BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026P24

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010248257.1|  PREDICTED: uncharacterized protein LOC104591167    100   3e-22   Nelumbo nucifera [Indian lotus]
gb|KDP43239.1|  hypothetical protein JCGZ_22791                         101   3e-22   Jatropha curcas
ref|XP_007213836.1|  hypothetical protein PRUPE_ppa010547mg             100   9e-22   Prunus persica
gb|AFK39748.1|  unknown                                               99.8    2e-21   Medicago truncatula
gb|EYU35944.1|  hypothetical protein MIMGU_mgv1a011982mg              99.0    3e-21   Erythranthe guttata [common monkey flower]
ref|XP_008227622.1|  PREDICTED: uncharacterized protein LOC103327113  98.6    4e-21   Prunus mume [ume]
ref|XP_007146324.1|  hypothetical protein PHAVU_006G030700g           97.8    5e-21   Phaseolus vulgaris [French bean]
gb|KHN28150.1|  hypothetical protein glysoja_023968                   97.4    9e-21   Glycine soja [wild soybean]
emb|CDP14460.1|  unnamed protein product                              97.8    1e-20   Coffea canephora [robusta coffee]
ref|NP_001242587.1|  uncharacterized protein LOC100777135             97.4    1e-20   
gb|KHG17577.1|  Protein SCAF11                                        96.3    3e-20   Gossypium arboreum [tree cotton]
gb|KJB83578.1|  hypothetical protein B456_013G253900                  95.9    3e-20   Gossypium raimondii
ref|XP_011009127.1|  PREDICTED: uncharacterized protein LOC105114310  95.9    3e-20   Populus euphratica
ref|XP_011004228.1|  PREDICTED: uncharacterized protein LOC105110764  95.9    3e-20   Populus euphratica
gb|KDO54837.1|  hypothetical protein CISIN_1g025685mg                 94.0    7e-20   Citrus sinensis [apfelsine]
gb|KDO54836.1|  hypothetical protein CISIN_1g025685mg                 95.1    7e-20   Citrus sinensis [apfelsine]
ref|XP_006379115.1|  hypothetical protein POPTR_0009s07480g           95.9    7e-20   
ref|XP_006446281.1|  hypothetical protein CICLE_v10016417mg           94.7    8e-20   Citrus clementina [clementine]
ref|XP_008803342.1|  PREDICTED: uncharacterized protein LOC103716...  94.0    8e-20   
ref|XP_008803341.1|  PREDICTED: uncharacterized protein LOC103716...  94.4    1e-19   Phoenix dactylifera
ref|XP_009624918.1|  PREDICTED: uncharacterized protein LOC104115...  94.4    1e-19   Nicotiana tomentosiformis
ref|XP_009790741.1|  PREDICTED: uncharacterized protein LOC104238...  93.6    1e-19   Nicotiana sylvestris
ref|XP_009790732.1|  PREDICTED: uncharacterized protein LOC104238...  94.4    1e-19   Nicotiana sylvestris
ref|XP_009624919.1|  PREDICTED: uncharacterized protein LOC104115...  94.4    1e-19   Nicotiana tomentosiformis
gb|EAY77270.1|  hypothetical protein OsI_05243                        93.2    1e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002530900.1|  protein binding protein, putative                94.4    1e-19   Ricinus communis
ref|XP_007015290.1|  RING/U-box superfamily protein isoform 2         94.0    2e-19   
ref|XP_007015289.1|  RING/U-box superfamily protein isoform 1         94.0    2e-19   
ref|XP_009796422.1|  PREDICTED: uncharacterized protein LOC104243006  94.0    2e-19   Nicotiana sylvestris
ref|XP_009400091.1|  PREDICTED: uncharacterized protein LOC103984324  93.6    2e-19   
gb|EEE56020.1|  hypothetical protein OsJ_04797                        94.0    2e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004250890.1|  PREDICTED: uncharacterized protein LOC101260106  93.2    3e-19   Solanum lycopersicum
ref|XP_011090171.1|  PREDICTED: uncharacterized protein LOC105170929  93.2    3e-19   Sesamum indicum [beniseed]
ref|XP_006356360.1|  PREDICTED: uncharacterized protein LOC102590911  93.2    3e-19   Solanum tuberosum [potatoes]
dbj|BAB64711.1|  RING finger-like protein                             93.6    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011080406.1|  PREDICTED: uncharacterized protein LOC105163664  93.2    3e-19   Sesamum indicum [beniseed]
ref|XP_003556822.1|  PREDICTED: uncharacterized protein LOC100785472  92.4    6e-19   Glycine max [soybeans]
gb|ACU23925.1|  unknown                                               92.0    7e-19   Glycine max [soybeans]
ref|XP_009592376.1|  PREDICTED: uncharacterized protein LOC104089233  92.0    8e-19   Nicotiana tomentosiformis
ref|XP_004291737.1|  PREDICTED: uncharacterized protein LOC101305336  92.0    9e-19   Fragaria vesca subsp. vesca
ref|XP_006645378.1|  PREDICTED: uncharacterized protein LOC102722445  92.0    1e-18   Oryza brachyantha
ref|XP_006470558.1|  PREDICTED: uncharacterized protein LOC102609827  91.7    1e-18   Citrus sinensis [apfelsine]
ref|XP_002299981.2|  hypothetical protein POPTR_0001s28270g           91.3    1e-18   
ref|XP_007146325.1|  hypothetical protein PHAVU_006G030800g           89.0    1e-18   Phaseolus vulgaris [French bean]
ref|XP_009349039.1|  PREDICTED: uncharacterized protein LOC103940...  91.3    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_009349038.1|  PREDICTED: uncharacterized protein LOC103940...  91.3    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_009337048.1|  PREDICTED: uncharacterized protein LOC103929558  90.5    3e-18   Pyrus x bretschneideri [bai li]
gb|KDO54835.1|  hypothetical protein CISIN_1g025685mg                 90.1    4e-18   Citrus sinensis [apfelsine]
ref|XP_010926978.1|  PREDICTED: uncharacterized protein LOC105049116  89.7    5e-18   Elaeis guineensis
ref|XP_008344988.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  89.7    6e-18   
ref|XP_010045057.1|  PREDICTED: uncharacterized protein LOC104433874  87.8    2e-17   Eucalyptus grandis [rose gum]
gb|KCW87218.1|  hypothetical protein EUGRSUZ_B03731                   87.0    2e-17   Eucalyptus grandis [rose gum]
ref|XP_004513944.1|  PREDICTED: uncharacterized protein LOC101496...  87.8    3e-17   
ref|XP_002873563.1|  zinc finger family protein                       87.4    3e-17   
ref|XP_006362753.1|  PREDICTED: uncharacterized protein LOC102579503  87.0    4e-17   Solanum tuberosum [potatoes]
ref|XP_002280104.1|  PREDICTED: uncharacterized protein LOC100260248  87.0    5e-17   Vitis vinifera
gb|KDO54839.1|  hypothetical protein CISIN_1g025685mg                 84.7    6e-17   Citrus sinensis [apfelsine]
ref|XP_009340141.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  85.5    2e-16   
ref|XP_009340142.1|  PREDICTED: uncharacterized protein LOC103932...  84.3    2e-16   
gb|AFK37549.1|  unknown                                               85.1    2e-16   Lotus japonicus
ref|XP_008356335.1|  PREDICTED: uncharacterized protein LOC103420049  84.7    3e-16   
ref|XP_006399745.1|  hypothetical protein EUTSA_v10014482mg           84.0    3e-16   
ref|XP_006399746.1|  hypothetical protein EUTSA_v10014482mg           84.7    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010938563.1|  PREDICTED: uncharacterized protein LOC105057609  84.3    4e-16   Elaeis guineensis
ref|XP_010673753.1|  PREDICTED: uncharacterized protein LOC104890082  83.6    8e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008449664.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  83.2    9e-16   
ref|XP_002456950.1|  hypothetical protein SORBIDRAFT_03g046160        83.6    9e-16   Sorghum bicolor [broomcorn]
ref|XP_008449663.1|  PREDICTED: uncharacterized protein LOC103491...  83.2    1e-15   
ref|NP_568264.1|  RING/U-box superfamily protein                      82.8    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004971302.1|  PREDICTED: uncharacterized protein LOC101754108  82.4    2e-15   Setaria italica
ref|XP_010419820.1|  PREDICTED: uncharacterized protein LOC104705504  81.3    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010453296.1|  PREDICTED: uncharacterized protein LOC104735246  80.9    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_011024967.1|  PREDICTED: E3 ubiquitin-protein ligase RHF1A...  80.5    6e-15   Populus euphratica
emb|CDX70877.1|  BnaC03g09610D                                        80.9    7e-15   
ref|XP_010491989.1|  PREDICTED: uncharacterized protein LOC104769470  80.5    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006286547.1|  hypothetical protein CARUB_v10001792mg           80.5    9e-15   Capsella rubella
ref|XP_004140198.1|  PREDICTED: uncharacterized protein LOC101206...  80.1    9e-15   
gb|KFK25505.1|  hypothetical protein AALP_AA8G123400                  80.1    1e-14   Arabis alpina [alpine rockcress]
ref|XP_008782014.1|  PREDICTED: uncharacterized protein LOC103701648  80.1    1e-14   Phoenix dactylifera
emb|CDX88890.1|  BnaA03g07590D                                        80.1    1e-14   
ref|XP_004140197.1|  PREDICTED: uncharacterized protein LOC101206...  80.1    1e-14   Cucumis sativus [cucumbers]
ref|NP_001148564.1|  LOC100282180                                     80.1    1e-14   Zea mays [maize]
ref|XP_004228498.1|  PREDICTED: uncharacterized protein LOC101258982  79.7    1e-14   Solanum lycopersicum
gb|KHG12965.1|  Protein SCAF11                                        79.7    2e-14   Gossypium arboreum [tree cotton]
tpg|DAA55776.1|  TPA: putative RING zinc finger domain superfamil...  79.7    2e-14   
dbj|BAK01918.1|  predicted protein                                    79.3    3e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006400503.1|  hypothetical protein EUTSA_v10014461mg           79.0    3e-14   Eutrema salsugineum [saltwater cress]
gb|EMS60622.1|  hypothetical protein TRIUR3_12364                     78.2    5e-14   Triticum urartu
gb|EMT03322.1|  hypothetical protein F775_30097                       77.8    5e-14   
ref|XP_010097998.1|  hypothetical protein L484_001486                 77.8    6e-14   
gb|KJB35685.1|  hypothetical protein B456_006G124000                  77.8    7e-14   Gossypium raimondii
ref|XP_009121860.1|  PREDICTED: uncharacterized protein LOC103846649  77.0    1e-13   Brassica rapa
ref|XP_006288184.1|  hypothetical protein CARUB_v10001420mg           77.8    1e-13   
ref|NP_568374.1|  RING/U-box domain-containing protein                76.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60559.1|  hypothetical protein M569_14245                       75.5    3e-13   Genlisea aurea
ref|XP_010555026.1|  PREDICTED: uncharacterized protein LOC104824623  75.9    3e-13   Tarenaya hassleriana [spider flower]
ref|NP_001190339.1|  RING/U-box domain-containing protein             75.9    3e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86745.1|  predicted protein                                    76.3    3e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009131737.1|  PREDICTED: uncharacterized protein LOC103856380  75.9    4e-13   Brassica rapa
emb|CDM86606.1|  unnamed protein product                              75.5    4e-13   Triticum aestivum [Canadian hard winter wheat]
gb|KFK26206.1|  hypothetical protein AALP_AA8G216300                  75.1    6e-13   Arabis alpina [alpine rockcress]
ref|XP_002871884.1|  zinc finger family protein                       75.1    6e-13   
emb|CDX97183.1|  BnaC09g44420D                                        74.7    7e-13   
gb|ABK22142.1|  unknown                                               74.3    1e-12   Picea sitchensis
ref|XP_010493004.1|  PREDICTED: uncharacterized protein LOC104770302  74.3    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_003565098.2|  PREDICTED: uncharacterized protein LOC100841314  75.5    1e-12   
ref|XP_010420744.1|  PREDICTED: uncharacterized protein LOC104706267  74.3    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010454216.1|  PREDICTED: uncharacterized protein LOC104736...  74.3    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010454215.1|  PREDICTED: uncharacterized protein LOC104736...  74.3    1e-12   Camelina sativa [gold-of-pleasure]
emb|CDX78482.1|  BnaA03g03940D                                        73.6    2e-12   
emb|CDX70471.1|  BnaC03g05550D                                        73.2    3e-12   
ref|XP_009131277.1|  PREDICTED: uncharacterized protein LOC103855973  73.2    3e-12   Brassica rapa
ref|XP_006827514.1|  hypothetical protein AMTR_s00009p00186290        70.5    2e-11   Amborella trichopoda
ref|XP_002987496.1|  hypothetical protein SELMODRAFT_446999           70.9    2e-11   Selaginella moellendorffii
ref|XP_002992803.1|  hypothetical protein SELMODRAFT_448908           70.9    2e-11   Selaginella moellendorffii
emb|CDX70467.1|  BnaC03g05510D                                        70.5    3e-11   
ref|XP_001783242.1|  predicted protein                                69.3    3e-11   
gb|KDO54838.1|  hypothetical protein CISIN_1g025685mg                 67.8    7e-11   Citrus sinensis [apfelsine]
gb|KDO54834.1|  hypothetical protein CISIN_1g025685mg                 68.2    9e-11   Citrus sinensis [apfelsine]
gb|EYU46200.1|  hypothetical protein MIMGU_mgv1a013031mg              62.4    2e-08   Erythranthe guttata [common monkey flower]
tpg|DAA55777.1|  TPA: putative RING zinc finger domain superfamil...  54.7    2e-06   
gb|ACN35218.1|  unknown                                               54.3    3e-06   Zea mays [maize]
tpg|DAA55775.1|  TPA: putative RING zinc finger domain superfamil...  55.1    1e-05   
ref|XP_010097999.1|  hypothetical protein L484_001487                 52.4    4e-05   



