BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026M23

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362029.1|  PREDICTED: SUMO-activating enzyme subunit 2-...  71.6    2e-11   
ref|XP_009606961.1|  PREDICTED: SUMO-activating enzyme subunit 2      70.5    5e-11   Nicotiana tomentosiformis
ref|XP_010315319.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  67.8    4e-10   Solanum lycopersicum
ref|XP_004230873.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  67.8    5e-10   Solanum lycopersicum
gb|EYU37827.1|  hypothetical protein MIMGU_mgv1a002832mg              65.9    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_009765006.1|  PREDICTED: SUMO-activating enzyme subunit 2      65.5    2e-09   Nicotiana sylvestris
ref|XP_011088448.1|  PREDICTED: SUMO-activating enzyme subunit 2      61.6    4e-08   Sesamum indicum [beniseed]
ref|XP_011047909.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  58.2    7e-07   Populus euphratica
ref|XP_011047900.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  58.2    7e-07   Populus euphratica
ref|XP_011047920.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  57.8    7e-07   Populus euphratica
ref|XP_002283529.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  57.4    1e-06   Vitis vinifera
emb|CBI37697.3|  unnamed protein product                              57.0    1e-06   Vitis vinifera
ref|XP_010645393.1|  PREDICTED: SUMO-activating enzyme subunit 2 ...  57.0    1e-06   Vitis vinifera
emb|CDO97017.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
ref|XP_003627740.1|  SUMO activating enzyme                           53.9    3e-06   
gb|KEH19101.1|  SUMO1 activating enzyme subunit 2                     53.9    1e-05   Medicago truncatula
ref|XP_007133804.1|  hypothetical protein PHAVU_011G210500g           48.5    7e-04   Phaseolus vulgaris [French bean]
ref|XP_003541605.1|  PREDICTED: SUMO-activating enzyme subunit 2-...  48.1    0.001   Glycine max [soybeans]



>ref|XP_006362029.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Solanum tuberosum]
Length=652

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 19/109 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLC  308
            LSGWTP LA+E     T DNG SSS ASQT PL++ ++D++E IL     ++ GKKRK  
Sbjct  547  LSGWTPALAAEKTK--TSDNGPSSSNASQTVPLESEDNDEIEIILKDPEILAAGKKRKSS  604

Query  307  DTNP---------------DRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  206
            D +                 RKVEE DD  +  V +DGN D +KK+RVQ
Sbjct  605  DVSVAVDSEMFSVTGEMLTKRKVEE-DDSHNDIVMVDGNLDPNKKKRVQ  652



>ref|XP_009606961.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana tomentosiformis]
Length=652

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 61/108 (56%), Gaps = 16/108 (15%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLC  308
            LSGWTP LA+E   KT+ DNG SSS ASQT  L+  +DD+LE IL     +S G KRKL 
Sbjct  545  LSGWTPALATEKKTKTS-DNGPSSSNASQTVQLEPEDDDELEIILKDPEILSAGNKRKLS  603

Query  307  DTN--PDRKVE------------ELDDDGDGFVTLDGNSDGSKKQRVQ  206
            D +   D +V             E DD       LDGNSD SKK+RVQ
Sbjct  604  DISVTADSEVSRVTGEMQTKSHAEADDTHTDTAMLDGNSDISKKKRVQ  651



>ref|XP_010315319.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Solanum 
lycopersicum]
Length=607

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (59%), Gaps = 19/109 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLC  308
            LSGWTP LA+E     T DNG SSS ASQT PL++ ++D++E IL     ++ GKKRK  
Sbjct  502  LSGWTPALAAEKTK--TLDNGPSSSNASQTVPLESEDNDEIEIILKDPEILAAGKKRKSS  559

Query  307  DTN----PD-----------RKVEELDDDGDGFVTLDGNSDGSKKQRVQ  206
            D +    P+           +KVEE DD  +  V +DG  D +KK+RVQ
Sbjct  560  DVSVAVDPEIFSVTGAMLTKKKVEE-DDSNNDIVMVDGKLDLNKKKRVQ  607



>ref|XP_004230873.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Solanum 
lycopersicum]
Length=650

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (59%), Gaps = 19/109 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLC  308
            LSGWTP LA+E     T DNG SSS ASQT PL++ ++D++E IL     ++ GKKRK  
Sbjct  545  LSGWTPALAAEKTK--TLDNGPSSSNASQTVPLESEDNDEIEIILKDPEILAAGKKRKSS  602

Query  307  DTN----PD-----------RKVEELDDDGDGFVTLDGNSDGSKKQRVQ  206
            D +    P+           +KVEE DD  +  V +DG  D +KK+RVQ
Sbjct  603  DVSVAVDPEIFSVTGAMLTKKKVEE-DDSNNDIVMVDGKLDLNKKKRVQ  650



>gb|EYU37827.1| hypothetical protein MIMGU_mgv1a002832mg [Erythranthe guttata]
Length=633

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 60/106 (57%), Gaps = 16/106 (15%)
 Frame = -1

