BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026N19

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002266672.1|  PREDICTED: probable aspartyl aminopeptidase ...    236   3e-70   Vitis vinifera
ref|XP_004249975.1|  PREDICTED: probable aspartyl aminopeptidase        234   9e-70   Solanum lycopersicum
ref|XP_006361458.1|  PREDICTED: probable aspartyl aminopeptidase-...    234   9e-70   Solanum tuberosum [potatoes]
ref|XP_003591777.1|  Aspartyl aminopeptidase                            227   1e-69   
ref|XP_009596186.1|  PREDICTED: probable aspartyl aminopeptidase        234   1e-69   Nicotiana tomentosiformis
ref|XP_009802964.1|  PREDICTED: probable aspartyl aminopeptidase        234   2e-69   Nicotiana sylvestris
ref|XP_003591778.1|  Aspartyl aminopeptidase                            227   7e-69   
ref|XP_007213437.1|  hypothetical protein PRUPE_ppa025466mg             230   1e-68   
ref|XP_008375605.1|  PREDICTED: probable aspartyl aminopeptidase        227   3e-68   
emb|CDO99897.1|  unnamed protein product                                231   4e-68   Coffea canephora [robusta coffee]
gb|KJB78672.1|  hypothetical protein B456_013G012600                    229   7e-68   Gossypium raimondii
gb|KHG01889.1|  Aspartyl aminopeptidase                                 229   1e-67   Gossypium arboreum [tree cotton]
ref|XP_011076920.1|  PREDICTED: probable aspartyl aminopeptidase ...    228   2e-67   
ref|XP_009336015.1|  PREDICTED: probable aspartyl aminopeptidase ...    228   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_008347038.1|  PREDICTED: probable aspartyl aminopeptidase        228   3e-67   
ref|XP_008232012.1|  PREDICTED: probable aspartyl aminopeptidase        228   3e-67   Prunus mume [ume]
ref|XP_009336013.1|  PREDICTED: probable aspartyl aminopeptidase ...    228   4e-67   Pyrus x bretschneideri [bai li]
gb|KDO42030.1|  hypothetical protein CISIN_1g009941mg                   224   4e-67   Citrus sinensis [apfelsine]
ref|XP_011076919.1|  PREDICTED: probable aspartyl aminopeptidase ...    228   5e-67   Sesamum indicum [beniseed]
ref|XP_007010329.1|  Zn-dependent exopeptidases superfamily prote...    227   5e-67   
ref|XP_010244532.1|  PREDICTED: probable aspartyl aminopeptidase ...    226   8e-67   Nelumbo nucifera [Indian lotus]
gb|AES62027.2|  aspartyl aminopeptidase-like protein, putative          226   9e-67   Medicago truncatula
gb|KDO42028.1|  hypothetical protein CISIN_1g009941mg                   225   1e-66   Citrus sinensis [apfelsine]
gb|KCW51474.1|  hypothetical protein EUGRSUZ_J00993                     222   1e-66   Eucalyptus grandis [rose gum]
ref|XP_010694702.1|  PREDICTED: probable aspartyl aminopeptidase ...    225   2e-66   
ref|XP_010088778.1|  Aspartyl aminopeptidase                            226   2e-66   Morus notabilis
ref|XP_003591776.1|  Aspartyl aminopeptidase                            226   2e-66   
gb|KDO42027.1|  hypothetical protein CISIN_1g009941mg                   225   2e-66   Citrus sinensis [apfelsine]
ref|XP_010694701.1|  PREDICTED: probable aspartyl aminopeptidase ...    226   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006436620.1|  hypothetical protein CICLE_v10031166mg             225   2e-66   
tpg|DAA55692.1|  TPA: hypothetical protein ZEAMMB73_277076              215   3e-66   
ref|XP_006485213.1|  PREDICTED: probable aspartyl aminopeptidase-...    225   4e-66   Citrus sinensis [apfelsine]
ref|XP_004150844.1|  PREDICTED: probable aspartyl aminopeptidase-...    225   4e-66   
gb|KGN52197.1|  hypothetical protein Csa_5G615200                       225   4e-66   
ref|XP_006436621.1|  hypothetical protein CICLE_v10031166mg             225   5e-66   
ref|XP_007143804.1|  hypothetical protein PHAVU_007G103100g             224   6e-66   Phaseolus vulgaris [French bean]
ref|XP_008446766.1|  PREDICTED: probable aspartyl aminopeptidase        224   9e-66   Cucumis melo [Oriental melon]
ref|XP_004496198.1|  PREDICTED: probable aspartyl aminopeptidase-...    224   9e-66   
gb|KHN00906.1|  Aspartyl aminopeptidase                                 223   2e-65   Glycine soja [wild soybean]
ref|XP_003556268.2|  PREDICTED: probable aspartyl aminopeptidase-...    223   3e-65   Glycine max [soybeans]
ref|XP_010032079.1|  PREDICTED: probable aspartyl aminopeptidase ...    223   3e-65   Eucalyptus grandis [rose gum]
gb|EMT26810.1|  Aspartyl aminopeptidase                                 216   6e-65   
ref|XP_010543610.1|  PREDICTED: probable aspartyl aminopeptidase        222   7e-65   Tarenaya hassleriana [spider flower]
ref|XP_002311031.2|  hypothetical protein POPTR_0008s02250g             221   7e-65   
ref|XP_009356123.1|  PREDICTED: probable aspartyl aminopeptidase        222   7e-65   Pyrus x bretschneideri [bai li]
ref|XP_002311016.2|  hypothetical protein POPTR_0008s02250g             221   1e-64   
ref|XP_011032849.1|  PREDICTED: probable aspartyl aminopeptidase        220   2e-64   Populus euphratica
ref|XP_003565148.1|  PREDICTED: probable aspartyl aminopeptidase        220   3e-64   Brachypodium distachyon [annual false brome]
ref|XP_010907134.1|  PREDICTED: probable aspartyl aminopeptidase ...    218   3e-64   
ref|XP_006645339.1|  PREDICTED: probable aspartyl aminopeptidase-...    220   3e-64   Oryza brachyantha
ref|NP_001045513.1|  Os01g0967900                                       219   4e-64   
emb|CDX70207.1|  BnaA10g25560D                                          219   5e-64   
ref|XP_006398926.1|  hypothetical protein EUTSA_v10013255mg             219   6e-64   Eutrema salsugineum [saltwater cress]
ref|XP_008674488.1|  PREDICTED: probable aspartyl aminopeptidase        216   7e-64   
emb|CDY44874.1|  BnaC09g50740D                                          219   8e-64   Brassica napus [oilseed rape]
ref|XP_009122574.1|  PREDICTED: probable aspartyl aminopeptidase        219   9e-64   Brassica rapa
gb|EYU19780.1|  hypothetical protein MIMGU_mgv1a004147mg                218   2e-63   Erythranthe guttata [common monkey flower]
dbj|BAJ86698.1|  predicted protein                                      218   2e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC72239.1|  hypothetical protein OsI_05355                          217   2e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_010907133.1|  PREDICTED: probable aspartyl aminopeptidase ...    218   2e-63   Elaeis guineensis
ref|XP_006287486.1|  hypothetical protein CARUB_v10000697mg             217   4e-63   Capsella rubella
gb|KDP35783.1|  hypothetical protein JCGZ_10419                         217   4e-63   Jatropha curcas
ref|XP_010490993.1|  PREDICTED: probable aspartyl aminopeptidase        216   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002457006.1|  hypothetical protein SORBIDRAFT_03g047100          216   1e-62   Sorghum bicolor [broomcorn]
ref|XP_004971394.1|  PREDICTED: probable aspartyl aminopeptidase-...    216   1e-62   Setaria italica
ref|XP_004971395.1|  PREDICTED: probable aspartyl aminopeptidase-...    215   1e-62   
gb|KFK24913.1|  hypothetical protein AALP_AA8G041200                    215   2e-62   Arabis alpina [alpine rockcress]
ref|XP_002873165.1|  hypothetical protein ARALYDRAFT_487250             215   2e-62   
ref|NP_196091.1|  Zn-dependent exopeptidases superfamily protein        215   3e-62   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43404.1|  putative aspartyl aminopeptidase                       215   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788174.1|  PREDICTED: probable aspartyl aminopeptidase        214   4e-62   Phoenix dactylifera
ref|XP_010423546.1|  PREDICTED: probable aspartyl aminopeptidase        214   4e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002524995.1|  Aspartyl aminopeptidase, putative                  214   6e-62   Ricinus communis
ref|XP_010452373.1|  PREDICTED: probable aspartyl aminopeptidase        213   9e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009390025.1|  PREDICTED: probable aspartyl aminopeptidase        212   4e-61   
gb|KHN37829.1|  Aspartyl aminopeptidase                                 208   5e-60   Glycine soja [wild soybean]
gb|EPS58587.1|  aspartyl aminopeptidase                                 201   1e-57   Genlisea aurea
ref|XP_006851486.1|  hypothetical protein AMTR_s00040p00143220          202   2e-57   
ref|XP_002975004.1|  hypothetical protein SELMODRAFT_442726             194   1e-54   
ref|XP_002977420.1|  hypothetical protein SELMODRAFT_176342             192   2e-54   
dbj|BAD94988.1|  aspartyl aminopeptidase                                178   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001420830.1|  predicted protein                                  189   7e-53   Ostreococcus lucimarinus CCE9901
ref|XP_001751765.1|  predicted protein                                  185   1e-51   
gb|ABR25597.1|  aspartyl aminopeptidase                                 176   1e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_003082377.1|  aspartyl aminopeptidase (ISS)                      183   1e-50   
ref|XP_008360788.1|  PREDICTED: probable aspartyl aminopeptidase        176   1e-50   
ref|XP_011024060.1|  PREDICTED: probable aspartyl aminopeptidase        183   1e-50   Populus euphratica
emb|CEF99925.1|  Peptidase M18                                          184   1e-50   Ostreococcus tauri
dbj|BAK02635.1|  predicted protein                                      174   3e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008464464.1|  PREDICTED: probable aspartyl aminopeptidase ...    181   6e-50   Cucumis melo [Oriental melon]
ref|XP_002318119.2|  aspartyl aminopeptidase family protein             181   1e-49   
ref|XP_011044185.1|  PREDICTED: probable aspartyl aminopeptidase        180   1e-49   Populus euphratica
ref|XP_002963681.1|  hypothetical protein SELMODRAFT_80579              180   1e-49   
ref|XP_004165826.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    180   2e-49   
ref|XP_004138058.1|  PREDICTED: probable aspartyl aminopeptidase-...    180   2e-49   
ref|XP_002974770.1|  hypothetical protein SELMODRAFT_101663             179   3e-49   
gb|KGN63496.1|  hypothetical protein Csa_1G002160                       180   3e-49   
ref|XP_002511215.1|  Aspartyl aminopeptidase, putative                  178   3e-49   
ref|XP_002321687.1|  aspartyl aminopeptidase family protein             179   4e-49   Populus trichocarpa [western balsam poplar]
gb|KFK26680.1|  hypothetical protein AALP_AA8G278900                    179   5e-49   Arabis alpina [alpine rockcress]
ref|XP_010536640.1|  PREDICTED: probable aspartyl aminopeptidase        179   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_008239439.1|  PREDICTED: probable aspartyl aminopeptidase        179   6e-49   Prunus mume [ume]
sp|B9RAJ0.2|DNPEP_RICCO  RecName: Full=Probable aspartyl aminopep...    179   6e-49   Ricinus communis
ref|XP_009134060.1|  PREDICTED: probable aspartyl aminopeptidase        178   8e-49   Brassica rapa
emb|CDY34036.1|  BnaC03g27790D                                          178   8e-49   Brassica napus [oilseed rape]
emb|CDX83160.1|  BnaA03g23460D                                          178   8e-49   
ref|NP_200824.1|  zn-dependent exopeptidases superfamily protein        177   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61631.1|  aspartyl aminopeptidase-like protein                    177   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866374.1|  hypothetical protein ARALYDRAFT_332278             177   1e-48   Arabidopsis lyrata subsp. lyrata
ref|NP_001066463.1|  Os12g0236500                                       177   2e-48   
ref|XP_007209960.1|  hypothetical protein PRUPE_ppa004869mg             177   2e-48   Prunus persica
tpg|DAA58400.1|  TPA: hypothetical protein ZEAMMB73_107325              173   3e-48   
gb|AFK46082.1|  unknown                                                 176   3e-48   Lotus japonicus
gb|EYU43065.1|  hypothetical protein MIMGU_mgv1a005789mg                176   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_006664453.1|  PREDICTED: probable aspartyl aminopeptidase-...    176   4e-48   Oryza brachyantha
ref|XP_006476998.1|  PREDICTED: probable aspartyl aminopeptidase-...    176   4e-48   Citrus sinensis [apfelsine]
ref|XP_011083884.1|  PREDICTED: probable aspartyl aminopeptidase        176   4e-48   Sesamum indicum [beniseed]
ref|XP_006440072.1|  hypothetical protein CICLE_v10019750mg             176   6e-48   Citrus clementina [clementine]
ref|XP_006402123.1|  hypothetical protein EUTSA_v10015798mg             175   6e-48   
ref|XP_010674696.1|  PREDICTED: probable aspartyl aminopeptidase        176   7e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|KHF99832.1|  Aspartyl aminopeptidase                                 175   1e-47   Gossypium arboreum [tree cotton]
ref|XP_007037930.1|  Zn-dependent exopeptidases superfamily protein     176   1e-47   
ref|XP_006280394.1|  hypothetical protein CARUB_v10026321mg             175   1e-47   Capsella rubella
ref|XP_001756754.1|  predicted protein                                  174   1e-47   
ref|XP_002458215.1|  hypothetical protein SORBIDRAFT_03g029130          174   1e-47   Sorghum bicolor [broomcorn]
ref|XP_008367478.1|  PREDICTED: probable aspartyl aminopeptidase        175   2e-47   
ref|XP_008392833.1|  PREDICTED: probable aspartyl aminopeptidase        174   2e-47   
ref|XP_010026684.1|  PREDICTED: probable aspartyl aminopeptidase        174   2e-47   Eucalyptus grandis [rose gum]
ref|XP_003578741.1|  PREDICTED: probable aspartyl aminopeptidase        174   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_007137936.1|  hypothetical protein PHAVU_009G167900g             174   2e-47   Phaseolus vulgaris [French bean]
ref|XP_009346502.1|  PREDICTED: probable aspartyl aminopeptidase        174   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_010456062.1|  PREDICTED: probable aspartyl aminopeptidase        174   3e-47   Camelina sativa [gold-of-pleasure]
ref|NP_001159225.1|  hypothetical protein                               172   4e-47   Zea mays [maize]
ref|XP_009359462.1|  PREDICTED: probable aspartyl aminopeptidase        174   4e-47   Pyrus x bretschneideri [bai li]
ref|XP_009336570.1|  PREDICTED: probable aspartyl aminopeptidase        174   4e-47   Pyrus x bretschneideri [bai li]
ref|XP_010483659.1|  PREDICTED: probable aspartyl aminopeptidase        173   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_008374264.1|  PREDICTED: probable aspartyl aminopeptidase        174   4e-47   Malus domestica [apple tree]
ref|XP_010443807.1|  PREDICTED: probable aspartyl aminopeptidase        173   4e-47   Camelina sativa [gold-of-pleasure]
gb|KCW83184.1|  hypothetical protein EUGRSUZ_B00132                     174   5e-47   Eucalyptus grandis [rose gum]
ref|XP_006826610.1|  hypothetical protein AMTR_s00138p00074300          170   7e-47   
ref|XP_008673044.1|  PREDICTED: hypothetical protein isoform X1         172   8e-47   Zea mays [maize]
ref|XP_003526970.1|  PREDICTED: probable aspartyl aminopeptidase-...    172   9e-47   Glycine max [soybeans]
gb|EMS55846.1|  Aspartyl aminopeptidase                                 174   1e-46   Triticum urartu
ref|XP_004500663.1|  PREDICTED: probable aspartyl aminopeptidase-...    172   1e-46   Cicer arietinum [garbanzo]
ref|XP_004960722.1|  PREDICTED: probable aspartyl aminopeptidase-...    172   2e-46   Setaria italica
ref|XP_010102886.1|  Aspartyl aminopeptidase                            172   2e-46   
ref|XP_006351481.1|  PREDICTED: probable aspartyl aminopeptidase-...    171   3e-46   Solanum tuberosum [potatoes]
ref|XP_003602076.1|  Aspartyl aminopeptidase                            171   3e-46   Medicago truncatula
ref|XP_009624334.1|  PREDICTED: probable aspartyl aminopeptidase        171   3e-46   Nicotiana tomentosiformis
ref|XP_009790447.1|  PREDICTED: probable aspartyl aminopeptidase        171   4e-46   Nicotiana sylvestris
ref|XP_009379936.1|  PREDICTED: probable aspartyl aminopeptidase        171   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003523136.1|  PREDICTED: probable aspartyl aminopeptidase-...    171   5e-46   Glycine max [soybeans]
gb|KJB27157.1|  hypothetical protein B456_004G282900                    170   5e-46   Gossypium raimondii
gb|KJB27156.1|  hypothetical protein B456_004G282900                    170   5e-46   Gossypium raimondii
gb|KJB27155.1|  hypothetical protein B456_004G282900                    170   5e-46   Gossypium raimondii
ref|XP_004236341.1|  PREDICTED: probable aspartyl aminopeptidase        171   6e-46   Solanum lycopersicum
ref|XP_002283475.1|  PREDICTED: probable aspartyl aminopeptidase        170   7e-46   Vitis vinifera
ref|XP_009404266.1|  PREDICTED: probable aspartyl aminopeptidase        170   7e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP05422.1|  unnamed protein product                                170   9e-46   Coffea canephora [robusta coffee]
gb|KDP30945.1|  hypothetical protein JCGZ_11321                         170   9e-46   Jatropha curcas
ref|XP_011463290.1|  PREDICTED: probable aspartyl aminopeptidase        169   1e-45   Fragaria vesca subsp. vesca
ref|XP_010248918.1|  PREDICTED: probable aspartyl aminopeptidase ...    169   2e-45   Nelumbo nucifera [Indian lotus]
gb|EPS62030.1|  aspartyl aminopeptidase-like protein                    169   3e-45   Genlisea aurea
gb|ABR17053.1|  unknown                                                 167   8e-45   Picea sitchensis
ref|XP_008807558.1|  PREDICTED: probable aspartyl aminopeptidase ...    166   1e-44   Phoenix dactylifera
ref|XP_008807556.1|  PREDICTED: probable aspartyl aminopeptidase ...    167   1e-44   
ref|XP_010930126.1|  PREDICTED: probable aspartyl aminopeptidase        166   2e-44   Elaeis guineensis
gb|KJB19571.1|  hypothetical protein B456_003G109700                    162   6e-44   Gossypium raimondii
ref|XP_004165827.1|  PREDICTED: probable aspartyl aminopeptidase-...    165   6e-44   
ref|XP_004138060.1|  PREDICTED: probable aspartyl aminopeptidase-...    165   6e-44   
ref|XP_002507546.1|  aspartyl aminopeptidase                            165   9e-44   Micromonas commoda
gb|EMT03759.1|  Aspartyl aminopeptidase                                 168   1e-43   
ref|XP_008464465.1|  PREDICTED: probable aspartyl aminopeptidase ...    163   2e-43   Cucumis melo [Oriental melon]
gb|KJB19572.1|  hypothetical protein B456_003G109700                    162   4e-43   Gossypium raimondii
gb|KDO42029.1|  hypothetical protein CISIN_1g009941mg                   163   5e-43   Citrus sinensis [apfelsine]
ref|XP_004172613.1|  PREDICTED: probable aspartyl aminopeptidase-...    160   6e-43   
ref|XP_004336070.1|  aspartyl aminopeptidase                            159   2e-42   Acanthamoeba castellanii str. Neff
gb|KCW51472.1|  hypothetical protein EUGRSUZ_J00993                     160   3e-42   Eucalyptus grandis [rose gum]
ref|XP_001690598.1|  aspartyl aminopeptidase-like protein               161   4e-42   Chlamydomonas reinhardtii
ref|XP_002907085.1|  aspartyl aminopeptidase, putative                  159   7e-42   Phytophthora infestans T30-4
ref|XP_007512692.1|  predicted protein                                  159   3e-41   Bathycoccus prasinos
ref|XP_010694703.1|  PREDICTED: probable aspartyl aminopeptidase ...    157   4e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008909814.1|  hypothetical protein PPTG_14635                    157   4e-41   Phytophthora parasitica INRA-310
ref|XP_009519985.1|  hypothetical protein PHYSODRAFT_539739             157   6e-41   Phytophthora sojae
ref|XP_003060266.1|  predicted protein                                  153   6e-40   Micromonas pusilla CCMP1545
ref|XP_003055398.1|  predicted protein                                  152   3e-39   Micromonas pusilla CCMP1545
ref|XP_005648131.1|  peptidase M18, aminopeptidase I                    150   2e-38   Coccomyxa subellipsoidea C-169
ref|XP_011396821.1|  Aspartyl aminopeptidase                            149   3e-38   Auxenochlorella protothecoides
emb|CEJ00699.1|  Putative Aspartyl aminopeptidase                       145   4e-38   Rhizopus microsporus
gb|EXX59698.1|  Ape4p                                                   147   2e-37   Rhizophagus irregularis DAOM 197198w
ref|XP_007514776.1|  predicted protein                                  148   2e-37   Bathycoccus prasinos
ref|XP_001421486.1|  predicted protein                                  147   2e-37   Ostreococcus lucimarinus CCE9901
gb|ESA11968.1|  hypothetical protein GLOINDRAFT_335422                  147   2e-37   
gb|ETO14766.1|  hypothetical protein RFI_22603                          139   3e-37   Reticulomyxa filosa
ref|XP_004346183.2|  aspartyl aminopeptidase                            146   4e-37   Capsaspora owczarzaki ATCC 30864
gb|KJE94975.1|  aspartyl aminopeptidase                                 146   4e-37   Capsaspora owczarzaki ATCC 30864
ref|XP_002505350.1|  predicted protein                                  145   8e-37   Micromonas commoda
emb|CEG81490.1|  Putative Aspartyl aminopeptidase                       145   1e-36   Rhizopus microsporus
ref|XP_002960428.1|  hypothetical protein SELMODRAFT_164111             145   1e-36   
ref|XP_002967289.1|  hypothetical protein SELMODRAFT_86972              145   1e-36   
emb|CEG01789.1|  Peptidase M18                                          144   2e-36   Ostreococcus tauri
ref|XP_003083329.1|  aspartyl aminopeptidase (ISS)                      147   3e-36   
ref|XP_008863481.1|  hypothetical protein H310_01914                    143   5e-36   Aphanomyces invadans
emb|CCA15777.1|  aspartyl aminopeptidase putative                       143   5e-36   Albugo laibachii Nc14
gb|EPB92944.1|  aspartyl aminopeptidase                                 143   6e-36   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN09714.1|  aspartyl aminopeptidase                                142   8e-36   Mucor ambiguus
emb|CCI46763.1|  unnamed protein product                                144   9e-36   Albugo candida
ref|XP_009825683.1|  hypothetical protein H257_03355                    142   9e-36   Aphanomyces astaci
ref|XP_002678138.1|  predicted protein                                  141   3e-35   Naegleria gruberi strain NEG-M
emb|CDS03243.1|  hypothetical protein LRAMOSA00645                      140   4e-35   Lichtheimia ramosa
gb|EIE78284.1|  hypothetical protein RO3G_02988                         140   4e-35   Rhizopus delemar RA 99-880
gb|EPB84012.1|  aspartyl aminopeptidase                                 140   7e-35   Mucor circinelloides f. circinelloides 1006PhL
emb|CDH60153.1|  aspartyl aminopeptidase                                139   2e-34   Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAN06933.1|  aspartyl aminopeptidase                                139   2e-34   Mucor ambiguus
emb|CEP14293.1|  hypothetical protein                                   138   2e-34   Parasitella parasitica
gb|KDO32253.1|  hypothetical protein SPRG_02733                         138   3e-34   Saprolegnia parasitica CBS 223.65
ref|XP_008620058.1|  aspartyl aminopeptidase                            138   3e-34   Saprolegnia diclina VS20
ref|XP_001745410.1|  hypothetical protein                               138   4e-34   Monosiga brevicollis MX1
ref|XP_007879166.1|  hypothetical protein PFL1_03458                    137   6e-34   Anthracocystis flocculosa PF-1
emb|CBQ68247.1|  probable aspartyl aminopeptidase                       137   9e-34   Sporisorium reilianum SRZ2
emb|CEJ04001.1|  Putative Aspartyl aminopeptidase                       137   1e-33   Rhizopus microsporus
emb|CEI95696.1|  Putative Aspartyl aminopeptidase                       136   2e-33   Rhizopus microsporus
emb|CEG69346.1|  Putative Aspartyl aminopeptidase                       136   2e-33   Rhizopus microsporus
emb|CCF51316.1|  probable aspartyl aminopeptidase                       136   2e-33   Ustilago hordei
emb|CEG81693.1|  Putative Aspartyl aminopeptidase                       136   2e-33   Rhizopus microsporus
gb|EIE88868.1|  hypothetical protein RO3G_13579                         135   2e-33   Rhizopus delemar RA 99-880
ref|XP_002129082.1|  PREDICTED: aspartyl aminopeptidase-like            135   3e-33   Ciona intestinalis [sea vase]
dbj|GAC99602.1|  aspartyl aminopeptidase                                135   4e-33   Pseudozyma hubeiensis SY62
gb|KDN49618.1|  putative aspartyl aminopeptidase                        135   5e-33   Tilletiaria anomala UBC 951