>ref|XP_010248257.1| PREDICTED: uncharacterized protein LOC104591167 [Nelumbo nucifera]
Length=200

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevdd---yvddfylydgfedeeddldeay  504
            GSI+DYMFEESVCLLLRASWF PL V  ++   D+     +  Y Y+  ++E+DDLDE Y
Sbjct  54   GSIHDYMFEESVCLLLRASWFTPLAVEVQEEVYDEFDDLYEYQYEYEYEDEEDDDLDEGY  113

Query  503  fDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            F SSSSIR+GNRRWGDNGYVRAGR+EARPVNR NF+D+ AG
Sbjct  114  FISSSSIRIGNRRWGDNGYVRAGRKEARPVNRENFQDNGAG  154



>gb|KDP43239.1| hypothetical protein JCGZ_22791 [Jatropha curcas]
Length=246

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+PL+V E     DD    +Y Y+  +++EDDLDE Y   
Sbjct  103  GSIQDYMFEESVCLLLRAPWFKPLIVEEHHNVYDDLEYYYYPYEYEDEDEDDLDEVYLSR  162

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS++R+GNRRWGDNGYVRAGRQEARPV+RPN +DS AG
Sbjct  163  SSNLRIGNRRWGDNGYVRAGRQEARPVHRPNPQDSGAG  200



>ref|XP_007213836.1| hypothetical protein PRUPE_ppa010547mg [Prunus persica]
 gb|EMJ15035.1| hypothetical protein PRUPE_ppa010547mg [Prunus persica]
Length=245

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRA WF+PL+V E +   DD  D +Y Y+  ED++ D       S
Sbjct  104  GSIHDYMFEESVCLLLRAKWFEPLIVEEREDVYDDPDDYYYPYEDEEDDDLDEAYFS--S  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSSIR+GNRRWGDNGYVR GRQEARPVNR N EDS A
Sbjct  162  SSSIRIGNRRWGDNGYVRGGRQEARPVNRSNIEDSGA  198



>gb|AFK39748.1| unknown [Medicago truncatula]
Length=244

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+PL V E   E D Y +    Y  FE+++D  DE Y+  
Sbjct  99   GSIRDYMFEESVCLLLRAQWFKPLTVEERVVEEDIYEELVDYYYQFENDDDLDDEDYYGG  158

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            S+S+R+GNRRWGDNG+VRAGRQEARPV+RP+F+DS A
Sbjct  159  SASVRIGNRRWGDNGFVRAGRQEARPVHRPSFQDSGA  195



>gb|EYU35944.1| hypothetical protein MIMGU_mgv1a011982mg [Erythranthe guttata]
Length=265

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRASWF+PLVVVE +   ++  D +Y Y+  E+E+ D +     S
Sbjct  117  GSIHDYMFEESVCLLLRASWFKPLVVVEHKVVDEEIEDYYYEYEDDEEEDLDDEVYLGGS  176

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVN-RPNFEDS  390
            SSS+R+GNRRWGDNGYVR GRQEARPV  RPN +DS
Sbjct  177  SSSLRIGNRRWGDNGYVRGGRQEARPVVYRPNLQDS  212



>ref|XP_008227622.1| PREDICTED: uncharacterized protein LOC103327113 [Prunus mume]
Length=245

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRA WF+PL+V E +   DD  D +Y Y+  ED++ D       S
Sbjct  104  GSIHDYMFEESVCLLLRAKWFEPLIVEEREDVYDDPDDYYYPYEDEEDDDLDEAYFS--S  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSSIR+GNRRWGDNGYVR GRQEARPV+R N EDS A
Sbjct  162  SSSIRIGNRRWGDNGYVRGGRQEARPVHRSNIEDSGA  198



>ref|XP_007146324.1| hypothetical protein PHAVU_006G030700g [Phaseolus vulgaris]
 gb|ESW18318.1| hypothetical protein PHAVU_006G030700g [Phaseolus vulgaris]
Length=234

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF+PL V E     D Y +    Y   ++E ++        
Sbjct  100  GSIQDYMFEESVCLLLRASWFKPLSVEEHVVHEDAYEELEEYYPYEDEEMEEAYYG---G  156

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSS+R+GNRRWGDNGYVR GRQEARPV+R NF+DS A
Sbjct  157  SSSVRIGNRRWGDNGYVRGGRQEARPVHRSNFQDSGA  193



>gb|KHN28150.1| hypothetical protein glysoja_023968 [Glycine soja]
Length=251

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF PL V E     D Y D    Y   +D++DD  +  +  
Sbjct  105  GSIQDYMFEESVCLLLRASWFTPLSVEEHVVHEDAYEDLEDYYQYEDDDDDDDMDEVYYG  164

Query  494  -SSSIR-LGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
             SSS+R +GNRRWGDNGYVRAGRQEARPV+RPNF+DS A
Sbjct  165  GSSSLRVIGNRRWGDNGYVRAGRQEARPVHRPNFQDSGA  203



>emb|CDP14460.1| unnamed protein product [Coffea canephora]
Length=277

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 83/98 (85%), Gaps = 1/98 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRA+W++PL +VEE+ EV+D +  FY Y   ++EE+++DE YF  
Sbjct  131  GSIHDYMFEESVCLLLRATWYKPL-IVEERDEVEDDMGYFYSYAYEDEEEEEMDEIYFGG  189

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SSSIR+GNRRWGDNGYVRAGRQEARP+ RPN +DS AG
Sbjct  190  SSSIRIGNRRWGDNGYVRAGRQEARPIPRPNTQDSGAG  227



>ref|NP_001242587.1| uncharacterized protein LOC100777135 [Glycine max]
 gb|ACU23961.1| unknown [Glycine max]
Length=251

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF PL V E     D Y D    Y   +D++DD  +  +  
Sbjct  105  GSIQDYMFEESVCLLLRASWFTPLSVEEHVVHEDAYEDLEDYYQYEDDDDDDDMDEVYYG  164

Query  494  -SSSIR-LGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
             SSS+R +GNRRWGDNGYVRAGRQEARPV+RPNF+DS A
Sbjct  165  GSSSLRVIGNRRWGDNGYVRAGRQEARPVHRPNFQDSGA  203



>gb|KHG17577.1| Protein SCAF11 [Gossypium arboreum]
Length=246

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DYMFEESVCLLLRA+WF+PL+V+EE+ EV D ++ +Y Y  +EDE+D+ DE Y+ +
Sbjct  102  GRIHDYMFEESVCLLLRATWFKPLIVLEEREEVYDNLESYYDYYPYEDEDDEEDEVYYTN  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  390
            S S+R+GNRRWGD+GYVR+GRQEARPV R NF+DS
Sbjct  162  SPSLRIGNRRWGDSGYVRSGRQEARPVQRSNFQDS  196



>gb|KJB83578.1| hypothetical protein B456_013G253900 [Gossypium raimondii]
Length=246

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DYMFEESVCLLLRA+WF+PL+V+EE+ EV D ++ +Y Y  +EDE+D+ DE Y+ +
Sbjct  102  GRIHDYMFEESVCLLLRATWFKPLIVLEEREEVYDNLESYYDYYPYEDEDDEEDEVYYTN  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  390
            S S+R+GNRRWGD+GYVR+GRQEARPV R NF+DS
Sbjct  162  SPSLRIGNRRWGDSGYVRSGRQEARPVQRSNFQDS  196



>ref|XP_011009127.1| PREDICTED: uncharacterized protein LOC105114310 [Populus euphratica]
Length=245

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeay---  504
            GSI DYMFEESVCLLLRA+WF PL V + +   +D  D +     +E E++  D+     
Sbjct  98   GSIQDYMFEESVCLLLRAAWFVPLTVEDHEDFYEDPDDYYPYEYEYEYEDESEDDDLDGV  157

