+GP+R+FGP G Y  
Sbjct  557  VNLVVAYWLLGSIPNICQDALLPADSPWTCPNDRVFFDASVIWGLVGPRRIFGPLGNYGA  616

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL GAV PV V++L + FP K WIP+IN+PV+    + MPPAT  N  SW++ G+I
Sbjct  617  LNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGATSYMPPATAVNYNSWLIIGII  676

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E++ + WWG+  +HCPLAS
Sbjct  677  FNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLSMENRSISWWGTAGEHCPLAS  736

Query  211  CPTAPGIVVEG---CPV  170
            CPTA GI +     CPV
Sbjct  737  CPTAKGINLGADSVCPV  753



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+ + W++L ++ NIC  + L PNSPW CP  RV FDASVIWGL+GPKR+FG  G Y 
Sbjct  559  TINIGIAWYLLTTVNNICQDELLPPNSPWMCPNDRVFFDASVIWGLVGPKRIFGDLGNYS  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GAV PV VW+L K FP K WI LIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  619  ALNWCFLGGAVAPVFVWLLHKAFPSKTWIKLINLPVLLGATAAMPPATTLNFNSWILVGT  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAALDAG AFM V+L+F L  E+  + WWGS  ++C LA
Sbjct  679  IFNLFVFRYRKRWWQRYNYVLSAALDAGLAFMGVVLYFCLGVENVSISWWGSNGEYCDLA  738

Query  214  SCPTAPGIVVEGCPV  170
            SCPTA G+ V+GCPV
Sbjct  739  SCPTAKGVAVDGCPV  753



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNL V WW+L SI+NIC  D  S NSPWTCP   V FDASVIWGL+ PKR+FG  G Y 
Sbjct  560  TVNLTVAWWLLDSIDNICHQDKFS-NSPWTCPGDHVFFDASVIWGLVSPKRIFGHLGNYS  618

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + PV VW+L K FP++ WIPLIN+PV+    A MPPAT  N  SWI+ G 
Sbjct  619  ALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGATAMMPPATALNYNSWILVGT  678

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWG-SELDHCPL  218
            IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F +  E + + WWG ++ +HC L
Sbjct  679  IFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVGMEDRSINWWGNTDPEHCDL  738

Query  217  ASCPTAPGIVVEGCPVF  167
            A+CPTA GI ++GCP F
Sbjct  739  ATCPTAKGISIDGCPTF  755



>ref|XP_008646108.1| PREDICTED: oligopeptide transporter 4-like [Zea mays]
 gb|AFW72904.1| hypothetical protein ZEAMMB73_956147 [Zea mays]
Length=758

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +N+   WW+LGSI  IC +D+L P+SPWTCP  RV FDASVIWGL+GP R+FGPGG Y 
Sbjct  562  TINIGTAWWLLGSIHGIC-SDSLPPDSPWTCPNDRVFFDASVIWGLVGPMRIFGPGGNYG  620

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FLIGA  PV V+ L ++FP + WIPLIN+PV+    A MPPAT  N  SW++ G 
Sbjct  621  AVNWFFLIGAAGPVIVYALHRVFPSQSWIPLINLPVLFGATASMPPATAVNYNSWLLVGT  680

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WW +YNY+LSA LDAG AFM VLL+F+L  ++K + WWG+  +HCPLA
Sbjct  681  IFNFFVFRYRKRWWTRYNYILSAGLDAGVAFMGVLLYFSLTMQNKSIDWWGTAGEHCPLA  740

Query  214  SCPTAPGIVVEG--CPVF  167
             CPTA G+ +    CPVF
Sbjct  741  KCPTAKGVDLGDGVCPVF  758



>ref|XP_008677393.1| PREDICTED: oligopeptide transporter 4 isoform X1 [Zea mays]
 gb|ACN26883.1| unknown [Zea mays]
 gb|AFW63464.1| oligopeptide transporter 4 [Zea mays]
Length=760

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDASVIWGL+GP+R+FGP G Y 
Sbjct  564  TVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDASVIWGLVGPRRIFGPDGNYG  622

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    A MPPAT  N  SW++ G 
Sbjct  623  ALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGATAYMPPATAVNYNSWLLVGT  682

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L  ++K + WWG+  +HCPLA
Sbjct  683  VFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMQNKSIDWWGTAGEHCPLA  742

Query  214  SCPTAPGIVVEG--CPVF  167
             CPTA G+ +    CPVF
Sbjct  743  RCPTAKGVDLGDGVCPVF  760



>gb|EYU21027.1| hypothetical protein MIMGU_mgv1a026700mg [Erythranthe guttata]
Length=735