ref|XP_011386806.1|  putative aspartyl aminopeptidase                   135   5e-33   Ustilago maydis 521
emb|CDI51753.1|  probable aspartyl aminopeptidase                       135   5e-33   Melanopsichium pennsylvanicum 4
ref|XP_004994670.1|  aspartyl aminopeptidase                            134   9e-33   Salpingoeca rosetta
ref|XP_004361073.1|  aspartyl aminopeptidase                            134   1e-32   Cavenderia fasciculata
ref|XP_009025082.1|  hypothetical protein HELRODRAFT_187369             133   2e-32   Helobdella robusta
ref|XP_011457668.1|  PREDICTED: probable aspartyl aminopeptidase        126   3e-32   Fragaria vesca subsp. vesca
dbj|GAC74074.1|  histone acetyltransferase                              134   9e-32   Moesziomyces antarcticus T-34
dbj|GAK61818.1|  acyltransferase                                        134   1e-31   Moesziomyces antarcticus
gb|ETS64061.1|  hypothetical protein PaG_02398                          134   1e-31   Moesziomyces aphidis DSM 70725
gb|EST06743.1|  histone acetyltransferase                               134   2e-31   Kalmanozyma brasiliensis GHG001
gb|EWC43491.1|  aspartyl aminopeptidase                                 130   2e-31   Drechslerella stenobrocha 248
ref|XP_005849269.1|  hypothetical protein CHLNCDRAFT_143544             130   3e-31   Chlorella variabilis
ref|XP_002289000.1|  probable aspartyl aminopeptidase                   129   4e-31   Thalassiosira pseudonana CCMP1335
gb|EJK61550.1|  hypothetical protein THAOC_17943                        129   6e-31   Thalassiosira oceanica
ref|NP_001279935.1|  aspartyl aminopeptidase                            128   8e-31   Callorhinchus milii [Australian ghost shark]
gb|AFK11572.1|  aspartyl aminopeptidase                                 128   8e-31   Callorhinchus milii [Australian ghost shark]
gb|EPY30718.1|  aspartyl aminopeptidase                                 124   1e-30   Strigomonas culicis
ref|XP_002840917.1|  hypothetical protein                               128   1e-30   Tuber melanosporum Mel28
ref|XP_006683342.1|  hypothetical protein BATDEDRAFT_18145              128   1e-30   Batrachochytrium dendrobatidis JAM81
ref|XP_007883309.1|  PREDICTED: aspartyl aminopeptidase                 128   2e-30   Callorhinchus milii [Australian ghost shark]
ref|XP_001837079.1|  aspartyl aminopeptidase                            127   2e-30   Coprinopsis cinerea okayama7#130
ref|XP_002155387.2|  PREDICTED: aspartyl aminopeptidase-like            127   2e-30   
ref|XP_005415861.1|  PREDICTED: aspartyl aminopeptidase                 120   3e-30   
ref|XP_011481489.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    126   4e-30   
gb|ELU07857.1|  hypothetical protein CAPTEDRAFT_158105                  126   4e-30   Capitella teleta
ref|XP_003446617.1|  PREDICTED: aspartyl aminopeptidase-like isof...    126   4e-30   Oreochromis niloticus
ref|XP_005452349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    126   4e-30   Oreochromis niloticus
ref|XP_011123681.1|  hypothetical protein AOL_s00083g200                126   4e-30   Arthrobotrys oligospora ATCC 24927
gb|KIK06798.1|  hypothetical protein K443DRAFT_674082                   126   6e-30   Laccaria amethystina LaAM-08-1
ref|XP_008323213.1|  PREDICTED: aspartyl aminopeptidase isoform X3      126   6e-30   
ref|XP_008323212.1|  PREDICTED: aspartyl aminopeptidase isoform X2      126   6e-30   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008323211.1|  PREDICTED: aspartyl aminopeptidase isoform X1      126   6e-30   
ref|XP_004563349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    126   6e-30   Maylandia zebra
ref|XP_004563350.1|  PREDICTED: aspartyl aminopeptidase-like isof...    125   6e-30   Maylandia zebra
dbj|GAM18899.1|  hypothetical protein SAMD00019534_020740               125   7e-30   Acytostelium subglobosum LB1
gb|ABQ22407.1|  aspartyl aminopeptidase-like protein                    121   7e-30   Callithrix jacchus [common marmoset]
ref|XP_003333509.2|  hypothetical protein PGTG_14931                    125   8e-30   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|ENH77871.1|  aspartyl aminopeptidase                                 125   1e-29   
gb|ELR06737.1|  hypothetical protein GMDG_00354                         125   1e-29   Pseudogymnoascus destructans 20631-21
emb|CCX33896.1|  Similar to Aspartyl aminopeptidase; acc. no. Q2UPZ7    125   1e-29   Pyronema omphalodes CBS 100304
ref|XP_002592514.1|  hypothetical protein BRAFLDRAFT_69005              125   1e-29   Branchiostoma floridae
ref|XP_005279931.1|  PREDICTED: aspartyl aminopeptidase                 125   2e-29   Chrysemys picta bellii
gb|KFQ24176.1|  Aspartyl aminopeptidase                                 121   2e-29   Merops nubicus
ref|XP_008947935.1|  PREDICTED: aspartyl aminopeptidase                 121   2e-29   Merops nubicus
gb|EPY33263.1|  aminopeptidase                                          124   2e-29   Strigomonas culicis
ref|XP_006035444.1|  PREDICTED: aspartyl aminopeptidase                 124   2e-29   
gb|KEZ42556.1|  Aspartyl aminopeptidase                                 125   2e-29   Scedosporium apiospermum
gb|EPY23074.1|  aminopeptidase                                          124   2e-29   Strigomonas culicis
dbj|GAM24522.1|  hypothetical protein SAMD00019534_076970               125   2e-29   Acytostelium subglobosum LB1
emb|CEJ81993.1|  Putative Aspartyl aminopeptidase                       124   2e-29   Torrubiella hemipterigena
gb|KFY19397.1|  hypothetical protein V491_04461                         122   2e-29   
emb|CCF41181.1|  aspartyl aminopeptidase                                124   3e-29   
ref|XP_002736578.1|  PREDICTED: aspartyl aminopeptidase-like            122   3e-29   
ref|XP_005330568.1|  PREDICTED: aspartyl aminopeptidase                 124   3e-29   
gb|KFZ06387.1|  hypothetical protein V501_07458                         124   3e-29   
ref|XP_010181866.1|  PREDICTED: aspartyl aminopeptidase                 123   3e-29   
gb|EJT49728.1|  aspartyl aminopeptidase                                 124   3e-29   
ref|XP_007234617.1|  PREDICTED: aspartyl aminopeptidase                 124   3e-29   
ref|XP_005101285.1|  PREDICTED: aspartyl aminopeptidase-like            124   3e-29   
ref|XP_008293067.1|  PREDICTED: aspartyl aminopeptidase isoform X1      123   4e-29   
ref|XP_008293068.1|  PREDICTED: aspartyl aminopeptidase isoform X2      123   4e-29   
ref|XP_009033025.1|  hypothetical protein AURANDRAFT_20254              124   4e-29   
gb|KIL70156.1|  hypothetical protein M378DRAFT_156218                   123   5e-29   
ref|XP_007068759.1|  PREDICTED: aspartyl aminopeptidase                 123   5e-29   
ref|XP_007575368.1|  PREDICTED: aspartyl aminopeptidase isoform X1      123   5e-29   
ref|XP_006272731.1|  PREDICTED: aspartyl aminopeptidase                 123   5e-29   
emb|CBY20487.1|  unnamed protein product                                123   5e-29   
ref|XP_007575369.1|  PREDICTED: aspartyl aminopeptidase isoform X2      123   5e-29   
ref|XP_007279968.1|  aspartyl aminopeptidase                            122   6e-29   
ref|XP_007600979.1|  aminopeptidase I zinc metalloprotease              124   6e-29   
gb|EFQ27027.1|  aminopeptidase I zinc metalloprotease                   123   6e-29   
gb|EPY40683.1|  aspartyl aminopeptidase                                 121   6e-29   
ref|NP_001172115.1|  aspartyl aminopeptidase                            123   7e-29   
gb|KIO30255.1|  hypothetical protein M407DRAFT_157151                   123   7e-29   
gb|AAX27684.2|  SJCHGC06075 protein                                     122   7e-29   
gb|KFQ19689.1|  Aspartyl aminopeptidase                                 122   7e-29   
gb|EKF32950.1|  aspartyl aminopeptidase, putative,metallo-peptida...    123   7e-29   
ref|XP_010890471.1|  PREDICTED: aspartyl aminopeptidase isoform X2      122   8e-29   
ref|XP_005154153.1|  PREDICTED: aspartyl aminopeptidase                 122   9e-29   
gb|KFO72178.1|  Aspartyl aminopeptidase                                 122   9e-29   
ref|XP_010890470.1|  PREDICTED: aspartyl aminopeptidase isoform X1      122   9e-29   
ref|XP_008594228.1|  aminopeptidase I zinc metalloprotease              122   9e-29   
ref|XP_010748613.1|  PREDICTED: aspartyl aminopeptidase isoform X2      122   9e-29   
gb|KDR83853.1|  hypothetical protein GALMADRAFT_236273                  122   9e-29   
ref|XP_003347186.1|  hypothetical protein SMAC_08078                    122   9e-29   
ref|XP_009553937.1|  PREDICTED: aspartyl aminopeptidase                 122   9e-29   
gb|KGQ12368.1|  Aspartyl aminopeptidase                                 122   9e-29   
ref|XP_002712541.1|  PREDICTED: aspartyl aminopeptidase isoform X2      122   1e-28   
ref|XP_010748612.1|  PREDICTED: aspartyl aminopeptidase isoform X1      122   1e-28   
gb|KFY13166.1|  hypothetical protein V492_03441                         123   1e-28   
gb|AAX07699.1|  aspartyl aminopeptidase-like protein                    122   1e-28   
gb|KFY42594.1|  hypothetical protein V494_02343                         123   1e-28   
gb|KFY79508.1|  hypothetical protein V499_01520                         123   1e-28   
ref|XP_008257444.1|  PREDICTED: aspartyl aminopeptidase isoform X1      122   1e-28   
gb|KEY64841.1|  hypothetical protein S7711_08849                        122   1e-28   
gb|KFA55851.1|  hypothetical protein S40293_01900                       122   1e-28   
ref|XP_009041924.1|  hypothetical protein AURANDRAFT_34091              122   1e-28   
ref|XP_001641062.1|  predicted protein                                  122   1e-28   
ref|XP_001877081.1|  aspartyl aminopeptidase                            122   1e-28   
gb|KDN65494.1|  putative aminopeptidase I zinc metalloprotease          122   1e-28   
ref|XP_006668022.1|  aspartyl aminopeptidase                            124   1e-28   
emb|CCC13957.1|  unnamed protein product                                122   1e-28   
ref|XP_957246.2|  aspartyl aminopeptidase                               122   1e-28   
ref|XP_009850908.1|  aspartyl aminopeptidase                            122   1e-28   
ref|XP_010022905.1|  PREDICTED: aspartyl aminopeptidase                 121   1e-28   
ref|XP_003713775.1|  aspartyl aminopeptidase                            122   1e-28   
gb|KFQ45573.1|  Aspartyl aminopeptidase                                 121   1e-28   
gb|KFA70034.1|  hypothetical protein S40285_02036                       122   2e-28   
ref|XP_009062504.1|  hypothetical protein LOTGIDRAFT_220342             122   2e-28   
ref|XP_005814088.1|  PREDICTED: aspartyl aminopeptidase-like            122   2e-28   
ref|XP_005361637.1|  PREDICTED: aspartyl aminopeptidase isoform X2      122   2e-28   
ref|XP_002180680.1|  predicted protein                                  122   2e-28   
ref|XP_005361636.1|  PREDICTED: aspartyl aminopeptidase isoform X1      122   2e-28   
gb|KID79523.1|  aspartyl aminopeptidase                                 122   2e-28   
ref|XP_822049.1|  aspartyl aminopeptidase                               121   2e-28   
ref|XP_003510642.1|  PREDICTED: aspartyl aminopeptidase                 121   2e-28   
gb|EKG04533.1|  aspartyl aminopeptidase, putative,metallo-peptida...    121   2e-28   
gb|EMC84232.1|  Aspartyl aminopeptidase                                 121   2e-28   
ref|XP_500533.1|  YALI0B05522p                                          121   2e-28   
ref|XP_009069815.1|  PREDICTED: aspartyl aminopeptidase                 121   2e-28   
gb|KFP77222.1|  Aspartyl aminopeptidase                                 121   2e-28   
ref|XP_006906751.1|  PREDICTED: aspartyl aminopeptidase                 121   2e-28   
ref|XP_009217911.1|  aspartyl aminopeptidase                            122   2e-28   
gb|ETE70732.1|  Aspartyl aminopeptidase                                 121   2e-28   
ref|XP_003966622.1|  PREDICTED: aspartyl aminopeptidase-like            121   2e-28   
ref|XP_005070528.1|  PREDICTED: aspartyl aminopeptidase                 121   2e-28   
ref|XP_005610686.1|  PREDICTED: aspartyl aminopeptidase isoform X3      121   3e-28   
ref|XP_001492028.3|  PREDICTED: aspartyl aminopeptidase isoform X1      121   3e-28   
ref|XP_011108047.1|  hypothetical protein H072_2059                     121   3e-28   
ref|XP_005610687.1|  PREDICTED: aspartyl aminopeptidase isoform X4      121   3e-28   
ref|XP_010334576.1|  PREDICTED: aspartyl aminopeptidase isoform X3      121   3e-28   
ref|XP_004576859.1|  PREDICTED: aspartyl aminopeptidase                 121   3e-28   
gb|ELK17177.1|  Aspartyl aminopeptidase                                 121   3e-28   
ref|XP_010334577.1|  PREDICTED: aspartyl aminopeptidase isoform X4      121   3e-28   
gb|KFV63385.1|  Aspartyl aminopeptidase                                 121   3e-28   
ref|XP_001773362.1|  predicted protein                                  121   3e-28   
gb|KGL86427.1|  Aspartyl aminopeptidase                                 120   3e-28   
ref|XP_010405218.1|  PREDICTED: aspartyl aminopeptidase                 120   3e-28   
ref|XP_010334575.1|  PREDICTED: aspartyl aminopeptidase isoform X2      121   3e-28   
dbj|BAA13937.1|  unnamed protein product                                120   3e-28   
ref|XP_007799299.1|  putative aspartyl aminopeptidase protein           121   3e-28   
gb|KFV81952.1|  Aspartyl aminopeptidase                                 120   3e-28   
gb|KFG81622.1|  aspartyl aminopeptidase                                 121   3e-28   
ref|XP_005610685.1|  PREDICTED: aspartyl aminopeptidase isoform X2      121   3e-28   
gb|KFO52747.1|  Aspartyl aminopeptidase                                 120   3e-28   
gb|KFQ94690.1|  Aspartyl aminopeptidase                                 120   3e-28   
ref|XP_003925541.1|  PREDICTED: aspartyl aminopeptidase isoform X1      121   4e-28   
ref|XP_008997791.1|  PREDICTED: aspartyl aminopeptidase isoform X1      121   4e-28   
ref|XP_008997792.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   4e-28   
gb|ABY89804.1|  aspartyl aminopeptidase (predicted)                     120   4e-28   
ref|XP_004402808.1|  PREDICTED: aspartyl aminopeptidase isoform 1       121   4e-28   
ref|XP_009882434.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
ref|XP_006460010.1|  hypothetical protein AGABI2DRAFT_116970            120   4e-28   
ref|XP_007823244.1|  peptidase M18-like protein                         121   4e-28   
ref|XP_005498746.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
emb|CEP14325.1|  hypothetical protein                                   124   4e-28   
ref|XP_007956515.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
ref|XP_009674526.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
gb|KDO52596.1|  hypothetical protein CISIN_1g0132571mg                  113   4e-28   
ref|XP_007842164.1|  Aspartyl aminopeptidase                            120   4e-28   
ref|XP_008626911.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
ref|XP_009460435.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
ref|XP_006739743.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
ref|XP_008528206.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    121   4e-28   
ref|XP_009086531.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
ref|XP_010567906.1|  PREDICTED: aspartyl aminopeptidase                 120   4e-28   
ref|XP_007329540.1|  hypothetical protein AGABI1DRAFT_113568            120   4e-28   
ref|XP_005049624.1|  PREDICTED: aspartyl aminopeptidase                 120   5e-28   
ref|XP_004762907.1|  PREDICTED: aspartyl aminopeptidase isoform X6      120   5e-28   
ref|XP_004325558.1|  PREDICTED: aspartyl aminopeptidase isoform 1       120   5e-28   
ref|XP_004402809.1|  PREDICTED: aspartyl aminopeptidase isoform 2       120   5e-28   
gb|KDE05131.1|  hypothetical protein MVLG_04473                         120   5e-28   
ref|XP_004262731.1|  PREDICTED: aspartyl aminopeptidase isoform 1       120   5e-28   
gb|KFX91452.1|  hypothetical protein V490_05896                         121   5e-28   
ref|XP_004325559.1|  PREDICTED: aspartyl aminopeptidase isoform 2       120   5e-28   
ref|XP_006867902.1|  PREDICTED: aspartyl aminopeptidase                 120   5e-28   
ref|NP_594745.1|  aspartyl aminopeptidase Aap1                          120   5e-28   
ref|XP_004762903.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   5e-28   
ref|XP_004325560.1|  PREDICTED: aspartyl aminopeptidase isoform 3       120   5e-28   
ref|XP_004262732.1|  PREDICTED: aspartyl aminopeptidase isoform 2       120   5e-28   
ref|XP_004762902.1|  PREDICTED: aspartyl aminopeptidase isoform X1      120   5e-28   
ref|XP_007086232.1|  PREDICTED: aspartyl aminopeptidase                 120   5e-28   
gb|ACA64864.1|  aspartyl aminopeptidase (predicted)                     120   5e-28   
ref|XP_008688803.1|  PREDICTED: aspartyl aminopeptidase                 120   5e-28   
gb|KDE05132.1|  hypothetical protein, variant                           120   6e-28   
ref|NP_001020050.1|  aspartyl aminopeptidase                            120   6e-28   
ref|XP_005520045.1|  PREDICTED: aspartyl aminopeptidase                 120   6e-28   
ref|XP_006245246.1|  PREDICTED: aspartyl aminopeptidase isoform X1      120   6e-28   
ref|XP_007912218.1|  putative aspartyl aminopeptidase protein           120   6e-28   
ref|XP_009994576.1|  PREDICTED: aspartyl aminopeptidase                 120   6e-28   
gb|KID86528.1|  aspartyl aminopeptidase                                 120   6e-28   
gb|AAD01212.1|  aspartyl aminopeptidase                                 120   6e-28   
gb|KFU88502.1|  Aspartyl aminopeptidase                                 120   6e-28   
ref|XP_005640751.1|  PREDICTED: aspartyl aminopeptidase isoform X4      120   6e-28   
ref|XP_005234414.1|  PREDICTED: aspartyl aminopeptidase                 120   6e-28   
ref|NP_001085525.1|  aspartyl aminopeptidase                            120   6e-28   
ref|XP_006245247.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   6e-28   
gb|EEF81285.1|  Aminopeptidase I zinc metalloprotease (M18) super...    120   6e-28   
gb|KID97929.1|  aspartyl aminopeptidase                                 120   6e-28   
ref|XP_006935664.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   7e-28   
ref|XP_007382240.1|  aspartyl aminopeptidase                            120   7e-28   
ref|XP_006935665.1|  PREDICTED: aspartyl aminopeptidase isoform X3      120   7e-28   
gb|KGL77727.1|  Aspartyl aminopeptidase                                 120   7e-28   
ref|WP_028469943.1|  aminopeptidase                                     120   7e-28   
ref|XP_007122487.1|  PREDICTED: aspartyl aminopeptidase                 120   7e-28   
ref|WP_043887701.1|  aminopeptidase                                     120   7e-28   
ref|XP_005640749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   7e-28   
ref|XP_005956749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   7e-28   
ref|XP_010213657.1|  PREDICTED: aspartyl aminopeptidase                 120   7e-28   
ref|XP_008578710.1|  PREDICTED: aspartyl aminopeptidase                 120   7e-28   
ref|XP_005640748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      120   7e-28   
ref|XP_005676645.1|  PREDICTED: aspartyl aminopeptidase isoform X1      120   7e-28   
emb|CCE31713.1|  probable aspartyl aminopeptidase                       120   7e-28   
ref|NP_001039417.1|  aspartyl aminopeptidase                            120   7e-28   
gb|ELR60782.1|  Aspartyl aminopeptidase                                 120   7e-28   
ref|XP_005202875.1|  PREDICTED: aspartyl aminopeptidase isoform X5      120   7e-28   
ref|XP_009652940.1|  aspartyl aminopeptidase                            120   7e-28   
gb|KFY33190.1|  hypothetical protein V495_08348                         120   8e-28   
ref|XP_004674317.1|  PREDICTED: aspartyl aminopeptidase                 120   8e-28   
ref|XP_010859551.1|  PREDICTED: aspartyl aminopeptidase isoform X1      120   8e-28   
ref|XP_006935663.1|  PREDICTED: aspartyl aminopeptidase isoform X1      120   8e-28   
ref|XP_003006452.1|  aspartyl aminopeptidase                            120   8e-28   
gb|KIK30586.1|  hypothetical protein PISMIDRAFT_301057                  120   8e-28   
ref|XP_003290450.1|  hypothetical protein DICPUDRAFT_154975             120   8e-28   
ref|XP_005676646.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   8e-28   
gb|AAH04854.2|  DNPEP protein                                           119   8e-28   
ref|XP_007445869.1|  PREDICTED: aspartyl aminopeptidase                 120   8e-28   
ref|XP_637878.1|  aspartyl aminopeptidase                               120   8e-28   
ref|XP_004005000.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    120   8e-28   
ref|XP_007807761.1|  aspartyl aminopeptidase                            120   8e-28   
ref|XP_001784619.1|  predicted protein                                  120   8e-28   
gb|KIY46623.1|  peptidase M18, aminopeptidase I                         120   8e-28   
ref|XP_004467839.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    120   9e-28   
gb|KIJ70193.1|  hypothetical protein HYDPIDRAFT_77532                   120   9e-28   
ref|XP_002109666.1|  hypothetical protein TRIADDRAFT_37272              120   9e-28   
ref|XP_007519740.1|  PREDICTED: aspartyl aminopeptidase                 120   9e-28   
pdb|3VAR|A  Chain A, Crystal Structure Of Dnpep, Znzn Form              120   9e-28   
ref|NP_001088602.1|  uncharacterized protein LOC495491                  120   9e-28   
ref|XP_008057077.1|  PREDICTED: aspartyl aminopeptidase                 120   9e-28   
gb|EFX00349.1|  aspartyl aminopeptidase                                 120   9e-28   
ref|XP_005202874.1|  PREDICTED: aspartyl aminopeptidase isoform X2      120   9e-28   
ref|NP_001016026.1|  aspartyl aminopeptidase                            119   9e-28   
ref|XP_005956748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      120   1e-27   
ref|XP_009909456.1|  PREDICTED: aspartyl aminopeptidase                 120   1e-27   
gb|KFO95292.1|  Aspartyl aminopeptidase                                 119   1e-27   
ref|XP_010800625.1|  PREDICTED: aspartyl aminopeptidase isoform X3      120   1e-27   
ref|XP_003729436.1|  PREDICTED: aspartyl aminopeptidase-like            121   1e-27   
ref|XP_001240451.1|  aspartyl aminopeptidase, putative                  120   1e-27   
gb|KFY64115.1|  hypothetical protein V497_01817                         120   1e-27   
ref|XP_005485343.1|  PREDICTED: aspartyl aminopeptidase                 120   1e-27   
ref|XP_008495745.1|  PREDICTED: aspartyl aminopeptidase                 119   1e-27   
ref|XP_005443029.1|  PREDICTED: aspartyl aminopeptidase                 119   1e-27   
ref|XP_002192610.2|  PREDICTED: aspartyl aminopeptidase                 120   1e-27   
gb|KFX93899.1|  hypothetical protein O988_06582                         119   1e-27   
ref|XP_004701683.1|  PREDICTED: aspartyl aminopeptidase isoform X2      119   1e-27   
gb|KFY92019.1|  hypothetical protein V500_04378                         120   1e-27   
ref|NP_001104301.1|  aspartyl aminopeptidase isoform a                  119   1e-27   
ref|XP_003068027.1|  Aspartyl aminopeptidase, putative                  119   1e-27   
ref|NP_001012937.1|  aspartyl aminopeptidase                            119   1e-27   
ref|XP_010800626.1|  PREDICTED: aspartyl aminopeptidase isoform X4      119   1e-27   
gb|AAL16034.1|AF420303_1  aspartyl aminopeptidase                       119   1e-27   
ref|XP_004701682.1|  PREDICTED: aspartyl aminopeptidase isoform X1      119   1e-27   
ref|NP_058574.3|  aspartyl aminopeptidase isoform b                     119   1e-27   
dbj|BAE32800.1|  unnamed protein product                                119   1e-27   
gb|KDQ29229.1|  hypothetical protein PLEOSDRAFT_1055210                 119   1e-27   
dbj|BAC30079.1|  unnamed protein product                                119   1e-27   
ref|XP_006636850.1|  PREDICTED: aspartyl aminopeptidase-like            119   1e-27   
ref|XP_002627244.1|  aspartyl aminopeptidase                            119   1e-27   
gb|EFW14340.1|  aspartyl aminopeptidase                                 120   1e-27   
ref|XP_008823992.1|  PREDICTED: aspartyl aminopeptidase isoform X1      119   1e-27   
ref|XP_008823998.1|  PREDICTED: aspartyl aminopeptidase isoform X3      119   1e-27   