Query  503  -fDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
               SSS++R+GNRRWGDNGYVR+GRQEARPV+R NF+DS AG
Sbjct  158  YLSSSSNLRIGNRRWGDNGYVRSGRQEARPVHRSNFDDSGAG  199



>ref|XP_011004228.1| PREDICTED: uncharacterized protein LOC105110764 [Populus euphratica]
Length=245

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 74/102 (73%), Gaps = 4/102 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeay---  504
            GSI DYMFEESVCLLLRA+WF PL V + +   +D  D +     +E E++D D+     
Sbjct  98   GSIQDYMFEESVCLLLRAAWFVPLTVEDHEDFYEDPDDYYPYEYEYEYEDEDEDDDLDGV  157

Query  503  -fDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
               SSS++R+GNRRWGDNGYVR+GRQEARPV+R NF+DS AG
Sbjct  158  YLSSSSNLRIGNRRWGDNGYVRSGRQEARPVHRSNFDDSGAG  199



>gb|KDO54837.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=195

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA+WF+PL+V +     DD  DD+   D  +D ++        S
Sbjct  49   GSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFR----S  104

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSS+R+GNRRWGDNGYVRAGRQEARPV RPN +D  A
Sbjct  105  SSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGA  141



>gb|KDO54836.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=249

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA+WF+PL+V +     DD  DD+   D  +D ++        S
Sbjct  103  GSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFR----S  158

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSS+R+GNRRWGDNGYVRAGRQEARPV RPN +D  A
Sbjct  159  SSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGA  195



>ref|XP_006379115.1| hypothetical protein POPTR_0009s07480g [Populus trichocarpa]
 gb|ERP56912.1| hypothetical protein POPTR_0009s07480g [Populus trichocarpa]
Length=345

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = -1

Query  671  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddlde--ayfD  498
            SI DYMFEESVCLLLRA+WF PL V + +   +D  D +     +E E++D D    Y  
Sbjct  15   SIQDYMFEESVCLLLRAAWFMPLTVEDHEDFYEDPDDYYPYEYEYEYEDEDDDLDGVYLS  74

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SSS++R+GNRRWGDNGYVRAGRQEARPV+R NF+DS AG
Sbjct  75   SSSNLRIGNRRWGDNGYVRAGRQEARPVHRSNFDDSGAG  113



>ref|XP_006446281.1| hypothetical protein CICLE_v10016417mg [Citrus clementina]
 gb|ESR59521.1| hypothetical protein CICLE_v10016417mg [Citrus clementina]
Length=247

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 70/97 (72%), Gaps = 4/97 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA+WF+PL+V +     DD  DD+   D  +D ++        S
Sbjct  103  GSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFR----S  158

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSS+R+GNRRWGDNGYVRAGRQEARPV RPN +D  A
Sbjct  159  SSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGA  195



>ref|XP_008803342.1| PREDICTED: uncharacterized protein LOC103716918 isoform X2 [Phoenix 
dactylifera]
Length=193

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeay-fD  498
            G I+DYMFEESVCLLLRA+WF PL V  ++    +  D    YD  +D++D++DE+Y   
Sbjct  49   GCIHDYMFEESVCLLLRATWFVPLTVQTQEEASAEPHDYAQYYDDQDDDDDEIDESYYIG  108

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             SSSIR+GNRRWGDNGYVRAGR+EARPVNR   +DS AG
Sbjct  109  GSSSIRIGNRRWGDNGYVRAGRKEARPVNRQFLDDSGAG  147



>ref|XP_008803341.1| PREDICTED: uncharacterized protein LOC103716918 isoform X1 [Phoenix 
dactylifera]
Length=250

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeay-fD  498
            G I+DYMFEESVCLLLRA+WF PL V  ++    +  D    YD  +D++D++DE+Y   
Sbjct  106  GCIHDYMFEESVCLLLRATWFVPLTVQTQEEASAEPHDYAQYYDDQDDDDDEIDESYYIG  165

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             SSSIR+GNRRWGDNGYVRAGR+EARPVNR   +DS AG
Sbjct  166  GSSSIRIGNRRWGDNGYVRAGRKEARPVNRQFLDDSGAG  204



>ref|XP_009624918.1| PREDICTED: uncharacterized protein LOC104115903 isoform X1 [Nicotiana 
tomentosiformis]
Length=247

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ DYMFEESVCLLLRASWF+PL+V E     DD  D +      E++  +       S
Sbjct  104  GSLRDYMFEESVCLLLRASWFKPLIVEERAEVNDDMDDLYMYDYEEEEDLAEDYFVS--S  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS +R+GNRRWGDNGYV AGRQEARPV RPN ++S AG
Sbjct  162  SSRLRIGNRRWGDNGYVSAGRQEARPVYRPNSQESSAG  199



>ref|XP_009790741.1| PREDICTED: uncharacterized protein LOC104238141 isoform X2 [Nicotiana 
sylvestris]
Length=220

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF+PL+V E+Q   D+    +   D  E+  D        S
Sbjct  78   GSIQDYMFEESVCLLLRASWFRPLIVEEKQEVDDNMDYLYAYEDEDEELADFYFN----S  133

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS +R+GNRRWGDNGYVRAGRQEA PV RPN +D  AG
Sbjct  134  SSHLRIGNRRWGDNGYVRAGRQEAMPVPRPNSQDVGAG  171



>ref|XP_009790732.1| PREDICTED: uncharacterized protein LOC104238141 isoform X1 [Nicotiana 
sylvestris]
Length=246

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 68/98 (69%), Gaps = 4/98 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF+PL+V E+Q   D+    +   D  E+  D        S
Sbjct  104  GSIQDYMFEESVCLLLRASWFRPLIVEEKQEVDDNMDYLYAYEDEDEELADFYFN----S  159

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS +R+GNRRWGDNGYVRAGRQEA PV RPN +D  AG
Sbjct  160  SSHLRIGNRRWGDNGYVRAGRQEAMPVPRPNSQDVGAG  197



>ref|XP_009624919.1| PREDICTED: uncharacterized protein LOC104115903 isoform X2 [Nicotiana 
tomentosiformis]
Length=246

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ DYMFEESVCLLLRASWF+PL+V E     DD  D +      E++  +       S
Sbjct  103  GSLRDYMFEESVCLLLRASWFKPLIVEERAEVNDDMDDLYMYDYEEEEDLAEDYFVS--S  160

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS +R+GNRRWGDNGYV AGRQEARPV RPN ++S AG
Sbjct  161  SSRLRIGNRRWGDNGYVSAGRQEARPVYRPNSQESSAG  198



>gb|EAY77270.1| hypothetical protein OsI_05243 [Oryza sativa Indica Group]
Length=188

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -1

Query  671  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS-  495
            SI+DYMFEESVCLLLRA+WF+PL+V   +  +D+             E+D  +EAY+ S 
Sbjct  18   SIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEEELYHIYQYDDGVEDDLDEEAYYMSR  77

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            S SIR+GNRRWGDNGYVR GR+EARPV+R +  D+DAG
Sbjct  78   SPSIRIGNRRWGDNGYVRGGRKEARPVSRQSLNDTDAG  115



>ref|XP_002530900.1| protein binding protein, putative [Ricinus communis]
 gb|EEF31476.1| protein binding protein, putative [Ricinus communis]
Length=253

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 2/100 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayf--  501
            GSI DYMFEESVCLLLRA+WF PL+V   +   DD  D +    G +D++D+ D A    
Sbjct  107  GSIQDYMFEESVCLLLRAAWFNPLIVESHEDAYDDLDDYYVYEYGDDDDDDEDDLADVYL  166

Query  500  DSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             SSS++R+GNR+WGDNGYVR+GRQEARP  RPN +DS AG
Sbjct  167  SSSSNLRIGNRKWGDNGYVRSGRQEARPAYRPNVQDSGAG  206



>ref|XP_007015290.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY32909.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=239

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I DYMFEESVCLLLRA+WF+PL+V + +   DD  D +   +  + +E         S
Sbjct  101  GRINDYMFEESVCLLLRAAWFEPLIVEDREELYDDLEDYYPYEEDDDQDEAYYA-----S  155

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            S S+R+GNRRWGDNGYVR+GRQEARPV R NF+DS AG
Sbjct  156  SPSLRIGNRRWGDNGYVRSGRQEARPVQRSNFQDSGAG  193



>ref|XP_007015289.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY32908.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=240

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 69/98 (70%), Gaps = 5/98 (5%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I DYMFEESVCLLLRA+WF+PL+V + +   DD  D +   +  + +E         S
Sbjct  102  GRINDYMFEESVCLLLRAAWFEPLIVEDREELYDDLEDYYPYEEDDDQDEAYYA-----S  156

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            S S+R+GNRRWGDNGYVR+GRQEARPV R NF+DS AG
Sbjct  157  SPSLRIGNRRWGDNGYVRSGRQEARPVQRSNFQDSGAG  194



>ref|XP_009796422.1| PREDICTED: uncharacterized protein LOC104243006 [Nicotiana sylvestris]
Length=246

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ DYMFEESVCLLLRASWF+PL+V E     DD  D +      E++  +       S
Sbjct  104  GSLQDYMFEESVCLLLRASWFKPLIVEERAEVDDDMDDLYMYDYEEEEDLAEDYFVS--S  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS +R+GNRRWGDNGYV AGRQEARPV RPN ++S AG
Sbjct  162  SSRLRIGNRRWGDNGYVSAGRQEARPVYRPNSQESGAG  199



>ref|XP_009400091.1| PREDICTED: uncharacterized protein LOC103984324 [Musa acuminata 
subsp. malaccensis]
Length=240

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 3/101 (3%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddy---vddfylydgfedeeddldeay  504
            GSI DYMFEESVCLLLRASWF PL V  ++ EV +      + +L + +EDE DDLDE+Y
Sbjct  94   GSIQDYMFEESVCLLLRASWFVPLAVQAQREEVQEDGFDELEDFLQNEYEDELDDLDESY  153

Query  503  fDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            F S SSIR+GNRRWGDNGYVR GR+EARPVN  +F+D DAG
Sbjct  154  FASRSSIRIGNRRWGDNGYVRTGRKEARPVNLQSFDDEDAG  194



>gb|EEE56020.1| hypothetical protein OsJ_04797 [Oryza sativa Japonica Group]
Length=269

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DYMFEESVCLLLRA+WF+PL+V   +  +D+             E+D  +EAY+ S
Sbjct  98   GCIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEEELYHIYQYDDGVEDDLDEEAYYMS  157

Query  494  -SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             S SIR+GNRRWGDNGYVR GR+EARPV+R +  D+DAG
Sbjct  158  RSPSIRIGNRRWGDNGYVRGGRKEARPVSRQSLNDTDAG  196



>ref|XP_004250890.1| PREDICTED: uncharacterized protein LOC101260106 [Solanum lycopersicum]
Length=245

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ DYMFEESVCLLLRASWF+PL+V E+    DD  D +   D  +D  +D   +   S
Sbjct  104  GSLQDYMFEESVCLLLRASWFKPLIVEEKTEIDDDMDDMYMYDDADDDFTEDYFIS---S  160