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 141/195 (72%), Gaps = 0/195 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            +VN+AV W++L +IENIC  + L PNS WTCP  RV +DASVIWGL+GPKR FG  G Y 
Sbjct  540  LVNIAVAWYLLTNIENICQDELLPPNSQWTCPNDRVFYDASVIWGLVGPKRFFGTLGNYN  599

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GAV P  VW+L K  P +KWI  +N+P++    A MPPAT  N  SW++ G 
Sbjct  600  ALNWFFLGGAVGPFFVWILHKALPSQKWIKSVNLPILLGATAAMPPATTLNFNSWMLVGT  659

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN FVF+YRK WWQ+YNYVLSAALDAG AFM V L+F L  E   L WWGS+ +HC LA
Sbjct  660  IFNLFVFRYRKAWWQRYNYVLSAALDAGLAFMGVALYFTLGIEEVTLTWWGSKGEHCDLA  719

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA G++V+GCPV
Sbjct  720  TCPTARGVIVDGCPV  734



>ref|XP_002977317.1| hypothetical protein SELMODRAFT_232939 [Selaginella moellendorffii]
 gb|EFJ21321.1| hypothetical protein SELMODRAFT_232939 [Selaginella moellendorffii]
Length=711

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = -3

Query  733  WWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRNLVWLFL  554
            WWML S+ENICDTD L  +SPWTCP   V + ASVIWGLIGPKR+FG  G Y  L W FL
Sbjct  524  WWMLTSVENICDTDKLPADSPWTCPNDSVFYSASVIWGLIGPKRIFGSLGNYSELSWFFL  583

Query  553  IGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLIFNYFVF  374
            +GA+ PV +W+L+K FP  +W+  IN+PVI    + MPPA+  N  SW   GL FNYFV+
Sbjct  584  VGALAPVVLWLLTKAFPRARWLSYINLPVILGATSMMPPASAVNYISWTSVGLFFNYFVY  643

Query  373  KYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLASCPTAPG  194
             YR+ WWQ+YNYVLSAALDAG AFM VLL+FALQ     + WWG++  HCPLA CPT PG
Sbjct  644  TYRRRWWQRYNYVLSAALDAGVAFMGVLLYFALQMNGTSVTWWGND-SHCPLARCPTYPG  702

Query  193  IVVEGCPV  170
            IVV GCPV
Sbjct  703  IVVPGCPV  710



>gb|EAY75055.1| hypothetical protein OsI_02950 [Oryza sativa Indica Group]
Length=755

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 146/197 (74%), Gaps = 3/197 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V +W+LGSI NIC    L  +SPWTCP  RV FDASVIWGL+GP+R+FGP G Y  
Sbjct  557  VNLVVAYWLLGSIPNICQDALLPADSPWTCPNDRVFFDASVIWGLVGPRRIFGPLGNYGA  616

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
              W FL GAV PV V++L + FP K WIP+IN+PV+    + MPPAT  N  SW++ G+I
Sbjct  617  FNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGATSYMPPATAVNYNSWLIIGII  676

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLAS  212
            FN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E++ + WWG+  +HCPLAS
Sbjct  677  FNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLSMENRSISWWGTAGEHCPLAS  736

Query  211  CPTAPGIVVEG---CPV  170
            CPTA GI +     CPV
Sbjct  737  CPTAKGINLGADSVCPV  753



>ref|XP_008466652.1| PREDICTED: oligopeptide transporter 4-like [Cucumis melo]
Length=743

 Score =   245 bits (626),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N++V WW+L S++ IC   A S NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  547  INVSVAWWLLSSVDQICHQSA-SSNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYPA  605

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + P  V++L ++FP + WIPLIN+PV+    A MPPA P N  SWI+ G I
Sbjct  606  LNWFFLAGILGPSLVYLLHRIFPNQSWIPLINLPVLFGATASMPPAAPINYNSWILVGTI  665

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGS---ELDHCP  221
            FNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ F     +  + WWGS   + DHC 
Sbjct  666  FNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFTFGVRNVHMNWWGSNPIDTDHCL  725

Query  220  LASCPTAPGIVVEGCPVF  167
            LASCPTA G+VV+GCPVF
Sbjct  726  LASCPTAKGVVVDGCPVF  743



>dbj|BAD94325.1| hypothetical protein [Arabidopsis thaliana]
Length=308

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 141/198 (71%), Gaps = 2/198 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
            VV     WW++  I ++CDT  L  +S WTCP  RV FDASVIWGL+GP+R+FG  G Y 
Sbjct  111  VVYTGTAWWLMEEIPHLCDTSLLPSDSQWTCPMDRVFFDASVIWGLVGPRRVFGDLGEYS  170