>ref|XP_002266672.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Vitis 
vinifera]
 ref|XP_010658775.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Vitis 
vinifera]
 ref|XP_010658776.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Vitis 
vinifera]
 ref|XP_010658777.1| PREDICTED: probable aspartyl aminopeptidase isoform X4 [Vitis 
vinifera]
 emb|CBI35256.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+T+FLFKEV RIHNLPTQ+FVVRNDMGCGSTIG
Sbjct  419  HEEHHRPELQKGLVIKHNANQRYATSGITAFLFKEVGRIHNLPTQEFVVRNDMGCGSTIG  478

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQTFSSVDRKLNVD
Sbjct  479  PILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  535



>ref|XP_004249975.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=535

 Score =   234 bits (598),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+TSFLFKEVAR+H+LPTQDFVVRNDMGCGSTIG
Sbjct  419  HEEHHRPELQKGLVIKHNANQRYATSGITSFLFKEVARLHSLPTQDFVVRNDMGCGSTIG  478

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+GVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFYQ+FSS+DRKLNVD
Sbjct  479  PILAAGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYQSFSSIDRKLNVD  535



>ref|XP_006361458.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=535

 Score =   234 bits (598),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+TSFLFKEVAR+H+LPTQDFVVRNDMGCGSTIG
Sbjct  419  HEEHHRPELQKGLVIKHNANQRYATSGITSFLFKEVARLHSLPTQDFVVRNDMGCGSTIG  478

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+GVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFYQ+FSS+DRKLNVD
Sbjct  479  PILAAGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYQSFSSIDRKLNVD  535



>ref|XP_003591777.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=287

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  170  HEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQEFVVRNDMGCGSTIG  229

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ FSS+D+ L VD
Sbjct  230  PILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQNFSSIDKMLTVD  286



>ref|XP_009596186.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=541

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSFLFKEVAR+H+LPTQDFVVRNDMGCGSTIG
Sbjct  425  HEEHHRPELQKGLVIKHNANQRYATSGVTSFLFKEVARLHSLPTQDFVVRNDMGCGSTIG  484

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSS+DRKL VD
Sbjct  485  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSIDRKLIVD  541



>ref|XP_009802964.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=542

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSFLFKEVAR+H+LPTQDFVVRNDMGCGSTIG
Sbjct  426  HEEHHRPELQKGLVIKHNANQRYATSGVTSFLFKEVARLHSLPTQDFVVRNDMGCGSTIG  485

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSS+DRKL VD
Sbjct  486  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSIDRKLIVD  542



>ref|XP_003591778.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=332

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  215  HEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQEFVVRNDMGCGSTIG  274

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ FSS+D+ L VD
Sbjct  275  PILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQNFSSIDKMLTVD  331



>ref|XP_007213437.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
 gb|EMJ14636.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
Length=474

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSFLFKE+ +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  357  HEEHHRPEMQKGLVIKHNANQRYATSGVTSFLFKEIGKIHNLPTQEFVVRNDMGCGSTIG  416

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYKHFKAFYQ FSS+D+KLNVD
Sbjct  417  PILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFKAFYQAFSSIDKKLNVD  473



>ref|XP_008375605.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=407

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  290  HEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQEFVVRNDMGCGSTIG  349

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQTFSS+DRKL+VD
Sbjct  350  PILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQTFSSIDRKLDVD  406



>emb|CDO99897.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKEVA+++NLPTQ+FVVRNDMGCGSTIG
Sbjct  429  HEEHHRPELQKGLVIKHNANQRYATSGVTAFLFKEVAKMNNLPTQEFVVRNDMGCGSTIG  488

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICGKED+D AYKHF+AFYQTFSS+DRKLNVD
Sbjct  489  PILASGVGIRTVDCGIAQLSMHSVREICGKEDVDFAYKHFRAFYQTFSSIDRKLNVD  545



>gb|KJB78672.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
 gb|KJB78673.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
Length=521

 Score =   229 bits (585),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE  KG VIKHNA+QRYATSGVT+FLFKEVA++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  405  HEEHHRPEMHKGLVIKHNANQRYATSGVTAFLFKEVAKMHNLPTQEFVVRNDMGCGSTIG  464

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQTFSS+DRKL VD
Sbjct  465  PILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQTFSSIDRKLIVD  521



>gb|KHG01889.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=549

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE  KG VIKHNA+QRYATSGVT+FLFKEVA++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  433  HEEHHRPEMHKGLVIKHNANQRYATSGVTAFLFKEVAKMHNLPTQEFVVRNDMGCGSTIG  492

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQTFSS+DRKL VD
Sbjct  493  PILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQTFSSIDRKLIVD  549



>ref|XP_011076920.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Sesamum 
indicum]
Length=493

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP  QKG VIKHNA+QRYATSGVTSFLFKEVA+IHNLP Q+FVVRNDMGCGSTIG
Sbjct  376  HEENHRPVLQKGLVIKHNANQRYATSGVTSFLFKEVAKIHNLPIQEFVVRNDMGCGSTIG  435

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+TFSS+D+KLNVD
Sbjct  436  PILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYKTFSSIDKKLNVD  492



>ref|XP_009336015.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336016.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  412  HEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQEFVVRNDMGCGSTIG  471

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQTFSS+DRKL+VD
Sbjct  472  PILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQTFSSIDRKLDVD  528



>ref|XP_008347038.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=529

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  412  HEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQEFVVRNDMGCGSTIG  471

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQTFSS+DRKL+VD
Sbjct  472  PILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQTFSSIDRKLDVD  528



>ref|XP_008232012.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=530

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSFLFKE+ +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  413  HEEHHRPEMQKGLVIKHNANQRYATSGVTSFLFKEIGKIHNLPTQEFVVRNDMGCGSTIG  472

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYKHFKAFYQ FSS+D+KL+VD
Sbjct  473  PILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFKAFYQDFSSIDKKLDVD  529



>ref|XP_009336013.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336014.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  412  HEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQEFVVRNDMGCGSTIG  471

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQTFSS+DRKL+VD
Sbjct  472  PILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQTFSSIDRKLDVD  528



>gb|KDO42030.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=410

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  293  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIG  352

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++FSS+D+KL VD
Sbjct  353  PILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVD  409



>ref|XP_011076919.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Sesamum 
indicum]
Length=539

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP  QKG VIKHNA+QRYATSGVTSFLFKEVA+IHNLP Q+FVVRNDMGCGSTIG
Sbjct  422  HEENHRPVLQKGLVIKHNANQRYATSGVTSFLFKEVAKIHNLPIQEFVVRNDMGCGSTIG  481

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+TFSS+D+KLNVD
Sbjct  482  PILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYKTFSSIDKKLNVD  538



>ref|XP_007010329.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY19139.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE +KG VIKHNA+QRYATSGVT+FLFKEV +IHNLPTQDFVVRNDMGCGSTIG
Sbjct  404  HEEHHRPEMRKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPTQDFVVRNDMGCGSTIG  463

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVRE+CGK+DIDIAYKHFKAFYQ FSS+DRKL VD
Sbjct  464  PILASGVGIRTVDCGIAQLSMHSVREVCGKDDIDIAYKHFKAFYQIFSSIDRKLIVD  520



>ref|XP_010244532.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   226 bits (577),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A IHN+P Q+FVVRNDMGCGSTIG
Sbjct  403  YEEHHRPELQKGLVIKHNANQRYATSGVTAFLFKEIANIHNIPVQEFVVRNDMGCGSTIG  462

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+TFS +DRKLNVD
Sbjct  463  PILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYKTFSGIDRKLNVD  519



>gb|AES62027.2| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=526

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  409  HEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQEFVVRNDMGCGSTIG  468

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ FSS+D+ L VD
Sbjct  469  PILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQNFSSIDKMLTVD  525



>gb|KDO42028.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=469

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  352  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIG  411

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++FSS+D+KL VD
Sbjct  412  PILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVD  468



>gb|KCW51474.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=360

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ+F VRNDMGCGSTIG
Sbjct  243  HEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQEFAVRNDMGCGSTIG  302

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAY+HFKAFYQ+FS VD KL +D
Sbjct  303  PILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYQHFKAFYQSFSHVDSKLTID  359



>ref|XP_010694702.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+ QKG VIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ+FVV+NDMGCGSTIG
Sbjct  391  HEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQEFVVKNDMGCGSTIG  450

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+GVGIRTVDCGI+QLSMHSVREICGKEDIDIAYKHFKAFY++FSS+DRKL+VD
Sbjct  451  PILAAGVGIRTVDCGISQLSMHSVREICGKEDIDIAYKHFKAFYESFSSIDRKLSVD  507



>ref|XP_010088778.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB36961.1| Aspartyl aminopeptidase [Morus notabilis]
Length=532

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRP  QKG VIKHNA+QRYATSGVTSFLFKEV RIHNLPTQ+FVVRNDMGCGSTIG
Sbjct  415  HEEHHRPVMQKGLVIKHNANQRYATSGVTSFLFKEVGRIHNLPTQEFVVRNDMGCGSTIG  474

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICGKEDIDIAY+HFKAFY+TFSSVD KL++D
Sbjct  475  PILASGVGIRTVDCGIPQLSMHSVREICGKEDIDIAYQHFKAFYKTFSSVDMKLSID  531



>ref|XP_003591776.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=550

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+TS LFKEV +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  433  HEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQEFVVRNDMGCGSTIG  492

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ FSS+D+ L VD
Sbjct  493  PILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQNFSSIDKMLTVD  549



>gb|KDO42027.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=496

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  379  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIG  438

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++FSS+D+KL VD
Sbjct  439  PILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVD  495