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS +R+GNRRWGDNGYV AGRQEARPV RPN ++S AG
Sbjct  161  SSRLRIGNRRWGDNGYVSAGRQEARPVYRPNPQESGAG  198



>ref|XP_011090171.1| PREDICTED: uncharacterized protein LOC105170929 [Sesamum indicum]
Length=239

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 71/98 (72%), Gaps = 5/98 (5%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G +YDY FEESVCLLLRASWF+P+VVVE +   +D  D +Y  +  + EE  L      S
Sbjct  100  GRVYDYTFEESVCLLLRASWFKPMVVVEREEVDEDLYDFYYEDEEEDLEEVYLG-----S  154

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS IR+GNRRWGDNGYVRAGRQEARPV R + +DS AG
Sbjct  155  SSGIRIGNRRWGDNGYVRAGRQEARPVCRQHLQDSGAG  192



>ref|XP_006356360.1| PREDICTED: uncharacterized protein LOC102590911 [Solanum tuberosum]
Length=245

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ DYMFEESVCLLLRASWF+PL+V E+    DD  D +   D  +D  +D   +   S
Sbjct  104  GSLQDYMFEESVCLLLRASWFKPLIVEEKTEIDDDMDDLYMYDDADDDFTEDYFIS---S  160

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS +R+GNRRWGDNGYV AGRQEARPV RPN ++S AG
Sbjct  161  SSRLRIGNRRWGDNGYVSAGRQEARPVYRPNPQESGAG  198



>dbj|BAB64711.1| RING finger-like protein [Oryza sativa Japonica Group]
 dbj|BAB90773.1| RING finger-like protein [Oryza sativa Japonica Group]
 dbj|BAG89633.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DYMFEESVCLLLRA+WF+PL+V   +  +D+             E+D  +EAY+ S
Sbjct  109  GCIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEEELYHIYQYDDGVEDDLDEEAYYMS  168

Query  494  -SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             S SIR+GNRRWGDNGYVR GR+EARPV+R +  D+DAG
Sbjct  169  RSPSIRIGNRRWGDNGYVRGGRKEARPVSRQSLNDTDAG  207



>ref|XP_011080406.1| PREDICTED: uncharacterized protein LOC105163664 [Sesamum indicum]
Length=251

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = -1

Query  671  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  492
            SI+DYMFEESVCLLLRA+WF+PLV VE++   +    ++   +   DE          SS
Sbjct  114  SIHDYMFEESVCLLLRAAWFKPLVEVEKEEMFEVEEYEYDDEEDDLDEVYLG------SS  167

Query  491  SSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             S+R+GNRRWGDNGYVRAGRQEARP+ RP+  D+ AG
Sbjct  168  PSLRIGNRRWGDNGYVRAGRQEARPIVRPSVLDAGAG  204



>ref|XP_003556822.1| PREDICTED: uncharacterized protein LOC100785472 [Glycine max]
 gb|KHN12078.1| hypothetical protein glysoja_044903 [Glycine soja]
Length=247

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF PL V E     D Y D    Y   +D++ D       S
Sbjct  104  GSIQDYMFEESVCLLLRASWFTPLSVEEHVAHEDVYEDLEDYYQYEDDDDMDEAYYGGSS  163

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            +  + +GNRRWGDNGYVRAGRQEARPV+R NF+DS A
Sbjct  164  NLRV-IGNRRWGDNGYVRAGRQEARPVHRLNFQDSGA  199



>gb|ACU23925.1| unknown [Glycine max]
Length=247

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF PL V E     D Y D    Y   +D++ D       S
Sbjct  104  GSIQDYMFEESVCLLLRASWFTPLSVEEHVAHEDVYEDLEDYYQYEDDDDMDEAYYGGSS  163

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            +  + +GNRRWGDNGYVRAGRQEARPV+R NF+DS A
Sbjct  164  NLRV-IGNRRWGDNGYVRAGRQEARPVHRLNFQDSGA  199



>ref|XP_009592376.1| PREDICTED: uncharacterized protein LOC104089233 [Nicotiana tomentosiformis]
Length=247

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF PL+V E+Q   D+    +   D  E+ E         S
Sbjct  104  GSIQDYMFEESVCLLLRASWFNPLIVEEKQEVDDNMDYLYAYEDEDEELEHFYFT----S  159

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS  R+GNRRWGDNGYVRAGRQEA PV RPN +D  AG
Sbjct  160  SSHPRIGNRRWGDNGYVRAGRQEATPVPRPNSQDFGAG  197



>ref|XP_004291737.1| PREDICTED: uncharacterized protein LOC101305336 [Fragaria vesca 
subsp. vesca]
Length=248

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 69/98 (70%), Gaps = 2/98 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS++DYMFEESVCLLLRA+WF+PLVV + +        + Y     E+++ D       S
Sbjct  107  GSLHDYMFEESVCLLLRATWFEPLVVEDREDVYAYDDHEDYYPYEDEEDDLDEAYFS--S  164

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SSSIR+GNRRWGDNGYV AGRQEARPV+R N +++ A 
Sbjct  165  SSSIRIGNRRWGDNGYVSAGRQEARPVHRSNIQEAGAS  202



>ref|XP_006645378.1| PREDICTED: uncharacterized protein LOC102722445 [Oryza brachyantha]
Length=278

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DYMFEESVCLLLRA+WF+PL+V   +  +D+         G +DE+D  +EAY+ S
Sbjct  111  GCIHDYMFEESVCLLLRAAWFEPLIVEPHEEALDEEELYHIYQYGDDDEDDLDEEAYYMS  170

Query  494  -SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             S S+R+GNRRWGDNGYVR GR+EARPV+RP+    DAG
Sbjct  171  RSPSVRIGNRRWGDNGYVRGGRKEARPVSRPSLNGVDAG  209



>ref|XP_006470558.1| PREDICTED: uncharacterized protein LOC102609827 [Citrus sinensis]
Length=249

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA+WF+PL+V +     DD  DD+   D  +D ++        S
Sbjct  103  GSISDYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFR----S  158

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSS+R+GNRRWGDNGYVRAGRQEARPV  PN +D  A
Sbjct  159  SSSLRIGNRRWGDNGYVRAGRQEARPVYCPNSQDVGA  195



>ref|XP_002299981.2| hypothetical protein POPTR_0001s28270g [Populus trichocarpa]
 gb|EEE84786.2| hypothetical protein POPTR_0001s28270g [Populus trichocarpa]
Length=240

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF  L V + +   +D  D +      ED++DDLDE Y  S
Sbjct  97   GSIQDYMFEESVCLLLRASWFMTLTVEDHEDVYEDPEDYYPYEFEDEDDDDDLDEVYLSS  156

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS++R+GNRRWGDNGYVRAG QEARPV + +F+DS A
Sbjct  157  SSNLRIGNRRWGDNGYVRAGHQEARPVYQADFKDSGA  193



>ref|XP_007146325.1| hypothetical protein PHAVU_006G030800g, partial [Phaseolus vulgaris]
 gb|ESW18319.1| hypothetical protein PHAVU_006G030800g, partial [Phaseolus vulgaris]
Length=133

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = -1

Query  668  IYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSS  489
            I DYMFEESVCLLLR SWF+PL V E     D Y +    Y   ++E ++        SS
Sbjct  1    IQDYMFEESVCLLLRGSWFKPLSVEEHVVHEDAYEELEEYYPYEDEEMEEAYYG---GSS  57

Query  488  SIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            S+R+GN RWGDNGYVR GRQEARPV+R NF+DS A
Sbjct  58   SVRIGNCRWGDNGYVRGGRQEARPVHRSNFQDSGA  92



>ref|XP_009349039.1| PREDICTED: uncharacterized protein LOC103940614 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009349042.1| PREDICTED: uncharacterized protein LOC103940615 isoform X2 [Pyrus 
x bretschneideri]
Length=243

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+PLVV E +   + + D +Y     EDE+D  D  +  S
Sbjct  101  GSIQDYMFEESVCLLLRAKWFEPLVVEEREEVHEGHEDYYYYPYEDEDEDDLDDAYFS-S  159

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS IR+GNRRWGDNGYVR+GRQEARPV+R   +DS A
Sbjct  160  SSVIRIGNRRWGDNGYVRSGRQEARPVHRSGTQDSGA  196



>ref|XP_009349038.1| PREDICTED: uncharacterized protein LOC103940614 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009349041.1| PREDICTED: uncharacterized protein LOC103940615 isoform X1 [Pyrus 
x bretschneideri]
Length=248

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+PLVV E +   + + D +Y     EDE+D  D  +  S
Sbjct  106  GSIQDYMFEESVCLLLRAKWFEPLVVEEREEVHEGHEDYYYYPYEDEDEDDLDDAYFS-S  164

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS IR+GNRRWGDNGYVR+GRQEARPV+R   +DS A
Sbjct  165  SSVIRIGNRRWGDNGYVRSGRQEARPVHRSGTQDSGA  201



>ref|XP_009337048.1| PREDICTED: uncharacterized protein LOC103929558 [Pyrus x bretschneideri]
Length=250

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+PLVV E +   D + D +Y     E+++D  D  +  S
Sbjct  108  GSIQDYMFEESVCLLLRAKWFEPLVVEEREDVYDGHEDYYYYPYEDEEDDDLDDAYFS-S  166

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS IR+GNRRWGDNGYVR GRQEARPV R N +D  A
Sbjct  167  SSVIRIGNRRWGDNGYVRGGRQEARPVRRSNIQDPGA  203



>gb|KDO54835.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=247

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 4/93 (4%)
 Frame = -1

Query  662  DYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSI  483
            DYMFEESVCLLLRA+WF+PL+V +     DD  DD+   D  +D ++        SSSS+
Sbjct  105  DYMFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFR----SSSSL  160

Query  482  RLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            R+GNRRWGDNGYVRAGRQEARPV RPN +D  A
Sbjct  161  RIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGA  193



>ref|XP_010926978.1| PREDICTED: uncharacterized protein LOC105049116 [Elaeis guineensis]
Length=238

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DYMFEESVCLLLRA+WF PL V  ++   ++  D    YD  +D+E D       S
Sbjct  96   GCIHDYMFEESVCLLLRATWFVPLTVETQEEAPEEPEDYAQYYDDQDDDELDESYYISTS  155

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            SS  R+GNRRWGDNGYVRAGR+EARPVNR  F+DS AG
Sbjct  156  SSI-RIGNRRWGDNGYVRAGRKEARPVNRQFFDDSGAG  192



>ref|XP_008344988.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Malus domestica]
Length=250

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+PLVV E +   + + D +      E+++D  D  +  S
Sbjct  108  GSIQDYMFEESVCLLLRAKWFEPLVVEEREDVYEGHEDYYCYPYEDEEDDDLDDAYFS-S  166

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS IR+GNRRWGDNGYVR GRQEARPV R N +D  A
Sbjct  167  SSVIRIGNRRWGDNGYVRGGRQEARPVRRSNIQDPGA  203