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
            N+ W FL+GA+ P+ VW+ +KMFP + WI  I+IPV+    A MPPAT  N  SW++   
Sbjct  171  NVNWFFLVGAIAPLLVWLATKMFPAQTWIAKIHIPVLVGATAMMPPATAVNFTSWLIVAF  230

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGS--ELDHCP  221
            IF +F+FKYR+ WW KYNYVLS  LDAG+AFM +LLF AL  +  E++WWG+  + D CP
Sbjct  231  IFGHFIFKYRRVWWTKYNYVLSGGLDAGSAFMTILLFLALGRKGIEVQWWGNSGDRDTCP  290

Query  220  LASCPTAPGIVVEGCPVF  167
            LASCPTA G+VV+GCPVF
Sbjct  291  LASCPTAKGVVVKGCPVF  308



>ref|XP_006472404.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=755

 Score =   245 bits (625),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L S+E+IC    L  NSPWTCP  RV FDASVIWGL+GP+R+FG  G Y 
Sbjct  555  TINLIVAWWLLNSVEHICQPGLLPKNSPWTCPNDRVFFDASVIWGLVGPRRIFGSQGNYG  614

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL G + P  VW+L K FP + WIPLIN+PV+    A MPPAT  N  +WI+ G 
Sbjct  615  ALNWFFLGGLLGPCAVWLLHKKFPNQSWIPLINLPVLLGATAYMPPATALNYNAWILVGT  674

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VLL+ +L  E   L WWGS  D    H
Sbjct  675  IFNFFVFRYRKKWWQRYNYILSAALDAGTAFMTVLLYVSLGLEGVNLHWWGSNPDIDPEH  734

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LA+CPTA G+ V+GCPVF
Sbjct  735  CDLATCPTAKGVAVDGCPVF  754



>ref|XP_006433763.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
 gb|ESR47003.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
Length=728

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             +NL V WW+L S+E+IC    L  NSPWTCP  RV FDASVIWGL+GP+R+FG  G Y 
Sbjct  528  TINLIVAWWLLNSVEHICQPGLLPKNSPWTCPNDRVFFDASVIWGLVGPRRIFGSQGNYG  587

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W F+ G + P  VW+L K FP + WIPLIN+PV+    A MPPAT  N  +WI+ G 
Sbjct  588  ALNWFFVGGLLGPCAVWLLHKKFPNQSWIPLINLPVLLGATAYMPPATALNYNAWILVGT  647

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----H  227
            IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VLL+ +L  E   L WWGS  D    H
Sbjct  648  IFNFFVFRYRKKWWQRYNYILSAALDAGTAFMTVLLYVSLGLEGVNLHWWGSNPDIDPEH  707

Query  226  CPLASCPTAPGIVVEGCPVF  167
            C LA+CPTA G+ V+GCPVF
Sbjct  708  CDLATCPTAKGVAVDGCPVF  727



>ref|XP_004164894.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=743

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N++V WW+L S++ IC     S NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  547  INVSVAWWLLSSVDQICHQSP-SSNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYPA  605

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + P  V++L ++FP + WIPLIN+PV+    A MPPATP N  SWI+ G +
Sbjct  606  LNWFFLAGLLGPSLVYLLHRIFPNQSWIPLINLPVLFGATASMPPATPINYNSWILVGTV  665

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGS---ELDHCP  221
            FNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ FA       + WWGS   + DHC 
Sbjct  666  FNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFAFGVRDVHMNWWGSNPIDTDHCL  725

Query  220  LASCPTAPGIVVEGCPVF  167
            LASCPTA G+V +GCPVF
Sbjct  726  LASCPTAKGVVADGCPVF  743



>ref|XP_004136414.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 gb|KGN60283.1| hypothetical protein Csa_3G893330 [Cucumis sativus]
Length=743

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            +N++V WW+L S++ IC     S NSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  547  INVSVAWWLLSSVDQICHQSP-SSNSPWTCPGDRVFFDASVIWGLVGPKRIFGSQGNYPA  605

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + P  V++L ++FP + WIPLIN+PV+    A MPPATP N  SWI+ G +
Sbjct  606  LNWFFLAGLLGPSLVYLLHRIFPNQSWIPLINLPVLFGATASMPPATPINYNSWILVGTV  665

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGS---ELDHCP  221
            FNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ FA       + WWGS   + DHC 
Sbjct  666  FNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFAFGVRDVHMNWWGSNPIDTDHCL  725