>ref|XP_010694701.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+ QKG VIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ+FVV+NDMGCGSTIG
Sbjct  413  HEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQEFVVKNDMGCGSTIG  472

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+GVGIRTVDCGI+QLSMHSVREICGKEDIDIAYKHFKAFY++FSS+DRKL+VD
Sbjct  473  PILAAGVGIRTVDCGISQLSMHSVREICGKEDIDIAYKHFKAFYESFSSIDRKLSVD  529



>ref|XP_006436620.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49860.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=516

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  399  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIG  458

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++FSS+D+KL VD
Sbjct  459  PILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVD  515



>tpg|DAA55692.1| TPA: hypothetical protein ZEAMMB73_277076 [Zea mays]
Length=187

 Score =   215 bits (547),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  70   HEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  129

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ FS +DRKLNVD
Sbjct  130  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEMFSDIDRKLNVD  186



>ref|XP_006485213.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485214.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Citrus 
sinensis]
 gb|KDO42026.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=522

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  405  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIG  464

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++FSS+D+KL VD
Sbjct  465  PILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVD  521



>ref|XP_004150844.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=527

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQDFVVRNDMGCGSTIG
Sbjct  410  HEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQDFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHS+REICGKEDID AYK+FKAFY+TFSS+DRKL VD
Sbjct  470  PILASGAGIRTVDCGIPQLSMHSIREICGKEDIDTAYKYFKAFYKTFSSIDRKLKVD  526



>gb|KGN52197.1| hypothetical protein Csa_5G615200 [Cucumis sativus]
Length=527

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQDFVVRNDMGCGSTIG
Sbjct  410  HEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQDFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHS+REICGKEDID AYK+FKAFY+TFSS+DRKL VD
Sbjct  470  PILASGAGIRTVDCGIPQLSMHSIREICGKEDIDTAYKYFKAFYKTFSSIDRKLKVD  526



>ref|XP_006436621.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49861.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=542

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  425  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIG  484

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++FSS+D+KL VD
Sbjct  485  PILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSSIDKKLIVD  541



>ref|XP_007143804.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
 gb|ESW15798.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
Length=527

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATSG+TSFLFKEV +IHNLPTQDF VRNDMGCGSTIG
Sbjct  410  HEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQDFAVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+RE+CGKEDIDIAYKHFKAFYQ+FSSVD+ L VD
Sbjct  470  PILASGVGIRTVDCGIAQLSMHSIREMCGKEDIDIAYKHFKAFYQSFSSVDKMLTVD  526



>ref|XP_008446766.1| PREDICTED: probable aspartyl aminopeptidase [Cucumis melo]
Length=527

 Score =   224 bits (570),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIK+NA+QRYATSGVT+FLF+EV RIHNLPTQDFVVRNDMGCGSTIG
Sbjct  410  HEEHHRPEMQKGIVIKYNANQRYATSGVTAFLFREVGRIHNLPTQDFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHS+REICGKED+D AYK+FKAFY+TFSS+DRKL VD
Sbjct  470  PILASGVGIRTVDCGIPQLSMHSIREICGKEDVDTAYKYFKAFYKTFSSIDRKLKVD  526



>ref|XP_004496198.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=534

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYAT+G+TSFLFKEV +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  417  HEEHHRPELQKGLVIKHNANQRYATTGITSFLFKEVGKIHNLPTQEFVVRNDMGCGSTIG  476

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHS+REICGKEDIDIAYK+FKAFYQ FSS+D+ L VD
Sbjct  477  PILASGVGIRTVDCGIPQLSMHSIREICGKEDIDIAYKYFKAFYQNFSSIDKMLTVD  533



>gb|KHN00906.1| Aspartyl aminopeptidase [Glycine soja]
Length=518

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATSG+TSFLFKEV +IHNLPTQ+F VRNDMGCGSTIG
Sbjct  401  HEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQEFAVRNDMGCGSTIG  460

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ FSSVD+ L VD
Sbjct  461  PILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQNFSSVDKMLTVD  517



>ref|XP_003556268.2| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=539

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATSG+TSFLFKEV +IHNLPTQ+F VRNDMGCGSTIG
Sbjct  422  HEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQEFAVRNDMGCGSTIG  481

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ FSSVD+ L VD
Sbjct  482  PILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQNFSSVDKMLTVD  538



>ref|XP_010032079.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032080.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Eucalyptus 
grandis]
 ref|XP_010032081.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Eucalyptus 
grandis]
 gb|KCW51471.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=522

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ+F VRNDMGCGSTIG
Sbjct  405  HEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQEFAVRNDMGCGSTIG  464

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAY+HFKAFYQ+FS VD KL +D
Sbjct  465  PILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYQHFKAFYQSFSHVDSKLTID  521



>gb|EMT26810.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=332

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE QKG VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  215  HEEYHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  274

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKEDID  YKHFKAF++ FS +D+KLNVD
Sbjct  275  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTTYKHFKAFFEMFSDIDQKLNVD  331



>ref|XP_010543610.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=533

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRP+  KG VIKHNA+QRYATSG+TS LFKEVA++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  417  HEEHHRPQMHKGLVIKHNANQRYATSGITSLLFKEVAKLHNLPTQEFVVRNDMGCGSTIG  476

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY++FS++DRKL VD
Sbjct  477  PILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYESFSTIDRKLTVD  533



>ref|XP_002311031.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88398.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=496

 Score =   221 bits (563),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q+FVVRNDMGCGSTIG
Sbjct  380  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQEFVVRNDMGCGSTIG  439

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ FSS+D+KL VD
Sbjct  440  PILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQNFSSIDKKLEVD  496



>ref|XP_009356123.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=531

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRP+ QKG VIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ+FVVRNDMGCGSTIG
Sbjct  414  HEEHHRPQMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQEFVVRNDMGCGSTIG  473

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREICGKEDIDIAY +FKAFYQTFSS+D++L+VD
Sbjct  474  PILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYNYFKAFYQTFSSIDKELDVD  530



>ref|XP_002311016.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88383.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=526

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q+FVVRNDMGCGSTIG
Sbjct  410  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQEFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ FSS+D+KL VD
Sbjct  470  PILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQNFSSIDKKLEVD  526



>ref|XP_011032849.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=526

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q+FVVRNDMGCGSTIG
Sbjct  410  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQEFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ FSS+D+KL VD
Sbjct  470  PILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQNFSSIDKKLEVD  526



>ref|XP_003565148.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=520

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE Q+G VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  403  HEEHHRPELQRGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  462

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKEDID AYKHFKAF++ FS +D+KLNVD
Sbjct  463  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTAYKHFKAFFEMFSDIDQKLNVD  519



>ref|XP_010907134.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Elaeis 
guineensis]
Length=448

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EEHHRPE QKG VIKHN++QRYATS VT+FLFKEVA IHNLP Q+FVVRNDMGCGSTIG
Sbjct  331  YEEHHRPELQKGLVIKHNSNQRYATSAVTAFLFKEVANIHNLPVQEFVVRNDMGCGSTIG  390

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICGKED+DIAYKHF AF+Q+FS +DRKL+VD
Sbjct  391  PILASGVGIRTVDCGIPQLSMHSVREICGKEDVDIAYKHFMAFFQSFSDIDRKLSVD  447



>ref|XP_006645339.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=525

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATS VT+FLFKE+AR+HNLP Q+FVVRNDMGCGSTIG
Sbjct  408  HEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARLHNLPVQEFVVRNDMGCGSTIG  467

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  YKHFKAF++ FS +DRKLNVD
Sbjct  468  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYKHFKAFFEMFSDIDRKLNVD  524



>ref|NP_001045513.1| Os01g0967900 [Oryza sativa Japonica Group]
 dbj|BAB85315.1| putative aspartyl aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAF07427.1| Os01g0967900 [Oryza sativa Japonica Group]
 gb|EEE56077.1| hypothetical protein OsJ_04900 [Oryza sativa Japonica Group]
Length=525

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATS VT+FLFKE+AR+HNLP Q+FVVRNDMGCGSTIG
Sbjct  409  HEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARLHNLPVQEFVVRNDMGCGSTIG  468

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  YKHFKAF++ FS +DRKLNVD
Sbjct  469  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYKHFKAFFEMFSDIDRKLNVD  525



>emb|CDX70207.1| BnaA10g25560D [Brassica napus]
Length=528

 Score =   219 bits (559),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP QDFVVRNDMGCGSTIG
Sbjct  411  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQDFVVRNDMGCGSTIG  470

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVDRKL VD
Sbjct  471  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDRKLTVD  527



>ref|XP_006398926.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
 gb|ESQ40379.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
Length=523

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  406  HEENHRPQIHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  465

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAYKHFKAFYQ+FSSVDRKL VD
Sbjct  466  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYKHFKAFYQSFSSVDRKLIVD  522



>ref|XP_008674488.1| PREDICTED: probable aspartyl aminopeptidase [Zea mays]
Length=433

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  316  HEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  375

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ FS +DRKLNVD
Sbjct  376  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEMFSDIDRKLNVD  432



>emb|CDY44874.1| BnaC09g50740D [Brassica napus]
Length=517

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H LP QDFVVRNDMGCGSTIG
Sbjct  400  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHGLPIQDFVVRNDMGCGSTIG  459

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVDRKL VD
Sbjct  460  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDRKLTVD  516



>ref|XP_009122574.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=527

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP QDFVVRNDMGCGSTIG
Sbjct  410  HEENHRPQIHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQDFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVDRKL VD
Sbjct  470  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDRKLTVD  526



>gb|EYU19780.1| hypothetical protein MIMGU_mgv1a004147mg [Erythranthe guttata]
Length=542

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP  QKG VIKHNA+QRYATSG+TSFLFKEVA++HNLP Q+FVVRNDMGCGSTIG
Sbjct  425  HEENHRPLLQKGLVIKHNANQRYATSGITSFLFKEVAKLHNLPIQEFVVRNDMGCGSTIG  484

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+GVGIRTVDCGI QLSMHSVREICGKEDIDIAYKHF AFY+TFSS+D+KL VD
Sbjct  485  PILAAGVGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFMAFYRTFSSIDKKLRVD  541



>dbj|BAJ86698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE QKG VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  396  HEEYHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  455

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKEDID  YKHFKAF++ FS +D+KLNVD
Sbjct  456  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTTYKHFKAFFEMFSDIDQKLNVD  512



>gb|EEC72239.1| hypothetical protein OsI_05355 [Oryza sativa Indica Group]
Length=493

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATS VT+FLFKE+AR HNLP Q+FVVRNDMGCGSTIG
Sbjct  377  HEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARHHNLPVQEFVVRNDMGCGSTIG  436

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ FS +DRKLNVD
Sbjct  437  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEMFSDIDRKLNVD  493



>ref|XP_010907133.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Elaeis 
guineensis]
Length=528

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EEHHRPE QKG VIKHN++QRYATS VT+FLFKEVA IHNLP Q+FVVRNDMGCGSTIG
Sbjct  411  YEEHHRPELQKGLVIKHNSNQRYATSAVTAFLFKEVANIHNLPVQEFVVRNDMGCGSTIG  470

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICGKED+DIAYKHF AF+Q+FS +DRKL+VD
Sbjct  471  PILASGVGIRTVDCGIPQLSMHSVREICGKEDVDIAYKHFMAFFQSFSDIDRKLSVD  527



>ref|XP_006287486.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
 gb|EOA20384.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
Length=529

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSGVTSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  412  HEENHRPQLHKGLVIKHNANQRYATSGVTSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  471

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVDRKL VD
Sbjct  472  PILASGIGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYESFSSVDRKLMVD  528



>gb|KDP35783.1| hypothetical protein JCGZ_10419 [Jatropha curcas]
Length=526

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE +KG VIKHNA+QRYAT+G+T+FLFKEV +I +LPTQ+FVVRNDMGCGSTIG
Sbjct  410  HEEHHRPEMKKGLVIKHNANQRYATNGITAFLFKEVGKILSLPTQEFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVRE+C KEDIDIAYKHFKAFY+ FSS+D+KL VD
Sbjct  470  PILASGVGIRTVDCGIAQLSMHSVREVCAKEDIDIAYKHFKAFYENFSSIDKKLQVD  526



>ref|XP_010490993.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  413  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  472

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICG +DIDIAY+HFKAFYQ+FSSVDRKL VD
Sbjct  473  PILASGVGIRTVDCGIPQLSMHSVREICGTDDIDIAYRHFKAFYQSFSSVDRKLVVD  529



>ref|XP_002457006.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
 gb|EES02126.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
Length=524

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  407  HEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  466

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++ FS +DRKLNVD
Sbjct  467  PILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFEMFSDIDRKLNVD  523



>ref|XP_004971394.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Setaria 
italica]
Length=525

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  408  HEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  467

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHS+RE+CGKED+D  Y+HFKAF++ FS +DRKLNVD
Sbjct  468  PILASGVGIRTVDCGIPQLSMHSIREMCGKEDVDTTYRHFKAFFEMFSDIDRKLNVD  524



>ref|XP_004971395.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Setaria 
italica]
Length=523

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRPE QKG VIKHNA+QRYATS VT+FLFKE+ARIHNLP Q+FVVRNDMGCGSTIG
Sbjct  406  HEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQEFVVRNDMGCGSTIG  465

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHS+RE+CGKED+D  Y+HFKAF++ FS +DRKLNVD
Sbjct  466  PILASGVGIRTVDCGIPQLSMHSIREMCGKEDVDTTYRHFKAFFEMFSDIDRKLNVD  522



>gb|KFK24913.1| hypothetical protein AALP_AA8G041200 [Arabis alpina]
Length=523

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  406  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPVQEFVVRNDMGCGSTIG  465

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVDRKL +D
Sbjct  466  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDRKLVMD  522



>ref|XP_002873165.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49424.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  408  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  467

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVD+KL VD
Sbjct  468  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDKKLVVD  524



>ref|NP_196091.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 emb|CAB86013.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
 dbj|BAB08975.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AED90774.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  409  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  468

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVD+KL VD
Sbjct  469  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDKKLVVD  525



>dbj|BAC43404.1| putative aspartyl aminopeptidase [Arabidopsis thaliana]
Length=526

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  409  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  468

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY++FSSVD+KL VD
Sbjct  469  PILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDKKLVVD  525



>ref|XP_008788174.1| PREDICTED: probable aspartyl aminopeptidase [Phoenix dactylifera]
Length=533

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EEHHRPE QKG V+KHNA+QRYATS VT+FLFKEVA IHNLP Q+FVVRNDMGCGSTIG
Sbjct  416  YEEHHRPELQKGLVVKHNANQRYATSAVTAFLFKEVANIHNLPVQEFVVRNDMGCGSTIG  475

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVRE+CGKED+DIAYKHF AF+Q+FS +D KL+VD
Sbjct  476  PILASGVGIRTVDCGIPQLSMHSVREVCGKEDVDIAYKHFLAFFQSFSDIDGKLSVD  532



>ref|XP_010423546.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=536

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIKHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  419  HEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  478

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICG +DIDIAY+HFKAFY++FSSVDRKL VD
Sbjct  479  PILASGVGIRTVDCGIPQLSMHSVREICGTDDIDIAYRHFKAFYRSFSSVDRKLVVD  535



>ref|XP_002524995.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF37402.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=526

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYAT+G+T+FLFKEV  I  LPTQ+FVVRNDMGCGSTIG
Sbjct  410  HEEHHRPEMQKGLVIKHNANQRYATNGITAFLFKEVGNILKLPTQEFVVRNDMGCGSTIG  469

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRT+DCGI QLSMHSVRE+C KED+D AYKHFKAFYQ FSS+D+KL VD
Sbjct  470  PILASGVGIRTIDCGIPQLSMHSVREVCAKEDVDTAYKHFKAFYQNFSSIDKKLQVD  526



>ref|XP_010452373.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG V+KHNA+QRYATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIG
Sbjct  413  HEENHRPQLHKGLVVKHNANQRYATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIG  472

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICG  DIDIAY+HFKAFY++FSSVDRKL VD
Sbjct  473  PILASGVGIRTVDCGIPQLSMHSVREICGTNDIDIAYRHFKAFYRSFSSVDRKLVVD  529



>ref|XP_009390025.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EEHHRP  QKG VIKHNA+QRYATS +T+FLFKEVA +HNLP Q+FVVRNDMGCGSTIG
Sbjct  419  YEEHHRPALQKGVVIKHNANQRYATSSLTAFLFKEVANVHNLPVQEFVVRNDMGCGSTIG  478

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICGK+DIDIAYKHF AF+Q+FS +D+KL+VD
Sbjct  479  PILASGVGIRTVDCGIPQLSMHSVREICGKDDIDIAYKHFMAFFQSFSDIDKKLSVD  535



>gb|KHN37829.1| Aspartyl aminopeptidase [Glycine soja]
Length=500

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRP+ Q+  VIKHNA+QRYATSG+T FLFKE  +IHNLPTQ+F VRN MGCGSTIG
Sbjct  383  HEELHRPKLQRVLVIKHNANQRYATSGITPFLFKEAGKIHNLPTQEFAVRNGMGCGSTIG  442

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGIAQLSMHS+REIC KEDIDIAYKHFKAFYQ+FSSVD+ L VD
Sbjct  443  PILASGVGIRTVDCGIAQLSMHSIREICAKEDIDIAYKHFKAFYQSFSSVDKMLTVD  499



>gb|EPS58587.1| aspartyl aminopeptidase, partial [Genlisea aurea]
Length=468

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+E+HRP  QKG VIKHNA+QRYATSGVT FL KEVAR H+LP Q+FVVRNDMGCGSTIG
Sbjct  351  HDENHRPVLQKGLVIKHNANQRYATSGVTGFLLKEVARSHDLPVQEFVVRNDMGCGSTIG  410

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVDCGI QLSMHSVREICGKED++ AY+ FKAFY+TFS +D KL VD
Sbjct  411  PILASGMGIRTVDCGIPQLSMHSVREICGKEDVESAYRLFKAFYRTFSGIDEKLTVD  467



>ref|XP_006851486.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
 gb|ERN13067.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
Length=546

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE+ HRP  QKG VIKHNA+QRYAT+ VT+FLFKE+A   NLPTQ+FVVRNDMGCGSTIG
Sbjct  428  HEDQHRPVLQKGIVIKHNANQRYATNSVTAFLFKEIASACNLPTQEFVVRNDMGCGSTIG  487

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVDCGI QLSMHSVREICG+ED+D AYKHFKAF++ FSS+D+KL +D
Sbjct  488  PILASGVGIRTVDCGIPQLSMHSVREICGREDVDTAYKHFKAFFEMFSSIDKKLCID  544



>ref|XP_002975004.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
 gb|EFJ23789.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
Length=477

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  +G VIKHNA+QRYAT+ VT+FLFKEVAR+  + TQ+F+VRNDMGCGSTIG
Sbjct  360  HEENHQPKLHEGLVIKHNANQRYATNSVTAFLFKEVARLAGIQTQNFIVRNDMGCGSTIG  419

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVDCG+ QLSMHS+RE+CG +DID AYKHFKAFY+TF+S+D++++VD
Sbjct  420  PILASGIGIRTVDCGMPQLSMHSIREMCGTQDIDTAYKHFKAFYRTFTSIDQQVSVD  476



>ref|XP_002977420.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
 gb|EFJ21424.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
Length=445

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  +G VIKHNA+QRYAT+ V++FLFKEVAR+  + TQ+F+VRNDMGCGSTIG
Sbjct  328  HEENHQPKLHEGLVIKHNANQRYATNSVSAFLFKEVARLAGIQTQNFIVRNDMGCGSTIG  387

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVDCG+ QLSMHS+RE+CG +DID AYKHFKAFY+TF+S+D++++VD
Sbjct  388  PILASGIGIRTVDCGMPQLSMHSIREMCGTQDIDTAYKHFKAFYRTFTSIDQQVSVD  444



>dbj|BAD94988.1| aspartyl aminopeptidase [Arabidopsis thaliana]
Length=96

 Score =   178 bits (451),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  663  YATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  484
            YATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH
Sbjct  1    YATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  60

Query  483  SVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            SVREICG +DIDIAY+HFKAFY++FSSVD+KL VD
Sbjct  61   SVREICGTDDIDIAYRHFKAFYRSFSSVDKKLVVD  95



>ref|XP_001420830.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99123.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=465