>ref|XP_010045057.1| PREDICTED: uncharacterized protein LOC104433874 [Eucalyptus grandis]
 gb|KCW87217.1| hypothetical protein EUGRSUZ_B03731 [Eucalyptus grandis]
Length=244

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA+WF PL V  E           Y  +  ++++D  +  +  +
Sbjct  99   GSIRDYMFEESVCLLLRATWFMPLEVHYEDTYDPLEDYCPYEDEVEDEDDDLEEAYF--N  156

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            S SIR+GNRRWGDNGYVRAGRQEARPV R N +D  A
Sbjct  157  SPSIRIGNRRWGDNGYVRAGRQEARPVYRANPQDEGA  193



>gb|KCW87218.1| hypothetical protein EUGRSUZ_B03731 [Eucalyptus grandis]
Length=194

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA+WF PL V  E           Y  +  ++++D  +  +  +
Sbjct  49   GSIRDYMFEESVCLLLRATWFMPLEVHYEDTYDPLEDYCPYEDEVEDEDDDLEEAYF--N  106

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            S SIR+GNRRWGDNGYVRAGRQEARPV R N +D  A
Sbjct  107  SPSIRIGNRRWGDNGYVRAGRQEARPVYRANPQDEGA  143



>ref|XP_004513944.1| PREDICTED: uncharacterized protein LOC101496939 isoform X1 [Cicer 
arietinum]
 ref|XP_004513945.1| PREDICTED: uncharacterized protein LOC101496939 isoform X2 [Cicer 
arietinum]
Length=252

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+PL V E     D Y +    Y  +E+ +DDLD+  +  
Sbjct  105  GSIQDYMFEESVCLLLRAQWFKPLTVEEHVVHEDIYDEIEDYYYQYEEPDDDLDDEVYYG  164

Query  494  -SSSIRLGNRRWGDNGYVRAGRQEARPV-NRPNFEDSDA  384
             SSS+R+GNRRWGDNG+VRAGRQEARPV +R NF D  A
Sbjct  165  GSSSVRIGNRRWGDNGFVRAGRQEARPVIHRSNFPDPGA  203



>ref|XP_002873563.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49822.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ D+MFEESVCLLLRASWFQPL  VE   + D++  DF +   +EDE+DD  + ++  
Sbjct  100  GSVEDFMFEESVCLLLRASWFQPLEAVERVSDNDNFNYDFDIPPEYEDEDDDDLDEFYMQ  159

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
             SS+RLGNRRWGDNG+VRAGRQEARPV   N
Sbjct  160  GSSLRLGNRRWGDNGFVRAGRQEARPVQHKN  190



>ref|XP_006362753.1| PREDICTED: uncharacterized protein LOC102579503 [Solanum tuberosum]
Length=246

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 5/98 (5%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF+P V  +++ +        Y  D  E E+D        S
Sbjct  106  GSIQDYMFEESVCLLLRASWFKPFVEEKQEVDDYMDFLYAYYEDDEELEDDHFT-----S  160

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
            S S+R+GNRRWG+NGYVR GRQEA P + PN  DS AG
Sbjct  161  SPSLRIGNRRWGNNGYVREGRQEASPAHPPNSHDSGAG  198



>ref|XP_002280104.1| PREDICTED: uncharacterized protein LOC100260248 [Vitis vinifera]
 emb|CBI24239.3| unnamed protein product [Vitis vinifera]
Length=241

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRA+WF+PL+V E++   D+    +       D ++D  +  + +
Sbjct  97   GSIHDYMFEESVCLLLRAAWFKPLIVEEQEDIYDEEEYFYPYEINEVDIDEDDLDEVYYN  156

Query  494  S-SSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
            + SSIR+GNRRWG NGY+RAG QEARPV RPN
Sbjct  157  NLSSIRIGNRRWGTNGYIRAGHQEARPVYRPN  188



>gb|KDO54839.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=141

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = -1

Query  656  MFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSSSSIRL  477
            MFEESVCLLLRA+WF+PL+V +     DD  DD+   D  +D ++        SSSS+R+
Sbjct  1    MFEESVCLLLRATWFKPLIVEDHVVVQDDLEDDYSYEDEEDDLDEVYFR----SSSSLRI  56

Query  476  GNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            GNRRWGDNGYVRAGRQEARPV RPN +D  A
Sbjct  57   GNRRWGDNGYVRAGRQEARPVCRPNSQDVGA  87



>ref|XP_009340141.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X1 
[Pyrus x bretschneideri]
Length=243

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 81/97 (84%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+P +VVEE+ EV +  +D+Y Y   +++EDDLD+AYF S
Sbjct  101  GSIQDYMFEESVCLLLRAKWFEP-LVVEEREEVYEGHEDYYYYPYEDEDEDDLDDAYFSS  159

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS IR+GNRRWGDNGYVR+GRQEARPV+R + +DS A
Sbjct  160  SSVIRIGNRRWGDNGYVRSGRQEARPVHRSSTQDSGA  196



>ref|XP_009340142.1| PREDICTED: uncharacterized protein LOC103932304 isoform X2 [Pyrus 
x bretschneideri]
Length=196

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+  +VVEE+ EV +  +D+Y Y   +++EDDLD+AYF S
Sbjct  54   GSIQDYMFEESVCLLLRAKWFE-PLVVEEREEVYEGHEDYYYYPYEDEDEDDLDDAYFSS  112

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS IR+GNRRWGDNGYVR+GRQEARPV+R + +DS A
Sbjct  113  SSVIRIGNRRWGDNGYVRSGRQEARPVHRSSTQDSGA  149



>gb|AFK37549.1| unknown [Lotus japonicus]
Length=258

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfD-  498
            GSI D MFEESVCLLLRA WF+PL V +     +D + D      +  EEDD D      
Sbjct  107  GSIEDCMFEESVCLLLRAKWFKPLTVEDHVVVHEDTLLDELEDYYYHYEEDDEDLDDAYY  166

Query  497  -SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFED  393
              SSS R+GNRRWGDNGYVRAGRQEARPV+R N ++
Sbjct  167  GGSSSFRIGNRRWGDNGYVRAGRQEARPVHRSNTDN  202



>ref|XP_008356335.1| PREDICTED: uncharacterized protein LOC103420049 [Malus domestica]
 ref|XP_008364421.1| PREDICTED: uncharacterized protein LOC103428102 [Malus domestica]
Length=247

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRA WF+P +VVEE+ EV +  +D+Y Y   ++E+DDLD+AYF S
Sbjct  101  GSIQDYMFEESVCLLLRAKWFEP-LVVEEREEVYEGHEDYYYYPYEDEEDDDLDDAYFSS  159

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SS IR+GNRRWGDNGYVR GRQEARPV+R + +DS A
Sbjct  160  SSVIRIGNRRWGDNGYVRGGRQEARPVHRSSTQDSGA  196



>ref|XP_006399745.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
 gb|ESQ41198.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
Length=196

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ D+MFEESVCLLLRASWFQPL  VE   + D +  DF +   +EDE+DD  + ++  
Sbjct  44   GSVEDFMFEESVCLLLRASWFQPLDAVERVSDNDIHNYDFEIPPEYEDEDDDDLDEFYLH  103

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
             SS+RLGNRRWGDNG+VR+GRQEARPV   +
Sbjct  104  GSSLRLGNRRWGDNGFVRSGRQEARPVQHKH  134



>ref|XP_006399746.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
 gb|ESQ41199.1| hypothetical protein EUTSA_v10014482mg [Eutrema salsugineum]
Length=251

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ D+MFEESVCLLLRASWFQPL  VE   + D +  DF +   +EDE+DD  + ++  
Sbjct  99   GSVEDFMFEESVCLLLRASWFQPLDAVERVSDNDIHNYDFEIPPEYEDEDDDDLDEFYLH  158

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
             SS+RLGNRRWGDNG+VR+GRQEARPV   +
Sbjct  159  GSSLRLGNRRWGDNGFVRSGRQEARPVQHKH  189



>ref|XP_010938563.1| PREDICTED: uncharacterized protein LOC105057609 [Elaeis guineensis]
Length=247

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfy--------lydgfedeedd  519
            G I+DYMFEESVCLLLRA+WF PL V  ++   ++  D             D  +D ++ 
Sbjct  96   GCIHDYMFEESVCLLLRAAWFVPLTVEAQEEASEELEDYTQYYNDQDYADDDNDDDGDEL  155

Query  518  ldeayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             +  Y  SSSSIR+GNRRWGDNGYVRAGR+EARPV + +F+DS AG
Sbjct  156  DESYYISSSSSIRIGNRRWGDNGYVRAGRKEARPVGQRSFDDSGAG  201



>ref|XP_010673753.1| PREDICTED: uncharacterized protein LOC104890082 [Beta vulgaris 
subsp. vulgaris]
Length=270

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvv-----eeqpevddyvddfylydgfedeeddlde  510
            GS++DYMFEES+CLL+RASWF+PLVV       ++ +   Y    Y Y+  +  +DD ++
Sbjct  105  GSLHDYMFEESLCLLVRASWFKPLVVEPYDDFYDELDDIFYYQYQYQYEYGDLGDDDFED  164

Query  509  ayfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
             YF SS S+R+GNRRWGDNGY+ AGRQEARPV+R N ++S A
Sbjct  165  DYFHSSPSLRIGNRRWGDNGYISAGRQEARPVHRSNPQNSGA  206



>ref|XP_008449664.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X2 [Cucumis 
melo]
Length=244

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRASW++PL+  E +   D+  DD Y +   +DEE +        
Sbjct  104  GSIHDYMFEESVCLLLRASWYKPLIFEEREETYDEPEDDQYYHYEDDDEELEDAYLG--E  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNF  399
            S S+R+GNRRWG NGYVRAGRQEARPV R  F
Sbjct  162  SPSLRIGNRRWGYNGYVRAGRQEARPVLRQEF  193



>ref|XP_002456950.1| hypothetical protein SORBIDRAFT_03g046160 [Sorghum bicolor]
 gb|EES02070.1| hypothetical protein SORBIDRAFT_03g046160 [Sorghum bicolor]
Length=278

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 5/99 (5%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++DY+FEESVCLLLRA+WF+PL+V   +  ++D       Y   +DE+D  +E+Y+ S
Sbjct  99   GCLHDYLFEESVCLLLRAAWFEPLIVEAHEEPLEDEEFFDQQYQYDDDEDDLDEESYYMS  158

Query  494  -SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
             SSSIR+GNRRWGDNGY+R GR+EARPVN     D+ AG
Sbjct  159  RSSSIRIGNRRWGDNGYIRGGRKEARPVN----TDASAG  193



>ref|XP_008449663.1| PREDICTED: uncharacterized protein LOC103491476 isoform X1 [Cucumis 
melo]
Length=276

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRASW++PL+  E +   D+  DD Y +   +DEE +        
Sbjct  136  GSIHDYMFEESVCLLLRASWYKPLIFEEREETYDEPEDDQYYHYEDDDEELEDAYLG--E  193