Query  220  LASCPTAPGIVVEGCPVF  167
            LASCPTA G+V +GCPVF
Sbjct  726  LASCPTAKGVVADGCPVF  743



>ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
 gb|ESQ35869.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
Length=731

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 142/196 (72%), Gaps = 1/196 (1%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G Y  
Sbjct  536  VNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGRLGNYPA  595

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + P+ VW+L + FP + WI  IN+PV+    A MPPAT  N   WI+ G++
Sbjct  596  LNWFFLGGLIGPILVWLLQRAFPTRTWISQINLPVLLGATAAMPPATSVNFNCWIIVGVV  655

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKEL-KWWGSELDHCPLA  215
            FNYFVFK  K WWQ+YNYVLSAALDAG A M VLL+F+L      +  WWGS  ++CPLA
Sbjct  656  FNYFVFKNYKKWWQRYNYVLSAALDAGLAIMGVLLYFSLTMNGISIGNWWGSNGENCPLA  715

Query  214  SCPTAPGIVVEGCPVF  167
            SCPTAPGI VEGCPVF
Sbjct  716  SCPTAPGIHVEGCPVF  731



>ref|XP_008348885.1| PREDICTED: oligopeptide transporter 4-like [Malus domestica]
Length=253

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 139/195 (71%), Gaps = 1/195 (1%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV  W+L SI+N+C  D  S +SPWTCP  RV FDAS IWGL GPK +FG  G Y 
Sbjct  59   TVNLAVAHWLLNSIKNMCVDDPHS-DSPWTCPNDRVFFDASXIWGLAGPKXIFGSLGNYG  117

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             + W FL GAV PV VWV  K +P++ WI LIN+PV+      MPPAT  N  SWI+ G 
Sbjct  118  AMNWFFLGGAVGPVIVWVXHKAYPKQHWIRLINLPVLLGATGLMPPATALNYNSWIIVGT  177

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPLA  215
            IFN+FVF+YRK WWQ+YN +LSAA+DAG AFM VLL+ ++  E+K L WWG+  +HC LA
Sbjct  178  IFNFFVFRYRKNWWQRYNXILSAAMDAGVAFMXVLLYLSVGMENKSLTWWGANGEHCDLA  237

Query  214  SCPTAPGIVVEGCPV  170
            +CPTA GI V+GCPV
Sbjct  238  TCPTAKGIAVDGCPV  252



>ref|XP_010064240.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=748

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  751  VNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYRN  572
            VNL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIWGL+GPKR+FG  G+Y+ 
Sbjct  550  VNLGVAWWLLDSITNICHKNVLPPNSPWTCPSDRVFFDASVIWGLVGPKRIFGSEGVYKA  609

Query  571  LVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGLI  392
            L W FL G + PV VW+L K F ++ WIPLIN+PV+    A MPPAT  N  SWIV G I
Sbjct  610  LNWFFLGGLLGPVAVWLLHKSFRKQSWIPLINLPVLLGATAAMPPATALNYNSWIVVGTI  669

Query  391  FNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELD----HC  224
            FN+F+F+YRK WWQ+YNY+LSAALDAG AFMAV+++FA   E + L WWGS  D    HC
Sbjct  670  FNFFIFRYRKRWWQRYNYILSAALDAGVAFMAVVIYFAFGIEDRNLHWWGSNPDVDPEHC  729

Query  223  PLASCPTAPGIVVEGCPVF  167
             LA+CPTA GI ++GCPVF
Sbjct  730  GLATCPTAKGISIDGCPVF  748



>gb|KHG27447.1| Oligopeptide transporter 2 -like protein [Gossypium arboreum]
Length=237

 Score =   230 bits (586),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 129/179 (72%), Gaps = 0/179 (0%)
 Frame = -3

Query  754  VVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKRLFGPGGLYR  575
             VNLAV WW+L ++EN+C    L PNSPWTCP  RV FDASVIWGL+GPKR+F P G Y 
Sbjct  59   TVNLAVAWWLLTTVENVCQDHLLPPNSPWTCPCDRVFFDASVIWGLVGPKRIFSPLGNYS  118

Query  574  NLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTNIGSWIVTGL  395
             L W FL GA+ PV VW+  K FP +KWIPL N+PV+    A MPPAT  N   W++ G 
Sbjct  119  ALNWFFLGGALGPVVVWLFHKAFPNQKWIPLTNLPVLLGATAAMPPATSLNFNCWLIIGF  178

Query  394  IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWGSELDHCPL  218
            IFNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L      + WWGS+ +HC L
Sbjct  179  IFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLTMHGISISWWGSDGEHCDL  237



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260