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+  KG V+KHNA+QRYAT+ VTS+LF+E A++ N+PTQDFVVRNDMGCGSTIG
Sbjct  348  HEDNHQPKMHKGMVVKHNANQRYATTAVTSYLFRECAKMENVPTQDFVVRNDMGCGSTIG  407

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI +KHF AFY+ FS VD  + VD
Sbjct  408  PIIAAGVGIRTVDVGIPQLSMHSVREMCGTEDIDICFKHFTAFYKNFSKVDETVTVD  464



>ref|XP_001751765.1| predicted protein [Physcomitrella patens]
 gb|EDQ83200.1| predicted protein, partial [Physcomitrella patens]
Length=471

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  +G VIK+NA+QRYAT+ VT+FLFKEVA++  +PTQ+FVVRNDMGCGSTIG
Sbjct  355  HEENHQPKLHEGLVIKYNANQRYATNTVTAFLFKEVAKVAGVPTQNFVVRNDMGCGSTIG  414

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVD G+ QLSMHSVRE+CG ED+D++Y+HFKAFY+ F+++D KL VD
Sbjct  415  PILASGIGIRTVDVGMPQLSMHSVREMCGTEDVDLSYRHFKAFYELFTTID-KLTVD  470



>gb|ABR25597.1| aspartyl aminopeptidase [Oryza sativa Indica Group]
Length=149

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H+LP QDFVVRNDMGCGSTIG
Sbjct  32   HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHHLPIQDFVVRNDMGCGSTIG  91

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ F+ +D K+ VDC
Sbjct  92   PILASGVGIRTVDIGAPQLSMHSIREMCAVDDIKHSYEHFKAYFEEFTELDSKVKVDC  149



>ref|XP_003082377.1| aspartyl aminopeptidase (ISS) [Ostreococcus tauri]
Length=486

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  KG V+KHNA+QRYAT+ VT +LF+E A++ N+PTQDFVVRNDMGCGSTIG
Sbjct  370  HEENHQPKMHKGMVVKHNANQRYATTAVTGYLFRECAKMENVPTQDFVVRNDMGCGSTIG  429

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI  +HF AFY  F+ VD  + VD
Sbjct  430  PIVAAGVGIRTVDVGIPQLSMHSVREMCGVEDIDICLRHFTAFYDNFAKVDSTVTVD  486



>ref|XP_008360788.1| PREDICTED: probable aspartyl aminopeptidase, partial [Malus domestica]
Length=206

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+ +F+E+AR H+LP QDFVVRNDM CGSTIG
Sbjct  89   HEENHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQDFVVRNDMACGSTIG  148

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D K+ VD 
Sbjct  149  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFTHLDAKIKVDA  206



>ref|XP_011024060.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=489

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P    G VIKHNA+QRYAT+ +TSFLF+E+A  HNLPTQDFVVRNDMGCGSTIG
Sbjct  372  HEENHQPRLHGGLVIKHNANQRYATNAITSFLFREIATKHNLPTQDFVVRNDMGCGSTIG  431

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  432  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQDFSHLDAKITVD  488



>emb|CEF99925.1| Peptidase M18 [Ostreococcus tauri]
Length=549

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  KG V+KHNA+QRYAT+ VT +LF+E A++ N+PTQDFVVRNDMGCGSTIG
Sbjct  433  HEENHQPKMHKGMVVKHNANQRYATTAVTGYLFRECAKMENVPTQDFVVRNDMGCGSTIG  492

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI  +HF AFY  F+ VD  + VD
Sbjct  493  PIVAAGVGIRTVDVGIPQLSMHSVREMCGVEDIDICLRHFTAFYDNFAKVDSTVTVD  549



>dbj|BAK02635.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ +T+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  68   HEENHQPKLHGGLVIKHNANQRYATNAMTAFIFREIAERHQLPIQDFVVRNDMACGSTIG  127

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ F+ +D K+ VDC
Sbjct  128  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDISHSYEHFKAYFEEFTELDNKVKVDC  185



>ref|XP_008464464.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Cucumis 
melo]
Length=482

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK+NA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  365  HEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQDFVVRNDMGCGSTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ FSS+D KL VD
Sbjct  425  PILASGVGIRTVDVGAPQLSMHSIREMCATDDVNHSYEHFKAYYEEFSSLDEKLTVD  481



>ref|XP_002318119.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEE96339.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=486

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTSFLF+E+A  HNLPTQDFVVRNDM CGSTIG
Sbjct  369  HEDNHQPKLHGGLVIKHNANQRYATNAVTSFLFREIATKHNLPTQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSDLDAKITVD  485



>ref|XP_011044185.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=486

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTSFLF+E+A  HNLPTQDFVVRNDM CGSTIG
Sbjct  369  HEDNHQPKLHGGLVIKHNANQRYATNAVTSFLFREIATKHNLPTQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSDLDAKITVD  485



>ref|XP_002963681.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
 gb|EFJ35552.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
Length=475

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  KG V+K+NA+QRYAT+ VTSF+FKE+AR  +LPTQDFVVRNDM CGSTIG
Sbjct  359  HEENHQPKMHKGLVVKYNANQRYATNAVTSFIFKEIARRQDLPTQDFVVRNDMACGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+CG +D+  +Y+HFK F++ FS++D+ +NVD
Sbjct  419  PILASGVGIRTVDVGAPQLSMHSIREMCGVDDVGYSYRHFKLFFEDFSALDQHVNVD  475



>ref|XP_004165826.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartyl aminopeptidase-like 
[Cucumis sativus]
Length=485

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK+NA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  368  HEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQDFVVRNDMSCGSTIG  427

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ FSS+D+KL VD
Sbjct  428  PILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYEEFSSLDQKLTVD  484



>ref|XP_004138058.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=485

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK+NA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  368  HEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQDFVVRNDMSCGSTIG  427

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ FSS+D+KL VD
Sbjct  428  PILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYEEFSSLDQKLTVD  484



>ref|XP_002974770.1| hypothetical protein SELMODRAFT_101663 [Selaginella moellendorffii]
 gb|EFJ24290.1| hypothetical protein SELMODRAFT_101663 [Selaginella moellendorffii]
Length=498

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  KG V+K+NA+QRYAT+ VTSF+FKE+AR  +LPTQDFVVRNDM CGSTIG
Sbjct  382  HEENHQPKMHKGLVVKYNANQRYATNAVTSFIFKEIARRQDLPTQDFVVRNDMACGSTIG  441

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+CG +D+  +Y+HFK F++ FS++D+ +NVD
Sbjct  442  PILASGVGIRTVDVGAPQLSMHSIREMCGVDDVGYSYRHFKLFFEDFSALDQHVNVD  498



>gb|KGN63496.1| hypothetical protein Csa_1G002160 [Cucumis sativus]
Length=512

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK+NA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  395  HEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQDFVVRNDMSCGSTIG  454

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+ FSS+D+KL VD
Sbjct  455  PILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYEEFSSLDQKLTVD  511



>ref|XP_002511215.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF51817.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=441

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P    G VIKHNA+QRYAT+ VTSFLFKE+A  HNLP QDFVVRNDM CGSTIG
Sbjct  324  HEENHQPRMHGGLVIKHNANQRYATNSVTSFLFKEIASKHNLPVQDFVVRNDMPCGSTIG  383

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ FS +D K+ VD
Sbjct  384  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFEDFSHLDSKITVD  440



>ref|XP_002321687.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEF05814.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ +TSFLF+E+A  H+LPTQDFVVRNDMGCGSTIG
Sbjct  372  HEENHQPKLHGGLVIKHNANQRYATNAITSFLFREIATKHDLPTQDFVVRNDMGCGSTIG  431

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q  S +D K+ VD
Sbjct  432  PILASGVGIRTVDVGAPQLSMHSIREMCSVDDVKYSYEHFKAFFQDISHLDAKITVD  488



>gb|KFK26680.1| hypothetical protein AALP_AA8G278900 [Arabis alpina]
Length=477

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  360  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQDFVVRNDMGCGSTIG  419

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D KL+VD
Sbjct  420  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQEFTVLDTKLSVD  476



>ref|XP_010536640.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=489

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK NA+QRYAT+ VTSF+FKE+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  372  HEENHQPKMHGGLVIKTNANQRYATNAVTSFIFKEIAEKHNLPVQDFVVRNDMGCGSTIG  431

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D KL +D
Sbjct  432  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQEFAHLDSKLTID  488



>ref|XP_008239439.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=490

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTS +F+E+AR HNLP QDFVVRNDM CGSTIG
Sbjct  373  HEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIARNHNLPVQDFVVRNDMACGSTIG  432

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD 
Sbjct  433  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQEFSHLDEKIKVDA  490



>sp|B9RAJ0.2|DNPEP_RICCO RecName: Full=Probable aspartyl aminopeptidase [Ricinus communis]
Length=491

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P    G VIKHNA+QRYAT+ VTSFLFKE+A  HNLP QDFVVRNDM CGSTIG
Sbjct  374  HEENHQPRMHGGLVIKHNANQRYATNSVTSFLFKEIASKHNLPVQDFVVRNDMPCGSTIG  433

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ FS +D K+ VD
Sbjct  434  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFEDFSHLDSKITVD  490



>ref|XP_009134060.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=478

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  361  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQDFVVRNDMGCGSTIG  420

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D KL VD
Sbjct  421  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQEFTHLDAKLTVD  477



>emb|CDY34036.1| BnaC03g27790D [Brassica napus]
Length=478

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  361  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQDFVVRNDMGCGSTIG  420

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D KL VD
Sbjct  421  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQEFTHLDAKLTVD  477



>emb|CDX83160.1| BnaA03g23460D [Brassica napus]
Length=478

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  361  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQDFVVRNDMGCGSTIG  420

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D KL VD
Sbjct  421  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQEFTHLDAKLTVD  477



>ref|NP_200824.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 dbj|BAA97497.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AAK73942.1| AT5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AAM91365.1| At5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AED97287.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=477

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  360  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQDFVVRNDMGCGSTIG  419

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D KL +D
Sbjct  420  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQEFTHLDAKLTID  476



>gb|AAM61631.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=477

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  360  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQDFVVRNDMGCGSTIG  419

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D KL +D
Sbjct  420  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQEFTHLDAKLTID  476



>ref|XP_002866374.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42633.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  360  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQDFVVRNDMGCGSTIG  419

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q F+ +D KL VD
Sbjct  420  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQEFTHLDAKLTVD  476



>ref|NP_001066463.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|ABA96906.1| Aspartyl aminopeptidase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29482.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|EAY82691.1| hypothetical protein OsI_37907 [Oryza sativa Indica Group]
 gb|EAZ20072.1| hypothetical protein OsJ_35672 [Oryza sativa Japonica Group]
Length=478

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H+LP QDFVVRNDMGCGSTIG
Sbjct  361  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHHLPIQDFVVRNDMGCGSTIG  420

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ F+ +D K+ VDC
Sbjct  421  PILASGVGIRTVDIGAPQLSMHSIREMCAVDDIKHSYEHFKAYFEEFTELDSKVKVDC  478



>ref|XP_007209960.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
 gb|EMJ11159.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
Length=488

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTS +F+E+AR HNLP QDF VRNDM CGSTIG
Sbjct  371  HEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIARNHNLPVQDFAVRNDMACGSTIG  430

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD 
Sbjct  431  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVQYSYEHFKAFFQEFSHLDEKIKVDA  488



>tpg|DAA58400.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=321

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  204  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQDFVVRNDMACGSTIG  263

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ F+ +D K+ VD
Sbjct  264  PILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFEEFTELDGKVKVD  320



>gb|AFK46082.1| unknown [Lotus japonicus]
Length=479

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK+NA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  362  HEENHQPKLHAGLVIKNNANQRYATNAVTSFIFREIASKHNLPVQDFVVRNDMACGSTIG  421

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVD G  QLSMHS+RE+C  +D++ +YKHFKAF+Q FS +D K+ VD
Sbjct  422  PILASGMGIRTVDVGAPQLSMHSIREMCAIDDVNYSYKHFKAFFQEFSHLDAKIVVD  478



>gb|EYU43065.1| hypothetical protein MIMGU_mgv1a005789mg [Erythranthe guttata]
Length=470

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSFLF+E+A  HNLP QDFVVR+DM CGSTIG
Sbjct  353  HEENHQPKMHGGLVIKHNANQRYATNAVTSFLFREIAAKHNLPVQDFVVRSDMLCGSTIG  412

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI+ASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS++D KL VD
Sbjct  413  PIIASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSNLDAKLTVD  469



>ref|XP_006664453.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=474

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H+LP QDFVVRNDMGCGSTIG
Sbjct  357  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAENHHLPVQDFVVRNDMGCGSTIG  416

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKA+++ F+ +D K+ VDC
Sbjct  417  PILASGVGIRTVDIGAPQLSMHSIREMCAVDDVSHSYEHFKAYFEEFTELDSKVRVDC  474



>ref|XP_006476998.1| PREDICTED: probable aspartyl aminopeptidase-like [Citrus sinensis]
Length=483

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTSF+F+EVA  HNLP QDFVVRNDM CGSTIG
Sbjct  366  HEDNHQPKLHGGLVIKHNANQRYATNAVTSFVFREVASKHNLPVQDFVVRNDMACGSTIG  425

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  426  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSELDAKIKVD  482



>ref|XP_011083884.1| PREDICTED: probable aspartyl aminopeptidase [Sesamum indicum]
Length=480

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSFLF+E+A  H LP QDFV+RNDM CGSTIG
Sbjct  363  HEENHQPKMHSGLVIKHNANQRYATNAVTSFLFREIAAKHKLPVQDFVIRNDMLCGSTIG  422

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D KL VD
Sbjct  423  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYQHFKAFFQEFSHLDAKLAVD  479



>ref|XP_006440072.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
 gb|ESR53312.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
Length=515

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTSF+F+EVA  HNLP QDFVVRNDM CGSTIG
Sbjct  398  HEDNHQPKLHGGLVIKHNANQRYATNAVTSFVFREVASKHNLPVQDFVVRNDMACGSTIG  457

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  458  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSELDAKIKVD  514



>ref|XP_006402123.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
 gb|ESQ43576.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
Length=465

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDMGCGSTIG
Sbjct  348  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAVKHNLPVQDFVVRNDMGCGSTIG  407

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ F+ +D KL VD
Sbjct  408  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFREFTHLDAKLAVD  464



>ref|XP_010674696.1| PREDICTED: probable aspartyl aminopeptidase [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+FKE+A  HNLP Q+FVVRNDM CGSTIG
Sbjct  370  HEENHQPKLHGGLVIKHNANQRYATNAVTSFIFKEIALKHNLPVQEFVVRNDMPCGSTIG  429

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAFY  FS +D KL VD 
Sbjct  430  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVMHSYMHFKAFYMEFSDLDSKLTVDA  487



>gb|KHF99832.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=463

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTS +F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  346  HEENHQPKLHGGLVIKHNANQRYATNAVTSLIFREIAMKHNLPIQDFVVRNDMPCGSTIG  405

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRT+D G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  406  PILASGVGIRTIDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSQLDAKITVD  462



>ref|XP_007037930.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
 gb|EOY22431.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
Length=520

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  403  HEDNHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMQHNLPVQDFVVRNDMPCGSTIG  462

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  463  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSHLDTKITVD  519



>ref|XP_006280394.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
 gb|EOA13292.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
Length=478

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+E+H+P+   G VIKHNA+QRYAT+ +TSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  361  HDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQDFVVRNDMACGSTIG  420

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKAF+Q F+ +D KL VD
Sbjct  421  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVEHSYEHFKAFFQEFTHLDAKLTVD  477



>ref|XP_001756754.1| predicted protein [Physcomitrella patens]
 gb|EDQ78351.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  +G VIK NA+QRYAT+ +TSF+F+E+A++ NLPTQ+FVVRND+ CGSTIG
Sbjct  349  HEENHQPKMHRGLVIKDNANQRYATNAITSFIFREIAKLRNLPTQNFVVRNDVACGSTIG  408

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVD G  QLSMHS+RE+CG +D+  +Y HFKAF++ FS++D +L VD
Sbjct  409  PILASGIGIRTVDVGAPQLSMHSIREMCGVDDVGYSYNHFKAFFEDFSALDAQLAVD  465



>ref|XP_002458215.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
 gb|EES03335.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
Length=475

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  358  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPVQDFVVRNDMACGSTIG  417

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  AY+HFKA+Y+ F+ +D K+ VD
Sbjct  418  PILASGVGIRTVDIGAPQLSMHSIREMCAVDDISHAYEHFKAYYEEFTELDSKVKVD  474



>ref|XP_008367478.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+X  G VIKHNA+QRYAT+ VT+ +F+E+AR H+LP QDFVVRNDM CGSTIG
Sbjct  369  HEENHQPKXHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D K+ VD 
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFTHLDAKIKVDA  486



>ref|XP_008392833.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+X  G VIKHNA+QRYAT+ VT+ +F+E+AR H+LP QDFVVRNDM CGSTIG
Sbjct  369  HEENHQPKXHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D K+ VD 
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFTHLDAKIKVDA  486



>ref|XP_010026684.1| PREDICTED: probable aspartyl aminopeptidase [Eucalyptus grandis]
 gb|KCW83183.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=473

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A+ H+LP QDFVVRNDM CGSTIG
Sbjct  356  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAQKHDLPIQDFVVRNDMPCGSTIG  415

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA++Q FS +D K+ VD
Sbjct  416  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVNHSYEHFKAYFQEFSYLDAKIAVD  472



>ref|XP_003578741.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=475

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDMGCGSTIG
Sbjct  359  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEKHQLPIQDFVVRNDMGCGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  AY+HFKA+++ F+ +D K+ +D
Sbjct  419  PILASGVGIRTVDIGAPQLSMHSIREMCATDDVKHAYEHFKAYFEEFTELDSKIIID  475



>ref|XP_007137936.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
 gb|ESW09930.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
Length=481

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +H+P+   G VIK+NA+QRYAT+ VTSFLF+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  364  HEANHQPKLHGGLVIKNNANQRYATNIVTSFLFREIASKHNLPVQDFVVRNDMSCGSTIG  423

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAFYQ FS +D K+ VD
Sbjct  424  PILASGVGIRTVDVGAPQLSMHSIREVCAVDDVKYSYEHFKAFYQEFSHLDGKMVVD  480



>ref|XP_009346502.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VT+ +F+E+AR H+LP QDFVVRNDM CGSTIG
Sbjct  369  HEQNHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D K+ VD 
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQEFTHLDAKIKVDA  486



>ref|XP_010456062.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=475

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+E+H+P+   G VIKHNA+QRYAT+ +TSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  358  HDENHQPKMHGGLVIKHNANQRYATNALTSFIFREIAEKHNLPVQDFVVRNDMACGSTIG  417

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q F+ +D KL VD
Sbjct  418  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQEFTHLDAKLTVD  474



>ref|NP_001159225.1| hypothetical protein [Zea mays]
 gb|ACN25500.1| unknown [Zea mays]
 tpg|DAA58399.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=407

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  290  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQDFVVRNDMACGSTIG  349

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ F+ +D K+ VD
Sbjct  350  PILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFEEFTELDGKVKVD  406



>ref|XP_009359462.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ +T+ +F+E+AR H+LP QDFVVRNDM CGSTIG
Sbjct  369  HEENHQPKLHGGLVIKHNANQRYATNAITALIFREIARNHSLPVQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D K+ VD 
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVRHSYEHFKAFFQEFTHLDAKIKVDA  486



>ref|XP_009336570.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ +T+ +F+E+AR H+LP QDFVVRNDM CGSTIG
Sbjct  369  HEQNHQPKLHGGLVIKHNANQRYATNAITALIFREIARNHSLPVQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D K+ VD 
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQEFTHLDAKIKVDA  486



>ref|XP_010483659.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+E+H+P+   G VIKHNA+QRYAT+ +TSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  361  HDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQDFVVRNDMACGSTIG  420

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q F+ +D KL VD
Sbjct  421  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQEFTHLDAKLTVD  477



>ref|XP_008374264.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VT+ +F+E+AR H+LP QDFVVRNDM CGSTIG
Sbjct  369  HEQNHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQDFVVRNDMACGSTIG  428

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q F+ +D K+ VD 
Sbjct  429  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFTRLDSKIKVDA  486



>ref|XP_010443807.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+E+H+P+   G VIKHNA+QRYAT+ +TSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  361  HDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQDFVVRNDMACGSTIG  420