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNF  399
            S S+R+GNRRWG NGYVRAGRQEARPV R  F
Sbjct  194  SPSLRIGNRRWGYNGYVRAGRQEARPVLRQEF  225



>ref|NP_568264.1| RING/U-box superfamily protein [Arabidopsis thaliana]
 emb|CAC42892.1| RING finger-like protein [Arabidopsis thaliana]
 gb|AAM51588.1| AT5g19430/F7K24_180 [Arabidopsis thaliana]
 dbj|BAC42369.1| putative RING finger [Arabidopsis thaliana]
 gb|AED91790.1| RING/U-box superfamily protein [Arabidopsis thaliana]
Length=254

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 68/93 (73%), Gaps = 2/93 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayf--  501
            GS+ D+MFEESVCLLLRASWFQPL  VE   + D++  DF +   +E+E++D D+     
Sbjct  100  GSVEDFMFEESVCLLLRASWFQPLEAVERVSDNDNFNYDFDIPPEYEEEDEDDDDLDEFY  159

Query  500  DSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
               SS+RLGNRRWGDNG+VRAGRQEARPV   N
Sbjct  160  MQGSSLRLGNRRWGDNGFVRAGRQEARPVQHKN  192



>ref|XP_004971302.1| PREDICTED: uncharacterized protein LOC101754108 [Setaria italica]
Length=273

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++DY+FEESVCLLLRA+WF+PL+V   +  +++           ++++ D +  Y   
Sbjct  105  GCLHDYLFEESVCLLLRAAWFEPLIVEPHEEALEEDEFYHQYQYDDDEDDLDEETYYMSR  164

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
            S S R+GNRRWGDNGY+R GR+EARPVN
Sbjct  165  SPSFRIGNRRWGDNGYIRGGRREARPVN  192



>ref|XP_010419820.1| PREDICTED: uncharacterized protein LOC104705504 [Camelina sativa]
Length=253

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 66/93 (71%), Gaps = 2/93 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayf--  501
            GS+ D+MFEESVCLLLRA WFQPL  VE   + D++  DF +   +E E+DD D+     
Sbjct  99   GSVEDFMFEESVCLLLRAVWFQPLEAVERVSDSDNFNYDFDIPPEYEAEDDDDDDLDEFY  158

Query  500  DSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
               SS+RLGNRRWGDNG+VRAGRQEARPV   N
Sbjct  159  LQGSSLRLGNRRWGDNGFVRAGRQEARPVQHKN  191



>ref|XP_010453296.1| PREDICTED: uncharacterized protein LOC104735246 [Camelina sativa]
Length=255

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyv----ddfylydgfedeeddldea  507
            GS+ D+MFEESVCLLLRA WFQPL  VE   + D++              +D++DD    
Sbjct  99   GSVEDFMFEESVCLLLRAVWFQPLEAVERVSDSDNFNYDFDIPPEYEAEDDDDDDDDLNE  158

Query  506  yfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
            ++   SS+RLGNRRWGDNG+VRAGRQEARPV   N
Sbjct  159  FYLQGSSLRLGNRRWGDNGFVRAGRQEARPVQHKN  193



>ref|XP_011024967.1| PREDICTED: E3 ubiquitin-protein ligase RHF1A-like [Populus euphratica]
Length=239

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLL RASWF  + +  E  E      + Y    FEDE+DDLDE Y  S
Sbjct  97   GSIQDYMFEESVCLLRRASWF-VVTLTVEDHEDVYEDPEDYYPYEFEDEDDDLDEVYLSS  155

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
             S++R+GNRRWGDNGYVRAG QEARPV + +F+DS A
Sbjct  156  LSNLRIGNRRWGDNGYVRAGHQEARPVYQAHFKDSGA  192



>emb|CDX70877.1| BnaC03g09610D [Brassica napus]
Length=256

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL V+ EQ                + +EDD  +  +  
Sbjct  103  GSIEDFLFEESVCLLLRASWFIPLDVMVEQASYSYGYHHDDFDIPCDYDEDDDLDELYMH  162

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             S +R+GNRRWGDNG+VR+GRQEARPV +
Sbjct  163  GSGLRIGNRRWGDNGFVRSGRQEARPVKK  191



>ref|XP_010491989.1| PREDICTED: uncharacterized protein LOC104769470 [Camelina sativa]
Length=255

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 63/95 (66%), Gaps = 4/95 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyv----ddfylydgfedeeddldea  507
            GS+ D+MFEESVCLLLRA WFQPL  VE   + D +              ED++DD  + 
Sbjct  99   GSVEDFMFEESVCLLLRAVWFQPLEAVERVSDSDIFNYDFDIPPEYVAEDEDDDDDDLDE  158

Query  506  yfDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
            ++   SS+RLGNRRWGDNG+VRAGRQEARPV   N
Sbjct  159  FYLQGSSLRLGNRRWGDNGFVRAGRQEARPVQHKN  193



>ref|XP_006286547.1| hypothetical protein CARUB_v10001792mg [Capsella rubella]
 gb|EOA19445.1| hypothetical protein CARUB_v10001792mg [Capsella rubella]
Length=252

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeay-fD  498
            GS+ D+MFEESVCLLLRA+WFQPL  VE   + D++  DF +   +E+EEDD D    + 
Sbjct  99   GSVEDFMFEESVCLLLRAAWFQPLEAVERVSDNDNFNYDFDIPPEYEEEEDDDDLDEFYL  158

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
              S++RLGNRRWGDNG+VRAGRQEARPV   N
Sbjct  159  QGSNLRLGNRRWGDNGFVRAGRQEARPVQHKN  190



>ref|XP_004140198.1| PREDICTED: uncharacterized protein LOC101206609 isoform 2 [Cucumis 
sativus]
 ref|XP_004156316.1| PREDICTED: uncharacterized LOC101206609 isoform 2 [Cucumis sativus]
Length=244

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRASW++P   + E+ E      +   Y  +ED++++L++AY   
Sbjct  104  GSIHDYMFEESVCLLLRASWYKP--PIIEEREETYDDPEDDQYYPYEDDDEELEDAYLGE  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNF  399
            S S+R+GNRRWG NGYVRAGRQEARPV R  F
Sbjct  162  SPSLRIGNRRWGYNGYVRAGRQEARPVLRQEF  193



>gb|KFK25505.1| hypothetical protein AALP_AA8G123400 [Arabis alpina]
Length=252

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ D+MFEESVCLLLRASWF PL  V+     D            E+E+DD  E ++  
Sbjct  99   GSVEDFMFEESVCLLLRASWFVPLEAVDRFSGTDTDDFVIPPEYEEEEEDDDEIEEFYMH  158

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
             +  RLGNRRWGDNG+VRAGRQEARPV+  N
Sbjct  159  GAGPRLGNRRWGDNGFVRAGRQEARPVHPKN  189



>ref|XP_008782014.1| PREDICTED: uncharacterized protein LOC103701648 [Phoenix dactylifera]
Length=242

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 3/101 (3%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfy---lydgfedeeddldeay  504
            G I+DYMFEESV LLLRA+WF PL V  ++   ++  D        D  +D ++  +  Y
Sbjct  96   GCIHDYMFEESVWLLLRATWFVPLTVEAQEEASEELEDYARYYNDQDDDDDGDELDESYY  155

Query  503  fDSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDAG  381
              SSSSIR+GNRRWGDNGYVRAGR+EARPV + +F+DS AG
Sbjct  156  ISSSSSIRIGNRRWGDNGYVRAGRKEARPVGQRSFDDSGAG  196



>emb|CDX88890.1| BnaA03g07590D [Brassica napus]
Length=256

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL V+ EQ                + +EDD  + ++  
Sbjct  103  GSIEDFLFEESVCLLLRASWFIPLDVMVEQASYSYGYHHDDFDIPCDYDEDDDLDEFYMH  162

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             S +R+GNRRWGDNG+VR+GRQEARPV +
Sbjct  163  GSGLRIGNRRWGDNGFVRSGRQEARPVKK  191



>ref|XP_004140197.1| PREDICTED: uncharacterized protein LOC101206609 isoform 1 [Cucumis 
sativus]
 ref|XP_004156315.1| PREDICTED: uncharacterized LOC101206609 isoform 1 [Cucumis sativus]
 gb|KGN48101.1| hypothetical protein Csa_6G431760 [Cucumis sativus]
Length=276

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 2/92 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRASW++P   + E+ E      +   Y  +ED++++L++AY   
Sbjct  136  GSIHDYMFEESVCLLLRASWYKP--PIIEEREETYDDPEDDQYYPYEDDDEELEDAYLGE  193

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNF  399
            S S+R+GNRRWG NGYVRAGRQEARPV R  F
Sbjct  194  SPSLRIGNRRWGYNGYVRAGRQEARPVLRQEF  225



>ref|NP_001148564.1| LOC100282180 [Zea mays]
 gb|ACF85780.1| unknown [Zea mays]
 gb|ACG32054.1| zinc finger, C3HC4 type family protein [Zea mays]
 gb|ACL52636.1| unknown [Zea mays]
Length=283

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++DY+FEESVCLLLRA+WF+PL+V   +  +++       Y   +DE+D  +E+Y+ +
Sbjct  106  GCLHDYLFEESVCLLLRAAWFEPLIVEAHEEALEEEEFLHQQYQYDDDEDDLDEESYYMN  165

Query  494  -SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
             S SIR+GNRRWGDNGY+R GR+EARPVN
Sbjct  166  RSPSIRIGNRRWGDNGYIRGGRKEARPVN  194



>ref|XP_004228498.1| PREDICTED: uncharacterized protein LOC101258982 [Solanum lycopersicum]
Length=238

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 54/90 (60%), Gaps = 13/90 (14%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI DYMFEESVCLLLRASWF+P V   +     +  ++   +                S
Sbjct  106  GSIQDYMFEESVCLLLRASWFEPFVEEIDDYMDYEDDEELEDFHVT-------------S  152

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRP  405
            S S+R+ NRRWG+NGYVRAGRQEA P + P
Sbjct  153  SPSLRISNRRWGNNGYVRAGRQEASPAHPP  182



>gb|KHG12965.1| Protein SCAF11 [Gossypium arboreum]
Length=247

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 1/90 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylyd-gfedeeddldeayfD  498
            G I DYMFEESVCLLLRASWF+PL V E +   D      Y      +D++++ DE Y+ 
Sbjct  101  GRINDYMFEESVCLLLRASWFKPLNVEECEVYDDLEDYYHYYPYPCEDDDDEEEDEVYYR  160

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
            SS S+R+GNRRWGDNGYVR+GR+EARPV R
Sbjct  161  SSPSLRIGNRRWGDNGYVRSGRREARPVQR  190



>tpg|DAA55776.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=283

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++DY+FEESVCLLLRA+WF+PL+V   +  +++       Y   +DE+D  +E+Y+ +
Sbjct  106  GCLHDYLFEESVCLLLRAAWFEPLIVEAHEEALEEEEFLHQQYQYDDDEDDLDEESYYMN  165