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q F+ +D KL VD
Sbjct  421  PILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQEFTHLDAKLTVD  477



>gb|KCW83184.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=508

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A+ H+LP QDFVVRNDM CGSTIG
Sbjct  391  HEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAQKHDLPIQDFVVRNDMPCGSTIG  450

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA++Q FS +D K+ VD
Sbjct  451  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVNHSYEHFKAYFQEFSYLDAKIAVD  507



>ref|XP_006826610.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda]
 gb|ERM93847.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda]
Length=344

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P    G VIKHNA+QRYA++ VTSF+F+E+A+ H LP Q+FVVRNDM CGSTIG
Sbjct  227  HEENHQPRLHGGLVIKHNANQRYASNSVTSFIFREIAKQHKLPVQEFVVRNDMACGSTIG  286

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+  F+ +D K++VD
Sbjct  287  PILASGVGIRTVDVGAPQLSMHSIREMCSVDDVKHSYEHFKAFFHEFAQLDAKISVD  343



>ref|XP_008673044.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN26704.1| unknown [Zea mays]
 gb|ACN27911.1| unknown [Zea mays]
 tpg|DAA58398.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=475

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  358  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQDFVVRNDMACGSTIG  417

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ F+ +D K+ VD
Sbjct  418  PILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFEEFTELDGKVKVD  474



>ref|XP_003526970.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +H+P+   G VIK NASQRYAT+ VTSF+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  370  HEANHQPKLHGGLVIKTNASQRYATNVVTSFIFREIASKHKLPVQDFVVRNDMSCGSTIG  429

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+REIC  +D+  +Y+HFKAFYQ FS VD K+ VD
Sbjct  430  PILASGVGIRTVDVGAPQLSMHSIREICAVDDVKYSYEHFKAFYQEFSHVDGKMVVD  486



>gb|EMS55846.1| Aspartyl aminopeptidase [Triticum urartu]
Length=618

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  501  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFQEIAERHQLPIQDFVVRNDMACGSTIG  560

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+H KA+++ F+ +D K+ VDC
Sbjct  561  PILASGVGIRTVDIGAPQLSMHSIREMCAVDDVNYSYEHLKAYFEEFTELDNKVKVDC  618



>ref|XP_004500663.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=482

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK NA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRND  CGSTIG
Sbjct  365  HEENHQPKLHGGLVIKQNANQRYATNAVTSFIFREIASKHNLPVQDFVVRNDTACGSTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D  L VD
Sbjct  425  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQEFSHLDANLVVD  481



>ref|XP_004960722.1| PREDICTED: probable aspartyl aminopeptidase-like [Setaria italica]
Length=475

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  358  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPVQDFVVRNDMACGSTIG  417

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++ F+ +D K+ VD
Sbjct  418  PILASGVGIRTVDIGAPQLSMHSIREMCAVDDISHSYEHFKAYFEEFTELDSKVKVD  474



>ref|XP_010102886.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB94323.1| Aspartyl aminopeptidase [Morus notabilis]
Length=507

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK NA+QRYAT+ VTSFLF+E+A  H +PTQDFVVRNDM CGSTIG
Sbjct  391  HEENHQPKLHGGLVIKSNANQRYATNSVTSFLFREIASKHKIPTQDFVVRNDMPCGSTIG  450

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  AY+HFKA++Q FS +D K+ VD
Sbjct  451  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVRHAYQHFKAYFQEFSHLDSKIIVD  507



>ref|XP_006351481.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=483

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ +TSF+F+E+A  HN+P QDFV+RNDM CGSTIG
Sbjct  366  HEENHQPKFHGGLVIKHNANQRYATNAITSFVFREIASKHNIPLQDFVIRNDMPCGSTIG  425

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  426  PILASGVGIRTVDVGAPQWSMHSIREMCAVDDVKHSYEHFKAFFQDFSQLDGKIAVD  482



>ref|XP_003602076.1| Aspartyl aminopeptidase [Medicago truncatula]
 gb|AES72327.1| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=482

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIK NA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  365  HEENHQPKLHGGLVIKQNANQRYATNAVTSFIFREIASKHNLPVQDFVVRNDMACGSTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ FS +D  + VD
Sbjct  425  PILASGIGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFKEFSHLDANIVVD  481



>ref|XP_009624334.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=479

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HN+P QDFV+RNDM CGSTIG
Sbjct  362  HEENHQPKFHGGLVIKHNANQRYATNAVTSFIFREIAAKHNIPIQDFVIRNDMPCGSTIG  421

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  422  PILASGIGIRTVDVGAPQWSMHSIREMCAVDDVKHSYQHFKAFFQDFSLLDGKIAVD  478



>ref|XP_009790447.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=479

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HN+P QDFV+RNDM CGSTIG
Sbjct  362  HEENHQPKFHGGLVIKHNANQRYATNAVTSFIFREIAAKHNIPIQDFVIRNDMPCGSTIG  421

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  422  PILASGIGIRTVDVGAPQWSMHSIREMCAVDDVKHSYEHFKAFFQDFSHLDGKIAVD  478



>ref|XP_009379936.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A +HNLP QDFVVRNDM CGSTIG
Sbjct  359  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEMHNLPFQDFVVRNDMPCGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D   +Y+HFKA++  F+ +++KL VD
Sbjct  419  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSYEHFKAYFNEFTKLEKKLVVD  475



>ref|XP_003523136.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +H+P+   G VIK NA+QRYAT+ VTSF+F+E+A  H LP QDFVVRNDMGCGSTIG
Sbjct  370  HEANHQPKLHGGLVIKTNANQRYATNVVTSFIFREIASKHKLPVQDFVVRNDMGCGSTIG  429

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+GIRTVD G  QLSMHS+REIC  +D+  +Y+HFKAFY+ FS VD K+ VD
Sbjct  430  PILASGIGIRTVDVGAPQLSMHSIREICAVDDVKHSYEHFKAFYEEFSHVDGKMVVD  486



>gb|KJB27157.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=464

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRND  CGSTIG
Sbjct  347  HEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQDFVVRNDTPCGSTIG  406

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ FS +D K+  D
Sbjct  407  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFKEFSQLDTKITGD  463



>gb|KJB27156.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=461

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRND  CGSTIG
Sbjct  344  HEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQDFVVRNDTPCGSTIG  403

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ FS +D K+  D
Sbjct  404  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFKEFSQLDTKITGD  460



>gb|KJB27155.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=463

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  HNLP QDFVVRND  CGSTIG
Sbjct  346  HEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQDFVVRNDTPCGSTIG  405

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++ FS +D K+  D
Sbjct  406  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFKEFSQLDTKITGD  462



>ref|XP_004236341.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=482

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ +TSF+F+E+A  HN+P QDFV+RNDM CGSTIG
Sbjct  365  HEENHQPKFHGGLVIKHNANQRYATNAITSFVFREIAAKHNIPLQDFVIRNDMPCGSTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  Q SMHS+RE+C  +D+  +Y HFKAF+Q FS +D K+ VD
Sbjct  425  PILASGVGIRTVDVGAPQWSMHSIREMCAVDDVKHSYDHFKAFFQDFSQLDGKIAVD  481



>ref|XP_002283475.1| PREDICTED: probable aspartyl aminopeptidase [Vitis vinifera]
 emb|CBI15632.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+E+H+P+   G VIKHNA+QRYAT+ VTSF+FKE+A  HNLP QDFVVRNDM CGSTIG
Sbjct  368  HDENHQPKLHGGLVIKHNANQRYATNAVTSFIFKEIAAKHNLPVQDFVVRNDMPCGSTIG  427

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+   +D+  +Y+HF+A++Q FS +D K+ VD
Sbjct  428  PILASGVGIRTVDVGAPQLSMHSIREMSAVDDVKHSYEHFRAYFQEFSCLDAKITVD  484



>ref|XP_009404266.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A +HNLP QDFVVRND+ CGS+IG
Sbjct  359  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEMHNLPIQDFVVRNDIPCGSSIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D   +Y+H KA++  F+ +D KL VDC
Sbjct  419  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSYEHLKAYFDEFTELDNKLIVDC  476



>emb|CDP05422.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  365  HEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAARHKLPIQDFVVRNDMPCGSTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFK+F++ FS +D K+ VD 
Sbjct  425  PILASGLGIRTVDVGAPQLSMHSIREMCAVDDVRHSYEHFKSFFEEFSYLDTKITVDA  482



>gb|KDP30945.1| hypothetical protein JCGZ_11321 [Jatropha curcas]
Length=483

 Score =   170 bits (430),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VT+FLF+E+A  H +P QDFVVRNDM CGSTIG
Sbjct  366  HEDNHQPKMHGGLVIKHNANQRYATNSVTAFLFREIASKHKIPIQDFVVRNDMPCGSTIG  425

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI+ASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q FS +D K+ VD
Sbjct  426  PIIASGIGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQEFSHLDAKITVD  482



>ref|XP_011463290.1| PREDICTED: probable aspartyl aminopeptidase, partial [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+   G VIKHNA+QRYAT+ VTS +F+E+A  H+LP Q+FVVRNDM CGSTIG
Sbjct  338  HEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIAMNHSLPVQEFVVRNDMACGSTIG  397

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKA+YQ F+ +D K+ VD 
Sbjct  398  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAYYQEFTHMDAKIKVDA  455



>ref|XP_010248918.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=490

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VTSF+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  373  HEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAEKHGLPIQDFVVRNDMPCGSTIG  432

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFK++++ F+ +D K++VD
Sbjct  433  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKSYFREFTQLDAKISVD  489



>gb|EPS62030.1| aspartyl aminopeptidase-like protein, partial [Genlisea aurea]
Length=475

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+  +G VIKHNA+QRYAT+ V+SFLF+E+A  + LP Q+FV+RND+ CGSTIG
Sbjct  359  HEENHQPKLHEGLVIKHNANQRYATNAVSSFLFREIAARNGLPVQEFVIRNDLACGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG GIRTVD G  QLSMHSVRE+CG +D+  +Y HFKAF+  FS++D+ L VD
Sbjct  419  PILASGAGIRTVDVGAPQLSMHSVREMCGVDDVKHSYDHFKAFFLQFSALDQNLAVD  475



>gb|ABR17053.1| unknown [Picea sitchensis]
Length=502

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++H+P+  KG VIK NA+QRYAT+ VTSF+F+E+ + + LPTQ+FVVRNDM CGST+G
Sbjct  385  HEQNHQPQMHKGLVIKFNANQRYATNAVTSFIFREIGKKNKLPTQEFVVRNDMPCGSTVG  444

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASGVGIRTVD G  QLSMHS+RE+CG +D+  ++ HFKAF++ ++  D+++ VDC
Sbjct  445  PILASGVGIRTVDVGAPQLSMHSIREMCGVDDVVYSHLHFKAFFEDYAEFDKQIKVDC  502



>ref|XP_008807558.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Phoenix 
dactylifera]
Length=476

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ ++SF+F+E+A  HN+P QDFVVRNDM CGSTIG
Sbjct  359  HEENHQPKLHGGLVIKHNANQRYATNAISSFIFREIAERHNIPIQDFVVRNDMPCGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++  F+ +D K+ VD
Sbjct  419  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFDEFTQLDAKITVD  475



>ref|XP_008807556.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807557.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
Length=487

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ ++SF+F+E+A  HN+P QDFVVRNDM CGSTIG
Sbjct  370  HEENHQPKLHGGLVIKHNANQRYATNAISSFIFREIAERHNIPIQDFVVRNDMPCGSTIG  429

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++  F+ +D K+ VD
Sbjct  430  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFDEFTQLDAKITVD  486



>ref|XP_010930126.1| PREDICTED: probable aspartyl aminopeptidase [Elaeis guineensis]
Length=476

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ +TSF+F+E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  359  HEENHQPKLHGGLVIKHNANQRYATNAITSFIFREIAERHNLPIQDFVVRNDMPCGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++  F+ +D  + VD
Sbjct  419  PILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFDEFTQLDANIIVD  475



>gb|KJB19571.1| hypothetical protein B456_003G109700 [Gossypium raimondii]
Length=337

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE H+ +   G VIKHNA+QRYAT+ VTSF+F E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  220  HEESHQSKLHGGLVIKHNANQRYATNAVTSFIFWEIAVKHNLPIQDFVVRNDMPCGSTIG  279

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA GVGIRTVD G  QLSMH +RE+C  +D+  + +HFKAF+  FS +D K++VD
Sbjct  280  PILAGGVGIRTVDIGAPQLSMHGIREMCAVDDVKHSNEHFKAFFHEFSQLDTKISVD  336



>ref|XP_004165827.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
 gb|KGN63497.1| hypothetical protein Csa_1G002660 [Cucumis sativus]
Length=481

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+   G VIK+NAS +YAT+ VT+ LF+E+A  HNLP Q+FVVRNDM CG+TIG
Sbjct  365  YEENHRPKFHGGLVIKNNASNKYATNAVTAALFRELAIKHNLPVQEFVVRNDMACGTTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVD  397
            PILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++ FSS+D
Sbjct  425  PILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFEEFSSLD  475



>ref|XP_004138060.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=481

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+   G VIK+NAS +YAT+ VT+ LF+E+A  HNLP Q+FVVRNDM CG+TIG
Sbjct  365  YEENHRPKFHGGLVIKNNASNKYATNAVTAALFRELAIKHNLPVQEFVVRNDMACGTTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVD  397
            PILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++ FSS+D
Sbjct  425  PILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFEEFSSLD  475



>ref|XP_002507546.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
 gb|ACO68804.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
Length=500

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +H P+   G VIKHNA+QRYAT+ VT+ LF+E A    +PTQ+FVVRNDMGCGSTIG
Sbjct  382  HESNHAPKLHAGLVIKHNANQRYATNAVTATLFRECASKSGIPTQEFVVRNDMGCGSTIG  441

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLN  385
            PIL++ +GIRTVD G+ QLSMHSVRE+CG EDIDI Y+HFK+F++ F++V    N
Sbjct  442  PILSANLGIRTVDVGVPQLSMHSVREMCGTEDIDICYRHFKSFFENFAAVSSDCN  496



>gb|EMT03759.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=893

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P+   G VIKHNA+QRYAT+ VT+F+F+E+A  H LP QDFVVRNDM CGSTIG
Sbjct  564  HEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQDFVVRNDMACGSTIG  623

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNV  382
            PILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+H KA+++ F+ +D K+ +
Sbjct  624  PILASGVGIRTVDIGAPQLSMHSIREMCAVDDVNYSYEHLKAYFEEFTELDNKVKI  679



>ref|XP_008464465.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Cucumis 
melo]
Length=481

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+   G VIK+NA+ +YAT+ VT+ LF+E+A  HNLP Q+FVVRNDM CG+TIG
Sbjct  365  YEENHRPKFHGGLVIKNNANNKYATNAVTAALFRELAIKHNLPVQEFVVRNDMACGTTIG  424

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVD  397
            PILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++ FSS+D
Sbjct  425  PILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFEEFSSLD  475



>gb|KJB19572.1| hypothetical protein B456_003G109700 [Gossypium raimondii]
Length=450

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE H+ +   G VIKHNA+QRYAT+ VTSF+F E+A  HNLP QDFVVRNDM CGSTIG
Sbjct  333  HEESHQSKLHGGLVIKHNANQRYATNAVTSFIFWEIAVKHNLPIQDFVVRNDMPCGSTIG  392

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA GVGIRTVD G  QLSMH +RE+C  +D+  + +HFKAF+  FS +D K++VD
Sbjct  393  PILAGGVGIRTVDIGAPQLSMHGIREMCAVDDVKHSNEHFKAFFHEFSQLDTKISVD  449



>gb|KDO42029.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=510

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ+FVVRNDMGCGSTIG
Sbjct  405  HEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQEFVVRNDMGCGSTIG  464

Query  549  PILASGVGIRTVDCGIAQLSMH  484
            PILASGVGIRTVDCGIAQLSMH
Sbjct  465  PILASGVGIRTVDCGIAQLSMH  486



>ref|XP_004172613.1| PREDICTED: probable aspartyl aminopeptidase-like, partial [Cucumis 
sativus]
Length=397

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQDFVVRNDMGCGSTIG
Sbjct  316  HEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQDFVVRNDMGCGSTIG  375

Query  549  PILASGVGIRTVDCGIAQLSMH  484
            PILASG GIRTVDCGI QLSMH
Sbjct  376  PILASGAGIRTVDCGIPQLSMH  397



>ref|XP_004336070.1| aspartyl aminopeptidase [Acanthamoeba castellanii str. Neff]
 gb|ELR14057.1| aspartyl aminopeptidase [Acanthamoeba castellanii str. Neff]
Length=372

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+H+P  QKG  IK+NA+QRYAT+ +T+FL KE+AR H +P Q+FVVRND  CGSTIG
Sbjct  256  HEENHQPMMQKGVAIKYNANQRYATTSITAFLLKELARRHGVPMQEFVVRNDSPCGSTIG  315

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++G GIRT+D G+ QLSMHS+RE+CG +D+  A    KAFY  FS +D  L VD
Sbjct  316  PILSAGCGIRTIDIGLPQLSMHSIREMCGADDVSHAVNLLKAFYSDFSKLDESLVVD  372



>gb|KCW51472.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=489

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRPE QKG VIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ+F VRNDMGCGSTIG
Sbjct  405  HEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQEFAVRNDMGCGSTIG  464

Query  549  PILASGVGIRTVDCGIAQLSMH  484
            PILASGVGIRTVDCGIAQLSMH
Sbjct  465  PILASGVGIRTVDCGIAQLSMH  486



>ref|XP_001690598.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
 gb|EDP05857.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
Length=565

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+  H+P    G V+KHN +QRYAT+ V++ LF+EVAR H LP Q+F VRNDM CGSTIG
Sbjct  429  HDPDHQPRMHGGLVLKHNNNQRYATNAVSAALFREVARRHGLPVQEFSVRNDMPCGSTIG  488

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILAS +G RTVD GIAQLSMHS+RE CG +D+ IAY HF AF++ FS++D  L+VD
Sbjct  489  PILASNLGCRTVDVGIAQLSMHSIREQCGADDVAIAYDHFLAFFKEFSALDASLDVD  545



>ref|XP_002907085.1| aspartyl aminopeptidase, putative [Phytophthora infestans T30-4]
 gb|EEY63649.1| aspartyl aminopeptidase, putative [Phytophthora infestans T30-4]
Length=462

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++HRP    G VIKHNA++RYATSG +SFL KE+AR HN+  Q+FVVR D GCGSTIG
Sbjct  346  HEQNHRPALHAGPVIKHNANERYATSGTSSFLMKELARRHNVDIQEFVVRQDTGCGSTIG  405

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++  GIRT+D G+AQLSMHS+RE+CG ED+      F AFY  FSS+D+ L  D
Sbjct  406  PILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKTLDWFTAFYSEFSSLDKCLKTD  462



>ref|XP_007512692.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17292.1| predicted protein [Bathycoccus prasinos]
Length=615

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE H+P   KG V+KHNA+QRYAT+ +T+++F+E A++  +PTQ+FVV+NDMGCGSTIG
Sbjct  498  HEEQHQPLFHKGVVVKHNANQRYATTALTAYMFRECAKLSGIPTQEFVVKNDMGCGSTIG  557

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVD  397
            PI+++  GIRTVD G+ QLSMHSVRE+ G ED+DI +KHF AFY+  + VD
Sbjct  558  PIVSAQTGIRTVDVGVPQLSMHSVREMMGTEDVDICHKHFLAFYENIAKVD  608



>ref|XP_010694703.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=505

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+ QKG VIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ+FVV+NDMGCGSTIG
Sbjct  413  HEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQEFVVKNDMGCGSTIG  472

Query  549  PILASGVGIRTVDCGIAQLSMH  484
            PILA+GVGIRTVDCGI+QLSMH
Sbjct  473  PILAAGVGIRTVDCGISQLSMH  494



>ref|XP_008909814.1| hypothetical protein PPTG_14635 [Phytophthora parasitica INRA-310]
 gb|ETI40343.1| hypothetical protein F443_14241 [Phytophthora parasitica P1569]
 gb|ETK80443.1| hypothetical protein L915_13884 [Phytophthora parasitica]
 gb|ETL33871.1| hypothetical protein L916_13780 [Phytophthora parasitica]
 gb|ETL87142.1| hypothetical protein L917_13587 [Phytophthora parasitica]
 gb|ETM40342.1| hypothetical protein L914_13693 [Phytophthora parasitica]
 gb|ETN04877.1| hypothetical protein PPTG_14635 [Phytophthora parasitica INRA-310]
 gb|ETO69064.1| hypothetical protein F444_14258 [Phytophthora parasitica P1976]
 gb|ETP10176.1| hypothetical protein F441_14138 [Phytophthora parasitica CJ01A1]
 gb|ETP38275.1| hypothetical protein F442_14083 [Phytophthora parasitica P10297]
Length=462

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++HRP    G VIKHNA++RYATSG + FL KE+AR HN+  Q+FVVR D GCGSTIG
Sbjct  346  HEQNHRPALHAGPVIKHNANERYATSGTSCFLMKELARRHNVDIQEFVVRQDTGCGSTIG  405

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++  GIRT+D G+AQLSMHS+RE+CG ED+      F AFY  FSS+D+ L  D
Sbjct  406  PILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKTMDWFTAFYSEFSSLDKCLKTD  462



>ref|XP_009519985.1| hypothetical protein PHYSODRAFT_539739 [Phytophthora sojae]
 gb|EGZ24697.1| hypothetical protein PHYSODRAFT_539739 [Phytophthora sojae]
Length=462

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++HRP    G VIK+NA++RYATSG ++FL KE+AR HN+  Q+FVVR D GCGSTIG
Sbjct  346  HEQNHRPALHAGPVIKYNANERYATSGTSAFLMKELARRHNVDIQEFVVRQDTGCGSTIG  405

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++  GIRT+D G+AQLSMHS+RE+CG ED+  +   F AFY  FSS+D+ L  D
Sbjct  406  PILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKSLDWFTAFYSEFSSLDKCLKTD  462



>ref|XP_003060266.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55035.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=444

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  H+P+   G V+KHNA+QRYAT  V+S+LFKE+     LP Q+FVVR+D+GCGSTIG
Sbjct  328  HEPGHKPKFGAGVVVKHNANQRYATDAVSSYLFKEIGERAGLPVQEFVVRSDLGCGSTIG  387

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P L++  GIRTVD G AQLSMHSVRE+CG +D++ A KHF A Y+ F+++D  L VD
Sbjct  388  PTLSTNTGIRTVDVGAAQLSMHSVREMCGAKDVEHAVKHFTAVYEGFTALDATLMVD  444



>ref|XP_003055398.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60650.1| predicted protein [Micromonas pusilla CCMP1545]
Length=476

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +H P+   G V+KHNA+QRYAT+  T+ LF+E A    +PTQDFVVRNDMGCGSTIG
Sbjct  359  HESNHSPKMHAGVVVKHNANQRYATTATTATLFRECAAKEGIPTQDFVVRNDMGCGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVD  397
            PIL++ +G+RTVD G+ QLSMHSVRE+CG EDID+ ++HF+AF+  F+ +D
Sbjct  419  PILSTNLGVRTVDVGVPQLSMHSVREMCGTEDIDVCFRHFRAFFDHFAEID  469



>ref|XP_005648131.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
 gb|EIE23587.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
Length=482

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  H+P+  KG V+KHN  QRYAT+ V++ LF+E+A+   +PTQ+F VR+DM CGSTIG
Sbjct  346  HEPDHKPQFHKGLVLKHNVHQRYATNAVSATLFRELAKRRGIPTQEFCVRSDMACGSTIG  405

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+G RTVD G  QLSMHS+RE+C  +D+   Y HF AF++ FS++D  ++VD
Sbjct  406  PILASGLGCRTVDVGAPQLSMHSIREMCAVDDMSHTYNHFCAFFKDFSALDASIDVD  462



>ref|XP_011396821.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
 gb|KFM23943.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
Length=469

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+  H P    G V+KHNA+QRYAT+ V++ LF+EV R   +PT DF VR+DMGCGSTIG
Sbjct  348  HDAAHAPRLGDGIVLKHNANQRYATTAVSATLFREVCRQAGVPTADFAVRSDMGCGSTIG  407

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKL  388
            PILASG+G+RTVD G+ QLSMHS+RE+C   D+   Y+ F AFYQT S++D  L
Sbjct  408  PILASGLGLRTVDVGLPQLSMHSIREMCAVADVGHGYRAFLAFYQTVSALDAAL  461



>emb|CEJ00699.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=300

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE  KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q+FVVRND  CGSTIG
Sbjct  184  HEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHNIPIQEFVVRNDSPCGSTIG  243

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FYQ F  +++KL VD
Sbjct  244  PMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYQEFFVLEQKLIVD  300



>gb|EXX59698.1| Ape4p [Rhizophagus irregularis DAOM 197198w]
Length=466

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  +G VIK NA+QRYAT+ VTS + ++VA+ + +P QDFVVRND  CGSTIG
Sbjct  350  HEENHRPQMNQGVVIKTNANQRYATTSVTSLILRQVAKKYKVPLQDFVVRNDSPCGSTIG  409

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P++++ +G+RT+D G  QLSMHS+RE  G +D+D A K  KAF++ F+ +DR + VD
Sbjct  410  PMISANLGLRTLDIGNPQLSMHSIRETAGTKDVDHAIKLIKAFFEDFAEIDRNITVD  466



>ref|XP_007514776.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15016.1| predicted protein [Bathycoccus prasinos]
Length=522

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  H+P+   G VIKHNA+QRY+T  +TSF+FKE+     + +Q+FVVR+D+GCGSTIG
Sbjct  367  HEPGHKPKFGDGVVIKHNANQRYSTDAITSFIFKEIGERRKIKSQEFVVRSDLGCGSTIG  426

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++  GIRTVD G+ QLSMHS+RE+CG ED  +  +HFKA Y+ F  +D K+ VD
Sbjct  427  PILSTRSGIRTVDVGMPQLSMHSIREMCGTEDTRLCVEHFKAVYEDFFEMDEKMIVD  483



>ref|XP_001421486.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=512

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  H P+   G VIKHNA+QRYAT  VT+F+F+E+     +P Q+FVVR+D GCGSTIG
Sbjct  359  HEPAHAPKMHGGLVIKHNANQRYATDAVTAFMFREIGERAGVPVQEFVVRSDTGCGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI ++  GIRTVD G AQLSMHS+RE+CG +DID A KH  A Y  F  +DR L VD
Sbjct  419  PIFSTRTGIRTVDVGAAQLSMHSIREVCGADDIDHAVKHLTAVYLHFIDLDRTLIVD  475



>gb|ESA11968.1| hypothetical protein GLOINDRAFT_335422 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  +G VIK NA+QRYAT+ VTS + ++VA+ + +P QDFVVRND  CGSTIG
Sbjct  380  HEENHRPQMNQGVVIKTNANQRYATTSVTSLILRQVAKKYKVPLQDFVVRNDSPCGSTIG  439

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P++++ +G+RT+D G  QLSMHS+RE  G +D+D A K  KAF++ F+ +DR + VD
Sbjct  440  PMISANLGLRTLDIGNPQLSMHSIRETAGTKDVDHAIKLIKAFFEDFAEIDRNITVD  496



>gb|ETO14766.1| hypothetical protein RFI_22603 [Reticulomyxa filosa]
Length=160

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  H P   KG V+K+N +QRYATS  TSF   E+AR  N+P Q FVVRND  CGSTIG
Sbjct  44   HESLHGPLIHKGLVVKYNCNQRYATSMATSFHLTELARKLNIPLQKFVVRNDSPCGSTIG  103

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+  GIR VD GI QLSMHS+RE+CG +D+  A   F AFY+ F  +D    VD
Sbjct  104  PILATACGIRAVDVGIPQLSMHSIREVCGVKDVVSATNLFTAFYENFVKLDATFKVD  160



>ref|XP_004346183.2| aspartyl aminopeptidase [Capsaspora owczarzaki ATCC 30864]
Length=478

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP    G VIK NA+QRYAT+ V+  + +E+AR HN+P Q+FVVRND  CGSTIG
Sbjct  362  HEENHRPVIHGGPVIKSNANQRYATNSVSGTVIREIARKHNIPVQEFVVRNDSACGSTIG  421

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI+A  +G+RT+D G  QLSMHS+RE CG +D+  A +  KAF++ F ++D +L+VD
Sbjct  422  PIVAGNLGMRTIDIGNPQLSMHSIRETCGVDDVTYAVQLIKAFFEDFPAMDARLDVD  478



>gb|KJE94975.1| aspartyl aminopeptidase [Capsaspora owczarzaki ATCC 30864]
Length=474

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP    G VIK NA+QRYAT+ V+  + +E+AR HN+P Q+FVVRND  CGSTIG
Sbjct  358  HEENHRPVIHGGPVIKSNANQRYATNSVSGTVIREIARKHNIPVQEFVVRNDSACGSTIG  417

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI+A  +G+RT+D G  QLSMHS+RE CG +D+  A +  KAF++ F ++D +L+VD
Sbjct  418  PIVAGNLGMRTIDIGNPQLSMHSIRETCGVDDVTYAVQLIKAFFEDFPAMDARLDVD  474



>ref|XP_002505350.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66608.1| predicted protein [Micromonas sp. RCC299]
Length=495

 Score =   145 bits (367),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  HRP    G VIKHNA+QRYAT  VT++LF+E+     +P Q+FVVR+D+GCGSTIG
Sbjct  368  HEPGHRPRFGDGVVIKHNANQRYATDAVTAWLFRELGERAGVPVQEFVVRSDLGCGSTIG  427

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++  GIRTVD G  QLSMHSVRE+CG +D+  +  HF A Y+ F+ +D  L VD
Sbjct  428  PILSTRTGIRTVDVGAPQLSMHSVREMCGCDDVKHSVAHFTAVYEGFTKLDETLMVD  484



>emb|CEG81490.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=468

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE  KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q+FVVRND  CGSTIG
Sbjct  352  HEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHNIPIQEFVVRNDSPCGSTIG  411

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FYQ F  +++KL VD
Sbjct  412  PMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYQEFFVLEQKLIVD  468



>ref|XP_002960428.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
 gb|EFJ37967.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
Length=516

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -1

Query  723  EHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIGPI  544
            EH++P+   G VIKHN +Q  AT  +++FLFKEVA+ + +PTQ++ V +D+GC STI  +
Sbjct  401  EHNQPKLHDGLVIKHNVTQNNATDAISAFLFKEVAKRNCIPTQNYSVVSDVGCCSTIDSV  460

Query  543  LASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            LA+G GIR VDCG+ QL+MHSVRE+CG EDID A++HF+AF+Q  +S+D +L VD
Sbjct  461  LAAGYGIRLVDCGLPQLAMHSVREMCGTEDIDAAFRHFRAFFQEIASLDDQLRVD  515



>ref|XP_002967289.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
 gb|EFJ31888.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
Length=519

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -1

Query  723  EHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIGPI  544
            EH++P+   G VIKHN +Q  AT  +++FLFKEVA+ + +PTQ++ V +D+GC STI  +
Sbjct  404  EHNQPKLHDGLVIKHNLTQNNATDAISAFLFKEVAKRNCIPTQNYSVVSDVGCCSTIDSV  463

Query  543  LASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            LA+G GIR VDCG+ QL+MHSVRE+CG EDID A++HF+AF+Q  +S+D +L VD
Sbjct  464  LAAGYGIRLVDCGLPQLAMHSVREMCGTEDIDAAFRHFRAFFQEIASLDDQLRVD  518



>emb|CEG01789.1| Peptidase M18 [Ostreococcus tauri]
Length=499

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  H P+   G VIKHNA+QRYAT  VT+F+F+E+     +P Q+FVV++DMGCGSTIG
Sbjct  348  HEPAHTPKLHGGLVIKHNANQRYATDAVTAFMFRELGERVGVPVQEFVVKSDMGCGSTIG  407

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI ++  GIRTVD G AQLSMHS+RE+CG +D++ A KHF + +  F  +DR   VD
Sbjct  408  PIFSTRTGIRTVDVGAAQLSMHSIREVCGTDDVEHAIKHFTSTFMNFLDLDRTFIVD  464



>ref|XP_003083329.1| aspartyl aminopeptidase (ISS), partial [Ostreococcus tauri]
Length=1045

 Score =   147 bits (370),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  H P+   G VIKHNA+QRYAT  VT+F+F+E+     +P Q+FVV++DMGCGSTIG
Sbjct  348  HEPAHTPKLHGGLVIKHNANQRYATDAVTAFMFRELGERVGVPVQEFVVKSDMGCGSTIG  407

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI ++  GIRTVD G AQLSMHS+RE+CG +D++ A KHF + +  F  +DR   VD
Sbjct  408  PIFSTRTGIRTVDVGAAQLSMHSIREVCGTDDVEHAIKHFTSTFMNFLDLDRTFIVD  464



>ref|XP_008863481.1| hypothetical protein H310_01914 [Aphanomyces invadans]
 gb|ETW07388.1| hypothetical protein H310_01914 [Aphanomyces invadans]
Length=463

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++ + +  +G  IK+NA+QRYAT+  TSFL KE+ R HNL  Q FV R D GCGSTIG
Sbjct  347  HEQNSKLQMGQGAAIKYNANQRYATTAETSFLLKEIGRRHNLNVQSFVTRQDCGCGSTIG  406

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++  GIRT+D G+AQLSMHS+RE+CG  DI+ + + FKAF+  FS+VD  +  D
Sbjct  407  PILSTHTGIRTIDVGVAQLSMHSIREMCGVTDIETSVELFKAFFNDFSTVDGFVKTD  463



>emb|CCA15777.1| aspartyl aminopeptidase putative [Albugo laibachii Nc14]
Length=459

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP    G VIK+NA+QRY+TS  ++FL KE+AR H +  Q+FVVR D  CGSTIG
Sbjct  345  HEENHRPALHAGPVIKYNANQRYSTSSESAFLMKELARRHKIKFQEFVVRQDTACGSTIG  404

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLN  385
            PI+A+  G+ T+D G+AQLSMHS+RE+CG +D+++    FKAF+  F+++  +L+
Sbjct  405  PIMATNTGMSTIDVGLAQLSMHSIREMCGTDDLELGLTWFKAFFSEFTALKSRLS  459



>gb|EPB92944.1| aspartyl aminopeptidase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=475

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE  KG VIK NA+QRYAT+ +TS + KE+A+ H +P Q+FVVRND  CGSTIG
Sbjct  359  HEENHRPEMHKGTVIKVNANQRYATTAITSLVLKELAKKHQIPIQEFVVRNDSSCGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE  G +D+       +AFY+ F+ +++K  VD
Sbjct  419  PMLSAKLGLRTVDIGNPQLSMHSIRETGGTDDVKHGIDLLRAFYEEFAVLEQKFIVD  475



>dbj|GAN09714.1| aspartyl aminopeptidase [Mucor ambiguus]
Length=470

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE  KG VIK NA+QRYAT+ +TS + KE+A+ H +P Q+FVVRND  CGSTIG
Sbjct  354  HEENHRPEMHKGTVIKINANQRYATTAITSLVLKELAKKHQIPIQEFVVRNDSSCGSTIG  413

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE  G +D+       +AFY+ F+ +++K  VD
Sbjct  414  PMLSAKLGLRTVDIGNPQLSMHSIRETGGTDDVKHGIDLLRAFYEEFAVLEQKFIVD  470



>emb|CCI46763.1| unnamed protein product [Albugo candida]
Length=663

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +HRP    G VIK+NA+QRYAT+  ++FL KE+AR H +  Q+FVVR D GCGSTIG
Sbjct  549  HEHNHRPALHAGPVIKYNANQRYATTSESAFLMKELARRHGVKLQEFVVRQDTGCGSTIG  608

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLN  385
            PI+++  G+RT+D G+AQLSMHS+RE+CG +D+++    FKAF+  F++++  L+
Sbjct  609  PIMSTNTGMRTIDVGLAQLSMHSIREMCGTDDLELGLTWFKAFFSEFTNLNSYLS  663



>ref|XP_009825683.1| hypothetical protein H257_03355 [Aphanomyces astaci]
 gb|ETV83991.1| hypothetical protein H257_03355 [Aphanomyces astaci]
Length=459

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++ + +  +G  IK+NA+QRYAT+G TSFL KE+ R HNL  Q FV R D GCGSTIG
Sbjct  343  HEQNSKLQMGQGPAIKYNANQRYATTGETSFLLKEIGRRHNLDVQSFVSRQDCGCGSTIG  402

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++  GIRT+D G+AQLSMHS+RE+CG  D++ +   FKAFY  F++VD  +  D
Sbjct  403  PILSTHTGIRTIDVGVAQLSMHSIREMCGVSDVEKSVALFKAFYNDFTTVDGFVKTD  459



>ref|XP_002678138.1| predicted protein [Naegleria gruberi]
 gb|EFC45394.1| predicted protein [Naegleria gruberi]
Length=476

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+  HRP+  +G VIK NA+QRYAT+G TSFLF E+A+ HN+P Q FVVRND  CGSTIG
Sbjct  359  HQAKHRPQIHQGLVIKTNANQRYATNGHTSFLFGELAKRHNIPIQQFVVRNDSACGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI +S   IRT+D GI QLSMHS+RE CG  DI      F  ++  FS +D  L++D
Sbjct  419  PITSSNTSIRTIDVGIPQLSMHSIREQCGCVDIKSTIDLFTEYFNEFSEIDSTLHID  475



>emb|CDS03243.1| hypothetical protein LRAMOSA00645 [Absidia idahoensis var. thermophila]
Length=468

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +HRP   KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q+FVVRND  CGSTIG
Sbjct  352  HESNHRPHMHKGTVIKINANQRYATTAVTSLVLKELAKKHNIPIQEFVVRNDSPCGSTIG  411

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE+ G +D+       K FY+ F+ ++ ++ VD
Sbjct  412  PMLSAKLGLRTVDVGNPQLSMHSIREVGGTDDVKHGIDLLKVFYEEFAELEARIVVD  468



>gb|EIE78284.1| hypothetical protein RO3G_02988 [Rhizopus delemar RA 99-880]
Length=469

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP+  KG VIK NA+QRYAT+ VTS + KE+A+ H +P Q+FVVRND  CGSTIG
Sbjct  353  HEENHRPQMHKGTVIKVNANQRYATTAVTSLVLKELAKKHKIPIQEFVVRNDSPCGSTIG  412

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FY+ F+ +++K  VD
Sbjct  413  PMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYEEFAELEQKFIVD  469



>gb|EPB84012.1| aspartyl aminopeptidase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=524

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  KG VIK NA+QRYAT+  TS + KE+AR   +P Q+FVVRND  CGSTIG
Sbjct  408  YEENHRPQMHKGTVIKINANQRYATTAPTSLILKEIARQKEIPIQEFVVRNDSSCGSTIG  467

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RT+D G  QLSMHS+REI G +D+       KAF+Q F  VD ++ VD
Sbjct  468  PMLSAKLGLRTIDVGNPQLSMHSIREIGGVDDVKNGTDLLKAFFQLFPYVDSRVTVD  524



>emb|CDH60153.1| aspartyl aminopeptidase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=542

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +HRP   KG VIK NA+QRYAT+ VTS + KE+A+ H++P Q+FVVRND  CGSTIG
Sbjct  426  HESNHRPHMHKGTVIKINANQRYATTAVTSLVLKELAKKHSIPIQEFVVRNDSSCGSTIG  485

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE+ G +D+       K FY+ F+ ++ ++ VD
Sbjct  486  PMLSAKLGLRTVDVGNPQLSMHSIREVGGTDDVKHGIDLLKVFYEEFAELEARIVVD  542



>dbj|GAN06933.1| aspartyl aminopeptidase [Mucor ambiguus]
Length=528

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  +G VIK NA+QRYAT+  TS + KE+AR   +P Q+FVVRND  CGSTIG
Sbjct  412  YEENHRPQMHQGTVIKINANQRYATTAPTSLILKEIARQKEIPIQEFVVRNDSSCGSTIG  471

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RT+D G  QLSMHS+REI G +D+       KAF+Q F  VD ++ VD
Sbjct  472  PMLSAKLGLRTIDVGNPQLSMHSIREIGGVDDVKNGTDLLKAFFQLFPYVDSRVTVD  528



>emb|CEP14293.1| hypothetical protein [Parasitella parasitica]
Length=475

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE  KG VIK NA+QRYAT+ VTS + KE+A+ H +P Q+FVVRND  CGSTIG
Sbjct  354  HEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHQIPIQEFVVRNDSSCGSTIG  413