Query  494  -SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
             S SIR+GNRRWGDNGY+R GR+EARPVN
Sbjct  166  RSPSIRIGNRRWGDNGYIRGGRKEARPVN  194



>dbj|BAK01918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++DYMF+ESVCLLLRA+WF+PLVV       ++            DE+D  +E    S
Sbjct  115  GCLHDYMFDESVCLLLRATWFKPLVVEAHDEAQEEEDIYRSYQYDDGDEDDLYEEYISRS  174

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  390
             S IR+GNRRWGDNGYVR GR+EARPV  P   D+
Sbjct  175  PS-IRIGNRRWGDNGYVRGGRREARPVVIPPAADA  208



>ref|XP_006400503.1| hypothetical protein EUTSA_v10014461mg [Eutrema salsugineum]
 gb|ESQ41956.1| hypothetical protein EUTSA_v10014461mg [Eutrema salsugineum]
Length=255

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL VVE       Y DDF +   +EDE+DDLDE Y   
Sbjct  103  GSIEDFLFEESVCLLLRASWFIPLDVVEHASYSYGYHDDFDIPCEYEDEDDDLDEFYL-H  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
             SS+RLGNRRWGDNG+VR+GRQEARPV + N
Sbjct  162  GSSLRLGNRRWGDNGFVRSGRQEARPVQKYN  192



>gb|EMS60622.1| hypothetical protein TRIUR3_12364 [Triticum urartu]
Length=231

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++DYMF+ESVCLLLRA+WF+PLVV   +   ++            DE+D  +E    S
Sbjct  52   GCLHDYMFDESVCLLLRATWFKPLVVEAHEEAQEEEDIYRSYQYDDGDEDDLYEEYISRS  111

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  390
             S IR+GNRRWGDNGYVR GR+EARPV  P   D+
Sbjct  112  PS-IRIGNRRWGDNGYVRGGRREARPVVIPPVVDA  145



>gb|EMT03322.1| hypothetical protein F775_30097 [Aegilops tauschii]
Length=215

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 62/95 (65%), Gaps = 1/95 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++DYMF+ESVCLLLRA+WF+PLVV   +   ++            DE+D  +E     
Sbjct  44   GCLHDYMFDESVCLLLRATWFKPLVVEAHEEAQEEEDIYRSYQYDDGDEDDLYEEYIS-R  102

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  390
            S SIR+GNRRWGDNGYVR GR+EARPV  P   D+
Sbjct  103  SPSIRIGNRRWGDNGYVRGGRREARPVVIPPVVDA  137



>ref|XP_010097998.1| hypothetical protein L484_001486 [Morus notabilis]
 gb|EXB74316.1| hypothetical protein L484_001486 [Morus notabilis]
Length=242

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRASWF+PL V E+     +  D  +  + + +++ D       S
Sbjct  98   GSIHDYMFEESVCLLLRASWFKPLTVEEQANAYSEIEDFDFFEEEYLEDDLDEVYYRSSS  157

Query  494  SSSIRLGNRRWGDNGYVRAGRQEA--RPVNRPNFED  393
            SS    GNRRWGDNGYVR GRQEA  RPV + NF+D
Sbjct  158  SSIRI-GNRRWGDNGYVRGGRQEARPRPVYQSNFQD  192



>gb|KJB35685.1| hypothetical protein B456_006G124000 [Gossypium raimondii]
Length=248

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddy-vddfylydgfedeeddldeayfD  498
            G I DYMFEESVCLLLRASWF+PL V E +   D      +Y Y   +D++++ DE Y+ 
Sbjct  102  GRINDYMFEESVCLLLRASWFKPLNVEECEVYDDLEGYYHYYPYPCEDDDDEEEDEVYYR  161

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPV  414
            SS S+R+GNRRWGDNGYVR+GR+EARPV
Sbjct  162  SSPSLRIGNRRWGDNGYVRSGRREARPV  189



>ref|XP_009121860.1| PREDICTED: uncharacterized protein LOC103846649 [Brassica rapa]
 emb|CDX69690.1| BnaA10g20390D [Brassica napus]
Length=261

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 64/92 (70%), Gaps = 1/92 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfyly-dgfedeeddldeayfD  498
            GS+ D+MFEESVCLLLRASWF+PL  VE     D    DF +  +  E+E+DD D   F 
Sbjct  101  GSVEDFMFEESVCLLLRASWFKPLEAVERVSYHDIDNYDFDIPPEYEEEEDDDDDLDEFL  160

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
              SS+RLGNRRWGDNG+VR+GRQEARP    +
Sbjct  161  HGSSLRLGNRRWGDNGFVRSGRQEARPAQHKH  192



>ref|XP_006288184.1| hypothetical protein CARUB_v10001420mg [Capsella rubella]
 gb|EOA21082.1| hypothetical protein CARUB_v10001420mg [Capsella rubella]
Length=329

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL VV EQ        D +      +++DD  + ++  
Sbjct  178  GSIEDFLFEESVCLLLRASWFVPLDVVVEQASYSYGYHDDFDIPCDYEDDDDDLDEFYLH  237

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             SS+R+GNRRWG NG+VR+GR+EARPV R
Sbjct  238  GSSLRIGNRRWGGNGFVRSGRREARPVQR  266



>ref|NP_568374.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAK32770.1|AF361602_1 AT5g19430/F7K24_180 [Arabidopsis thaliana]
 gb|AAL15402.1| AT5g19430/F7K24_180 [Arabidopsis thaliana]
 gb|AED92705.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=255

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL VVE+      Y DDF +   +EDE+DDLDE Y   
Sbjct  103  GSIEDFLFEESVCLLLRASWFVPLDVVEQASYSHGYHDDFDIPYDYEDEDDDLDEFYL-H  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             SS+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  162  GSSLRIGNRRWGGNGFVRSGRQEARPVQR  190



>gb|EPS60559.1| hypothetical protein M569_14245, partial [Genlisea aurea]
Length=199

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 60/91 (66%), Gaps = 5/91 (5%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS++DY+ EESVCLLLRASWF P           D VD+      + +E  + DE Y   
Sbjct  106  GSLHDYLHEESVCLLLRASWFNP-----SIVVERDEVDEETEDYYYYEEGAEADEFYLSR  160

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
             SSIR+GNRR+G+ GYVR+GRQEARPVNR N
Sbjct  161  PSSIRIGNRRFGEQGYVRSGRQEARPVNRIN  191



>ref|XP_010555026.1| PREDICTED: uncharacterized protein LOC104824623 [Tarenaya hassleriana]
Length=253

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevd--dyvddfylydgfedeeddldeayf  501
            GSI D+MFEESVCLLLRASWFQPL V E   + D  +Y D    YD   + EDD  + Y+
Sbjct  99   GSIQDFMFEESVCLLLRASWFQPLDVEERVSQDDGFEYFDIPCEYDIPCEYEDDDLDEYY  158

Query  500  DSSSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
               SS+R+GNRRWG +GYVR+GRQEARPV  
Sbjct  159  LCGSSVRIGNRRWGGSGYVRSGRQEARPVQH  189



>ref|NP_001190339.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED92706.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=240

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL VVE+      Y DDF +   +EDE+DDLDE Y   
Sbjct  88   GSIEDFLFEESVCLLLRASWFVPLDVVEQASYSHGYHDDFDIPYDYEDEDDDLDEFYL-H  146

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             SS+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  147  GSSLRIGNRRWGGNGFVRSGRQEARPVQR  175



>dbj|BAJ86745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G ++ YMF+ESVCLLLRA+WF+PLVV       ++            DE+D  +E    S
Sbjct  113  GCLHGYMFDESVCLLLRATWFKPLVVEAHDEAQEEEDIYRSYQYDDGDEDDLYEEYISRS  172

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  390
             S IR+GNRRWGDNGYVR GR+EARPV  P   D+
Sbjct  173  PS-IRIGNRRWGDNGYVRGGRREARPVVIPPAADA  206



>ref|XP_009131737.1| PREDICTED: uncharacterized protein LOC103856380 [Brassica rapa]
Length=257

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylyd-gfedeeddldeayfD  498
            GSI D++FEESVCLLLRASWF PL V+ EQ                  ++ED   + ++ 
Sbjct  103  GSIEDFLFEESVCLLLRASWFIPLDVMVEQASYSYGYHHDDFDIPCDYEDEDADLDEFYL  162

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
              S +R+GNRRWGDNG+VR+GRQEARPV +
Sbjct  163  HGSGLRIGNRRWGDNGFVRSGRQEARPVKK  192



>emb|CDM86606.1| unnamed protein product [Triticum aestivum]
Length=280

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (65%), Gaps = 1/94 (1%)
 Frame = -1

Query  671  SIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDSS  492
             ++DYMF+ESVCLLLRA+WF+PL V   +   ++          + DE+D  +E     S
Sbjct  101  CLHDYMFDESVCLLLRATWFKPLAVEAHEEAQEEEDIYRSYQYDYGDEDDLYEEYIS-RS  159

Query  491  SSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDS  390
             SIR+GNRRWGDNGYVR GR+EARPV  P   D+
Sbjct  160  PSIRIGNRRWGDNGYVRGGRREARPVVIPPVVDA  193



>gb|KFK26206.1| hypothetical protein AALP_AA8G216300 [Arabis alpina]
Length=256

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL V E       Y DDF +   +EDE+DDLDE Y   
Sbjct  105  GSIEDFLFEESVCLLLRASWFLPLDVSELASYSHGYHDDFDIPCDYEDEDDDLDEFYLRG  164

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             S +R+GNRRWGDNG+VR+GRQEARPV +
Sbjct  165  PS-LRIGNRRWGDNGFVRSGRQEARPVKK  192



>ref|XP_002871884.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48143.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL VVE       Y DDF +   +EDE+DDLDE Y   
Sbjct  103  GSIEDFLFEESVCLLLRASWFVPLDVVELASYSYGYHDDFDIPCDYEDEDDDLDEFYL-H  161

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             SS+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  162  GSSLRIGNRRWGGNGFVRSGRQEARPVQR  190



>emb|CDX97183.1| BnaC09g44420D [Brassica napus]
Length=258

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 62/93 (67%), Gaps = 2/93 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfyl--ydgfedeeddldeayf  501
            GS+ D+MFEESVCLLLRASWF+PL  VE     D    DF +      E+++DD D   F
Sbjct  100  GSLEDFMFEESVCLLLRASWFKPLEAVERVSYNDIDNYDFDIPPEYEEEEDDDDDDLDEF  159

Query  500  DSSSSIRLGNRRWGDNGYVRAGRQEARPVNRPN  402
               SS+RLGNRRWGDNG+VR+GRQE RP    +
Sbjct  160  LHGSSLRLGNRRWGDNGFVRSGRQEVRPAQHKH  192