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFK-----AFYQTFSSVDRKLN  385
            P+L++ +G+RTVD G  QLSMHS+RE  G ED+       +     AFY+ F+ +++K  
Sbjct  414  PMLSAKLGLRTVDIGNPQLSMHSIRETGGTEDVKHGIDLLRVGLIYAFYEEFAVLEQKFI  473

Query  384  VD  379
            VD
Sbjct  474  VD  475



>gb|KDO32253.1| hypothetical protein SPRG_02733 [Saprolegnia parasitica CBS 223.65]
Length=470

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE + R +   G VIK+NA++RYATSG T+ L KE+ R H L  QDFV R D GCGSTIG
Sbjct  350  HEVNSRIQMHSGPVIKYNANERYATSGETALLIKELGRRHGLDIQDFVSRQDCGCGSTIG  409

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+  GIRTVD G+AQ SMHS+RE CG  D+++A + F AFY  F  +D  +  D
Sbjct  410  PILATSTGIRTVDMGLAQFSMHSIREQCGTVDLELAIELFSAFYNDFVEIDGSIATD  466



>ref|XP_008620058.1| aspartyl aminopeptidase [Saprolegnia diclina VS20]
 gb|EQC26479.1| aspartyl aminopeptidase [Saprolegnia diclina VS20]
Length=470

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE + R +   G VIK+NA++RYATSG T+ L KE+ R H L  QDFV R D GCGSTIG
Sbjct  350  HEVNSRIQMHSGPVIKYNANERYATSGETALLIKELGRRHGLDIQDFVSRQDCGCGSTIG  409

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+  GIRTVD G+AQ SMHS+RE CG  D+++A + F AFY  F  +D  +  D
Sbjct  410  PILATSTGIRTVDMGLAQFSMHSIREQCGTVDLELAIELFSAFYNDFVEIDGSIATD  466



>ref|XP_001745410.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89988.1| predicted protein [Monosiga brevicollis MX1]
Length=467

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  HRP+  +G VIK NA+QRYAT+ VT+ + + +A+   +P QDFVVR DMGCGSTIG
Sbjct  345  HEGLHRPKMNQGVVIKFNANQRYATNAVTASILRLLAKKAGVPLQDFVVRQDMGCGSTIG  404

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVDC  376
            PILASG+GIRT+D G  QL+MHS+RE+ G +D+  A   FK F++ F  +D  ++VD 
Sbjct  405  PILASGLGIRTIDVGNPQLAMHSIREMGGVKDVAYAIDLFKTFFKRFPQLDGSVHVDA  462



>ref|XP_007879166.1| hypothetical protein PFL1_03458 [Pseudozyma flocculosa PF-1]
 gb|EPQ29171.1| hypothetical protein PFL1_03458 [Pseudozyma flocculosa PF-1]
Length=516

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+   G VIK N  QRYAT+G T+FL + +A++ ++P Q FVV+N+M CGSTIG
Sbjct  401  YEENHRPKLNGGPVIKTNVKQRYATTGPTAFLIRRIAKLADVPLQSFVVKNNMPCGSTIG  460

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L S +GIRTVD G  QLSMHS+RE CG  D+++  + F+ F+++F  VD +L  D
Sbjct  461  PML-SKLGIRTVDLGNPQLSMHSIRETCGSRDVELKIRLFQHFFESFEKVDAQLTTD  516



>emb|CBQ68247.1| probable aspartyl aminopeptidase [Sporisorium reilianum SRZ2]
Length=502

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  +G VIK N  QRYAT+G T+FL + +A+  ++P Q FVV+NDM CGSTIG
Sbjct  387  YEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAHVPLQSFVVKNDMPCGSTIG  446

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L S +GIRT+D G  QLSMHS+RE CG +D+D   + FK F+ +F +VD +L +D
Sbjct  447  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVDYKIELFKHFFDSFETVDAQLVID  502



>emb|CEJ04001.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  KG VIK NA+Q+YAT+  TS + +EVAR  ++P Q+FVVRND  CGSTIG
Sbjct  380  YEENHRPQMHKGTVIKINANQKYATTAATSLILREVARQRSIPIQEFVVRNDSPCGSTIG  439

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ F  +D K+ +D
Sbjct  440  PMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFELFPDIDAKVFID  496



>emb|CEI95696.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q+FVVRND  CGSTIG
Sbjct  380  YEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQEFVVRNDSPCGSTIG  439

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ F  +D K+ +D
Sbjct  440  PMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFELFPDIDAKVFID  496



>emb|CEG69346.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q+FVVRND  CGSTIG
Sbjct  380  YEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQEFVVRNDSPCGSTIG  439

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ F  +D K+ +D
Sbjct  440  PMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFELFPDIDAKVFID  496



>emb|CCF51316.1| probable aspartyl aminopeptidase [Ustilago hordei]
Length=504

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  +G VIK N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  389  YEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQSFVVKNDMPCGSTIG  448

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +F  VD +L +D
Sbjct  449  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDSFEQVDAQLTID  504



>emb|CEG81693.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q+FVVRND  CGSTIG
Sbjct  380  YEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQEFVVRNDSPCGSTIG  439

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++ F  +D K+ +D
Sbjct  440  PMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGIDLLKSFFELFPDIDAKVFID  496



>gb|EIE88868.1| hypothetical protein RO3G_13579 [Rhizopus delemar RA 99-880]
Length=476

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  KG VIK NA+QRYAT+  TS + +E+AR  N+P Q+FVVRND  CGSTIG
Sbjct  360  YEENHRPQMHKGTVIKINANQRYATTAPTSLILREIARQKNIPIQEFVVRNDSPCGSTIG  419

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G+RTVD G  QLSMHS+RE  G +D+       K+F++ F  +D K+ VD
Sbjct  420  PMLSAKLGLRTVDVGNPQLSMHSIRETGGVDDVKHGIDLLKSFFELFPHIDAKVIVD  476



>ref|XP_002129082.1| PREDICTED: aspartyl aminopeptidase-like [Ciona intestinalis]
Length=449

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE H RP    G VIK N +QRYAT+ +T+ + +E A+I  +PTQD +VRND GCGSTIG
Sbjct  333  HESHMRPTLHGGPVIKTNNNQRYATTAITATIVRESAKIAGVPTQDVMVRNDAGCGSTIG  392

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+ +GIRTVD G AQLSMHS RE+CG    +   K + AF+Q F  +D  ++V+
Sbjct  393  PILATRLGIRTVDVGAAQLSMHSCREVCGVLAPEQCLKLYVAFFQNFPKIDENISVE  449



>dbj|GAC99602.1| aspartyl aminopeptidase [Pseudozyma hubeiensis SY62]
Length=502

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  +G VIK N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  387  YEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQSFVVKNDMPCGSTIG  446

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +F  VD +L +D
Sbjct  447  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDSFEQVDAQLVID  502



>gb|KDN49618.1| putative aspartyl aminopeptidase [Tilletiaria anomala UBC 951]
Length=497

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +E  HRP+   G VIK NA QRYA++  T+FL + +A+I N+P Q+F VRNDM CGSTIG
Sbjct  382  YENDHRPKLNGGPVIKTNAKQRYASTAPTTFLLRRLAKIANVPLQEFEVRNDMPCGSTIG  441

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P++ S  GIRTVD G  QL+MHS+RE CG  D +   + F+AF++ F +VD++L VD
Sbjct  442  PMM-SKTGIRTVDIGNPQLAMHSIRETCGSADPEYKIRLFEAFFEHFETVDKELKVD  497



>ref|XP_011386806.1| putative aspartyl aminopeptidase [Ustilago maydis 521]
 gb|KIS72420.1| putative aspartyl aminopeptidase [Ustilago maydis 521]
Length=505

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  +G VIK N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  390  YEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQSFVVKNDMPCGSTIG  449

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +F  +D +L +D
Sbjct  450  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDSFEQIDAQLVID  505



>emb|CDI51753.1| probable aspartyl aminopeptidase [Melanopsichium pennsylvanicum 
4]
Length=506

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +EE+HRP+  +G VIK N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  391  YEENHRPKLNQGPVIKTNVKQRYATTGPTAFLVRRIAQRAQVPLQSFVVKNDMPCGSTIG  450

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +F  VD +L +D
Sbjct  451  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDSFEQVDAQLIID  506



>ref|XP_004994670.1| aspartyl aminopeptidase [Salpingoeca rosetta]
 gb|EGD72847.1| aspartyl aminopeptidase [Salpingoeca rosetta]
Length=469

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE +H+P    G VIK N +QRYAT+ VT+ + + VA I ++P QD +VRND  CGSTIG
Sbjct  353  HEANHQPMMNAGPVIKFNTNQRYATNAVTALILRRVAEIADVPLQDVMVRNDSACGSTIG  412

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PIL++G+GIRT+D G AQL+MHS+RE+ G  DI  A   FK FY  F+ VD  + V+
Sbjct  413  PILSAGLGIRTIDIGNAQLAMHSIREMGGSHDIAYAVTLFKTFYCKFAEVDASVTVE  469



>ref|XP_004361073.1| aspartyl aminopeptidase [Dictyostelium fasciculatum]
 gb|EGG23222.1| aspartyl aminopeptidase [Dictyostelium fasciculatum]
Length=572

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE  HRP+  KG VIK+NA+ RYAT+G TSF   E+A+ + +P Q+F+V+ND  CGSTIG
Sbjct  454  HEPLHRPQLNKGPVIKYNANLRYATTGPTSFTILELAKRNGIPVQEFLVKNDSPCGSTIG  513

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PI++   GIRTVD G  QLSMHS+RE CG  DI   ++  + F++ FS +D+ + VD
Sbjct  514  PIISGSYGIRTVDIGNPQLSMHSIRETCGVVDITYGFQLIQKFFEQFSILDKSIKVD  570



>ref|XP_009025082.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
 gb|ESN96961.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
Length=468

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEEHHRP   KG V+K NA+Q+YA++ +TS + +E+A   ++P QDFV+RNDM CGSTIG
Sbjct  352  HEEHHRPFLNKGVVLKFNANQKYASTAITSSIMREIAHEASIPIQDFVMRNDMACGSTIG  411

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSV  400
            PIL++ +GI T+D G  QLSMHS+RE+C    + +A   FKA+++ +S +
Sbjct  412  PILSTRLGIPTLDLGSPQLSMHSIREMCSTSSVHLAISLFKAYFENYSKM  461



>ref|XP_011457668.1| PREDICTED: probable aspartyl aminopeptidase [Fragaria vesca subsp. 
vesca]
Length=147

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 66/82 (80%), Gaps = 13/82 (16%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRPE QKG VIKHNA+QRYATSGVTSFL             +FVVRNDMGCGSTIG
Sbjct  70   HEEYHRPEMQKGLVIKHNANQRYATSGVTSFL-------------EFVVRNDMGCGSTIG  116

Query  549  PILASGVGIRTVDCGIAQLSMH  484
            PILASG GIRTVDCGIAQLSMH
Sbjct  117  PILASGAGIRTVDCGIAQLSMH  138



>dbj|GAC74074.1| histone acetyltransferase [Pseudozyma antarctica T-34]
Length=1391

 Score =   134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -1

Query  729   HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
             +EE+HRP+   G VIK N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  1276  YEENHRPKINGGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQSFVVKNDMPCGSTIG  1335

Query  549   PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
             P+L S +GIRT+D G  QLSMHS+RE CG +D+    + FK F+ +F  VD +L +D
Sbjct  1336  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVAYKIELFKHFFDSFEQVDAQLTID  1391



>dbj|GAK61818.1| acyltransferase [Pseudozyma antarctica]
Length=1458

 Score =   134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -1

Query  729   HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
             +EE+HRP+   G VIK N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  1343  YEENHRPKINGGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQSFVVKNDMPCGSTIG  1402

Query  549   PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
             P+L S +GIRT+D G  QLSMHS+RE CG +D+    + FK F+ +F  VD +L +D
Sbjct  1403  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVAYKIELFKHFFDSFEQVDAQLTID  1458



>gb|ETS64061.1| hypothetical protein PaG_02398 [Pseudozyma aphidis DSM 70725]
Length=1503

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 1/117 (1%)
 Frame = -1

Query  729   HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
             +EE+HRP+   G VIK N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  1388  YEENHRPKINGGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQSFVVKNDMPCGSTIG  1447

Query  549   PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
             P+L S +GIRT+D G  QLSMHS+RE CG +D+    + FK F+ +F  VD +L +D
Sbjct  1448  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVAYKIELFKHFFDSFEQVDAQLTID  1503



>gb|EST06743.1| histone acetyltransferase [Pseudozyma brasiliensis GHG001]
Length=1410

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -1

Query  729   HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
             +EE+HRP+   G V+K N  QRYAT+G T+FL + +A+   +P Q FVV+NDM CGSTIG
Sbjct  1295  YEENHRPKINGGPVLKTNVKQRYATTGPTAFLIRRIAQRAQVPLQSFVVKNDMPCGSTIG  1354

Query  549   PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
             P+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ +F  VD +L +D
Sbjct  1355  PML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFDSFEEVDAQLVID  1410



>gb|EWC43491.1| aspartyl aminopeptidase [Drechslerella stenobrocha 248]
Length=501

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +E HHRPE  KG VIK NA+ RYAT+     L +E AR+  +P Q FVVRND  CGSTIG
Sbjct  386  YESHHRPEMNKGTVIKINANARYATNSPGIVLVQECARVAGVPLQLFVVRNDSSCGSTIG  445

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNV  382
            P+L++ +G+RT+D G AQLSMHS+RE  G +D++ A K FKAF+Q +++++  + V
Sbjct  446  PMLSAQMGMRTLDLGNAQLSMHSIRETGGAQDVEHAIKLFKAFFQRYTALEPTIFV  501



>ref|XP_005849269.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
 gb|EFN57167.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
Length=497

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 2/119 (2%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            H+    P    G V+KHN +QRYAT+ +++ LF+EV R   +PT +F VR+DM CGSTIG
Sbjct  359  HDPDLAPRLGSGLVLKHNVNQRYATTSISATLFREVCRRAGVPTAEFAVRSDMACGSTIG  418

Query  549  PILASGVGIRTVDCGIAQLSMHSVREI--CGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILASG+G+RTVD G+ QL+MHS+RE+  C   D     + F AF+QT S +DR ++ D
Sbjct  419  PILASGLGVRTVDIGVPQLAMHSIRELQMCTVSDAAHGLRAFTAFFQTISELDRTVDPD  477



>ref|XP_002289000.1| probable aspartyl aminopeptidase [Thalassiosira pseudonana CCMP1335]
 gb|EED94436.1| probable aspartyl aminopeptidase, partial [Thalassiosira pseudonana 
CCMP1335]
Length=464

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARI--HNLPTQDFVVRNDMGCGST  556
            HE +H P    G VIK N +QRYAT+GVT F+ +EVAR    N+P Q+FVVR+D  CG+T
Sbjct  347  HERNHGPRMNAGVVIKTNQNQRYATNGVTGFIAREVARKTEKNIPLQEFVVRSDCPCGTT  406

Query  555  IGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKL  388
            IGPIL++  GIRTVD G+ QLSMHS RE+ G  D+   Y  FK+F+  F+ +D  L
Sbjct  407  IGPILSANTGIRTVDLGMPQLSMHSCREVMGIADLTNGYNLFKSFFDNFNEIDECL  462



>gb|EJK61550.1| hypothetical protein THAOC_17943 [Thalassiosira oceanica]
Length=541

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLP-TQDFVVRNDMGCGSTI  553
            HE++H P+   G VIK NA+QRYAT+GVT  + +E+AR   LP  Q+FVVRND GCGSTI
Sbjct  425  HEKNHGPKMNDGMVIKRNANQRYATNGVTGLVVRELARRAGLPPVQEFVVRNDCGCGSTI  484

Query  552  GPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVD  397
            GPI+++  GIR +D G  QLSMHS+RE  G +D+      F+AF++ F++VD
Sbjct  485  GPIISTRTGIRAIDMGCPQLSMHSIRETMGTKDLTNGLALFRAFFKDFAAVD  536



>ref|NP_001279935.1| aspartyl aminopeptidase [Callorhinchus milii]
 gb|AFM91016.1| aspartyl aminopeptidase [Callorhinchus milii]
Length=471

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP   KG VIK N++Q+YA++ VT  + +E+AR  N+P Q+ +VRND  CGSTIG
Sbjct  355  HEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQEVMVRNDSTCGSTIG  414

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY  + +++  L VD
Sbjct  415  PILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYDHYPTINSSLVVD  471



>gb|AFK11572.1| aspartyl aminopeptidase [Callorhinchus milii]
Length=471

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP   KG VIK N++Q+YA++ VT  + +E+AR  N+P Q+ +VRND  CGSTIG
Sbjct  355  HEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQEVMVRNDSTCGSTIG  414

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY  + +++  L VD
Sbjct  415  PILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYDHYPTINSSLVVD  471



>gb|EPY30718.1| aspartyl aminopeptidase [Strigomonas culicis]
Length=242

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HE++HRP+   G VIK+NA+ RYAT+G+T+ + K+VA+   +P Q+FVV+ND  CGSTIG
Sbjct  133  HEDNHRPQLHLGPVIKYNANTRYATNGLTAAIVKDVAKKGEVPIQEFVVKNDSPCGSTIG  192

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSV  400
            PIL++  GI+T D G A LSMHSVRE+CG  DI    K  ++F++ +++V
Sbjct  193  PILSTLSGIKTADIGNAMLSMHSVREMCGTVDIYYLTKLIESFFENYAAV  242



>ref|XP_002840917.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ85108.1| unnamed protein product [Tuber melanosporum]
Length=463

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            +E HHRPE  KG VIK NA+ RYAT+     L +EVAR   +P Q FVV+ND  CGSTIG
Sbjct  344  YESHHRPEMNKGPVIKVNANARYATNSPGIVLTEEVAREAGVPLQLFVVKNDSPCGSTIG  403

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L++ +G RT+D G AQLSMHS+RE  G  DI  A K FK +++ FS+++  + VD
Sbjct  404  PMLSASLGTRTIDMGNAQLSMHSIRETGGAHDIKYAVKLFKKYFERFSNLEETIMVD  460



>ref|XP_006683342.1| hypothetical protein BATDEDRAFT_18145 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76038.1| hypothetical protein BATDEDRAFT_18145 [Batrachochytrium dendrobatidis 
JAM81]
Length=472

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHN------LPTQDFVVRNDMG  568
            HE++HRP    G VIK NA+QRYAT+ +++ + +EVA++        +  Q+FVVRND  
Sbjct  350  HEDNHRPLINSGVVIKQNANQRYATTAISTLVLREVAKLAGKEGSGGVALQEFVVRNDSP  409

Query  567  CGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKL  388
            CGSTIGP+L++ +G+RTVD G  Q SMHS+RE CG ED+  A   FK+F+  F++VD ++
Sbjct  410  CGSTIGPMLSASLGVRTVDVGNPQWSMHSIRETCGVEDVQHAVNLFKSFFDHFAAVDARI  469



>ref|XP_007883309.1| PREDICTED: aspartyl aminopeptidase [Callorhinchus milii]
Length=574

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE+HRP   KG VIK N++Q+YA++ VT  + +E+AR  N+P Q+ +VRND  CGSTIG
Sbjct  458  HEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQEVMVRNDSTCGSTIG  517

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            PILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY  + +++  L VD
Sbjct  518  PILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYDHYPTINSSLVVD  574



>ref|XP_001837079.1| aspartyl aminopeptidase [Coprinopsis cinerea okayama7#130]
 gb|EAU84696.1| aspartyl aminopeptidase [Coprinopsis cinerea okayama7#130]
Length=475

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 78/117 (67%), Gaps = 1/117 (1%)
 Frame = -1

Query  729  HEEHHRPEXQKGXVIKHNASQRYATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIG  550
            HEE HRP    G VIK NA QRYAT  V+SF+ K++A       Q+F VRNDM CGST+G
Sbjct  360  HEEKHRPYMNGGIVIKTNAKQRYATDAVSSFIVKQLAERRGGKVQEFEVRNDMPCGSTVG  419

Query  549  PILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  379
            P+L S +G+RTVD G   LSMHS+RE  G  D+  A   F AF++ FS +D+ LNVD
Sbjct  420  PML-SKLGVRTVDVGNPMLSMHSIRETAGSHDVQSAIDLFHAFFEGFSKLDQGLNVD  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470