>gb|ABK22142.1| unknown [Picea sitchensis]
Length=249

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 12/87 (14%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS++DYM EES+CLLLRASWF+ L + E   E DDY  +  + + +              
Sbjct  112  GSMHDYMLEESICLLLRASWFELLPLQEAYDEQDDYPYEDEIDEEYY------------G  159

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPV  414
            +S++RLGNRRWGD+GYVRAGR+EARPV
Sbjct  160  TSNVRLGNRRWGDSGYVRAGRKEARPV  186



>ref|XP_010493004.1| PREDICTED: uncharacterized protein LOC104770302 [Camelina sativa]
Length=256

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL V+E+      Y DDF +   +EDE+DDLDE Y   
Sbjct  104  GSIEDFLFEESVCLLLRASWFVPLDVMEQASYSHGYNDDFDIPCDYEDEDDDLDEFYL-H  162

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             +S+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  163  GASLRIGNRRWGGNGFVRSGRQEARPVQR  191



>ref|XP_003565098.2| PREDICTED: uncharacterized protein LOC100841314 [Brachypodium 
distachyon]
Length=354

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DY+F+ESVCLLLRA+WF+PLVV   +  +D+    +  Y   E +EDDL E  +  
Sbjct  185  GCIHDYLFDESVCLLLRATWFEPLVVEPHEEVLDEEEIFYRHYQYEEHDEDDLYEETYYM  244

Query  494  SSS--IRLGNRRWGDNGYVRAGRQEARPVN  411
            S S  +R+GNRRWGDNGY+R GR+EARPV+
Sbjct  245  SRSPIVRIGNRRWGDNGYIRGGRREARPVS  274



>ref|XP_010420744.1| PREDICTED: uncharacterized protein LOC104706267 [Camelina sativa]
 ref|XP_010420745.1| PREDICTED: uncharacterized protein LOC104706267 [Camelina sativa]
Length=254

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL V+E+      Y DD  +   +EDE+DDLDE Y   
Sbjct  104  GSIEDFLFEESVCLLLRASWFIPLDVMEQASYSFGYHDDLDIPCDYEDEDDDLDEFYL-H  162

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             +S+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  163  GASLRIGNRRWGGNGFVRSGRQEARPVQR  191



>ref|XP_010454216.1| PREDICTED: uncharacterized protein LOC104736009 isoform X2 [Camelina 
sativa]
Length=257

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL V+E+      Y DDF +   +EDE+DDLDE Y   
Sbjct  105  GSIEDFLFEESVCLLLRASWFVPLDVMEQTSYSYGYHDDFDIPCDYEDEDDDLDEFYL-H  163

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             +S+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  164  GASLRIGNRRWGGNGFVRSGRQEARPVQR  192



>ref|XP_010454215.1| PREDICTED: uncharacterized protein LOC104736009 isoform X1 [Camelina 
sativa]
Length=260

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI D++FEESVCLLLRASWF PL V+E+      Y DDF +   +EDE+DDLDE Y   
Sbjct  108  GSIEDFLFEESVCLLLRASWFVPLDVMEQTSYSYGYHDDFDIPCDYEDEDDDLDEFYL-H  166

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVNR  408
             +S+R+GNRRWG NG+VR+GRQEARPV R
Sbjct  167  GASLRIGNRRWGGNGFVRSGRQEARPVQR  195



>emb|CDX78482.1| BnaA03g03940D [Brassica napus]
Length=264

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevdd------yvddfylydgfedeeddld  513
            GS+ D+MFEESVCLLLRASWF PL  VE      +         ++   +  E++++D  
Sbjct  99   GSVEDFMFEESVCLLLRASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDDEDDL  158

Query  512  eayfDSSSSIRLGNRRWGDNGYVRAGRQEARP  417
            + ++   S++RLGNRRWGDNG+VR+GRQEARP
Sbjct  159  DEFYLHGSNLRLGNRRWGDNGFVRSGRQEARP  190



>emb|CDX70471.1| BnaC03g05550D [Brassica napus]
Length=265

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevdd------yvddfylydgfedeeddld  513
            GS+ D+MFEESVCLLLRASWF PL  VE      +         ++   +  E++EDD  
Sbjct  99   GSVEDFMFEESVCLLLRASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDEDDDL  158

Query  512  eayfDSSSSIRLGNRRWGDNGYVRAGRQEARP  417
            + ++   S++RLGNRRWGDNG+VR+GRQEARP
Sbjct  159  DEFYLHGSNLRLGNRRWGDNGFVRSGRQEARP  190



>ref|XP_009131277.1| PREDICTED: uncharacterized protein LOC103855973 [Brassica rapa]
 ref|XP_009131278.1| PREDICTED: uncharacterized protein LOC103855973 [Brassica rapa]
Length=264

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevdd------yvddfylydgfedeeddld  513
            GS+ D+MFEESVCLLLRASWF PL  VE      +         ++   +  E++++D  
Sbjct  99   GSVEDFMFEESVCLLLRASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDDEDDL  158

Query  512  eayfDSSSSIRLGNRRWGDNGYVRAGRQEARP  417
            + ++   S++RLGNRRWGDNG+VR+GRQEARP
Sbjct  159  DEFYLHGSNLRLGNRRWGDNGFVRSGRQEARP  190



>ref|XP_006827514.1| hypothetical protein AMTR_s00009p00186290 [Amborella trichopoda]
 gb|ERM94930.1| hypothetical protein AMTR_s00009p00186290 [Amborella trichopoda]
Length=227

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G I+DYMFEESVCLLLRA W+ P+ +  ++  +++  +  Y YD  +D  +D       +
Sbjct  85   GRIHDYMFEESVCLLLRAPWYTPVTLETQKEAIEEQEEHQYEYDDVDDYVEDAFYG---N  141

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARP-VNRPNFEDSDAG  381
             + +R+GNRRWGD GYVRAGR+EA P V R      +AG
Sbjct  142  MAGLRIGNRRWGDGGYVRAGRKEAMPIVERARSHGQEAG  180



>ref|XP_002987496.1| hypothetical protein SELMODRAFT_446999 [Selaginella moellendorffii]
 gb|EFJ11332.1| hypothetical protein SELMODRAFT_446999 [Selaginella moellendorffii]
Length=268

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 9/88 (10%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G + D+M EESVCLLLR++WF+PL     Q   D            E+            
Sbjct  135  GRMSDFMVEESVCLLLRSTWFKPLPPAAAQEPEDVEDYQDEDELYEEEYY---------Y  185

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
            +S++RLGNRRWGD+GYVR GR+EARPV+
Sbjct  186  TSNVRLGNRRWGDSGYVRGGRKEARPVS  213



>ref|XP_002992803.1| hypothetical protein SELMODRAFT_448908 [Selaginella moellendorffii]
 gb|EFJ06093.1| hypothetical protein SELMODRAFT_448908 [Selaginella moellendorffii]
Length=268

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 9/88 (10%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            G + D+M EESVCLLLR++WF+PL     Q   D            E+            
Sbjct  135  GRMSDFMVEESVCLLLRSTWFKPLPPAAAQEPEDVEDYQDEDELYEEEYY---------Y  185

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
            +S++RLGNRRWGD+GYVR GR+EARPV+
Sbjct  186  TSNVRLGNRRWGDSGYVRGGRKEARPVS  213



>emb|CDX70467.1| BnaC03g05510D [Brassica napus]
Length=264

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevdd------yvddfylydgfedeeddld  513
            GS+ D+MFEESVCLLL ASWF PL  VE      +         ++   +  E++++D  
Sbjct  99   GSVEDFMFEESVCLLLCASWFLPLEAVERVSYNGNDNYDFDIPPEYIPPEYEEEDDEDDL  158

Query  512  eayfDSSSSIRLGNRRWGDNGYVRAGRQEARP  417
            + ++   S++RLGNRRWGDNG+VR+GRQEARP
Sbjct  159  DEFYLHGSNLRLGNRRWGDNGFVRSGRQEARP  190



>ref|XP_001783242.1| predicted protein [Physcomitrella patens]
 gb|EDQ51937.1| predicted protein, partial [Physcomitrella patens]
Length=190

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 13/87 (15%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GS+ DY+ EESVCLLLRASWF+ + V  +  E +DY +D    D +              
Sbjct  58   GSLNDYLIEESVCLLLRASWFEGMPVFAQPEEPEDYYEDEEFDDYYF-------------  104

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPV  414
             S++R+GNRRWGDNGYVRAGR+EARPV
Sbjct  105  KSNVRIGNRRWGDNGYVRAGRREARPV  131



>gb|KDO54838.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=152

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -1

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSSS+R+GNRRWGDNGYVRAGRQEARPV RPN +D  A
Sbjct  61   SSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGA  98



>gb|KDO54834.1| hypothetical protein CISIN_1g025685mg [Citrus sinensis]
Length=224

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -1

Query  497  SSSSIRLGNRRWGDNGYVRAGRQEARPVNRPNFEDSDA  384
            SSSS+R+GNRRWGDNGYVRAGRQEARPV RPN +D  A
Sbjct  133  SSSSLRIGNRRWGDNGYVRAGRQEARPVCRPNSQDVGA  170



>gb|EYU46200.1| hypothetical protein MIMGU_mgv1a013031mg [Erythranthe guttata]
Length=232

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 6/75 (8%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPLvvveeqpevddyvddfylydgfedeeddldeayfDS  495
            GSI+DYMFEESVCLLLRASWF P+       EV+  V D      ++DEE+DL+  YF++
Sbjct  116  GSIHDYMFEESVCLLLRASWFNPI------VEVEKEVVDKVEAYYYDDEEEDLNGFYFNN  169

Query  494  SSSIRLGNRRWGDNG  450
            SSS+R+GNRRWGDNG
Sbjct  170  SSSVRIGNRRWGDNG  184



>tpg|DAA55777.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=120

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
            S SIR+GNRRWGDNGY+R GR+EARPVN
Sbjct  4    SPSIRIGNRRWGDNGYIRGGRKEARPVN  31



>gb|ACN35218.1| unknown [Zea mays]
Length=127

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
            S SIR+GNRRWGDNGY+R GR+EARPVN
Sbjct  11   SPSIRIGNRRWGDNGYIRGGRKEARPVN  38



>tpg|DAA55775.1| TPA: putative RING zinc finger domain superfamily protein, partial 
[Zea mays]
Length=292

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  494  SSSIRLGNRRWGDNGYVRAGRQEARPVN  411
            S SIR+GNRRWGDNGY+R GR+EARPVN
Sbjct  176  SPSIRIGNRRWGDNGYIRGGRKEARPVN  203



>ref|XP_010097999.1| hypothetical protein L484_001487 [Morus notabilis]
 gb|EXB74317.1| hypothetical protein L484_001487 [Morus notabilis]
Length=210

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -1

Query  674  GSIYDYMFEESVCLLLRASWFQPL  603
            GSI+DYMFEESVCLLLRASWF+PL
Sbjct  146  GSIHDYMFEESVCLLLRASWFKPL  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600