Query  484  LSGWTPVLASENNNKT-THDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC  308
            LSGWTP LA+E N  T T +NGAS+S  SQ   L   EDDDL+I+PT      GKKRK+ 
Sbjct  530  LSGWTPALAAEKNGSTSTTENGASTSGVSQATSLMTEEDDDLQIIPTQPG---GKKRKIS  586

Query  307  DTN-----------PDRKVEELDDDGDG-FVTLDGNSDGSKKQRVQ  206
            D +            D K++  D DG+   V LD  S G+ K++++
Sbjct  587  DLSSAATSDFSSVAKDTKIQRKDVDGNNDVVMLDDGSLGNSKKKIE  632



>ref|XP_009765006.1| PREDICTED: SUMO-activating enzyme subunit 2 [Nicotiana sylvestris]
Length=651

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 59/109 (54%), Gaps = 18/109 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLE-ILPTGTAISPGKKRKLC  308
            LSGWTP LA+E   KT+ DNG SSS ASQ    +  +DD+LE IL     +S G KRKL 
Sbjct  545  LSGWTPALAAEKKTKTS-DNGPSSSNASQAVQPEPEDDDELEIILKDPEILSAGNKRKLS  603

Query  307  DTN---------------PDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  206
            D +                   VEE DD     + +DGNSD SKK+RVQ
Sbjct  604  DISNTADSEVSRVTGEMQTKSHVEE-DDTHTDTIMIDGNSDISKKKRVQ  651



>ref|XP_011088448.1| PREDICTED: SUMO-activating enzyme subunit 2 [Sesamum indicum]
Length=648

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 57/108 (53%), Gaps = 19/108 (18%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC-  308
            LSGWT  LA E N K + DNGAS+S  S+T  L   +DD+L+I+P   A    KKRKL  
Sbjct  545  LSGWTQPLAVEKNGKGSTDNGASTSRVSETTSLVMEDDDELQIIPAQIA----KKRKLSD  600

Query  307  --------------DTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRVQ  206
                          +    RK EE D++ D  +   G+S+ SKK+R Q
Sbjct  601  ISSAASSDASSFRNEAKFKRKAEEADNNNDVVMLDGGSSENSKKKREQ  648



>ref|XP_011047909.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Populus 
euphratica]
Length=652

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 19/111 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL--  311
            LSGWT  L  + ++KT+  NGAS+S +  T P+DA +D +++ +  GTA SPGKKRKL  
Sbjct  543  LSGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIEVKEISDGTA-SPGKKRKLPE  601

Query  310  ----C---------DTNPDRKVEEL--DDDGDGFVTLDG-NSDGSKKQRVQ  206
                C         +T  D+K+++L  DDD D  V LD    D SKKQR+Q
Sbjct  602  FSEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHWGKDTSKKQRLQ  652



>ref|XP_011047900.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Populus 
euphratica]
Length=657

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 19/111 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL--  311
            LSGWT  L  + ++KT+  NGAS+S +  T P+DA +D +++ +  GTA SPGKKRKL  
Sbjct  548  LSGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIEVKEISDGTA-SPGKKRKLPE  606

Query  310  ----C---------DTNPDRKVEEL--DDDGDGFVTLDG-NSDGSKKQRVQ  206
                C         +T  D+K+++L  DDD D  V LD    D SKKQR+Q
Sbjct  607  FSEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHWGKDTSKKQRLQ  657



>ref|XP_011047920.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X3 [Populus 
euphratica]
Length=614

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 19/111 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL--  311
            LSGWT  L  + ++KT+  NGAS+S +  T P+DA +D +++ +  GTA SPGKKRKL  
Sbjct  505  LSGWTQALPEKKDDKTSIGNGASTSKSLPTEPMDAQKDIEVKEISDGTA-SPGKKRKLPE  563

Query  310  ----C---------DTNPDRKVEEL--DDDGDGFVTLDG-NSDGSKKQRVQ  206
                C         +T  D+K+++L  DDD D  V LD    D SKKQR+Q
Sbjct  564  FSEGCTLDQSNEADETRNDKKIQKLDDDDDDDDLVMLDHWGKDTSKKQRLQ  614



>ref|XP_002283529.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X1 [Vitis 
vinifera]
Length=634

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 15/99 (15%)
 Frame = -1

Query  484  LSGWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC  308
            LSGWT     E ++NKT  + G+S+S AS   P++A EDDD+E +PT      GKKRK+ 
Sbjct  545  LSGWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDDDIEFVPT------GKKRKVG  598

Query  307  D----TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  206
            +    TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  599  EISKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  634



>emb|CBI37697.3| unnamed protein product [Vitis vinifera]
Length=618

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 15/99 (15%)
 Frame = -1

Query  484  LSGWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC  308
            LSGWT     E ++NKT  + G+S+S AS   P++A EDDD+E +PT      GKKRK+ 
Sbjct  529  LSGWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDDDIEFVPT------GKKRKVG  582

Query  307  D----TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  206
            +    TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  583  EISKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  618



>ref|XP_010645393.1| PREDICTED: SUMO-activating enzyme subunit 2 isoform X2 [Vitis 
vinifera]
Length=521

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 15/99 (15%)
 Frame = -1

Query  484  LSGWTPVLASE-NNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC  308
            LSGWT     E ++NKT  + G+S+S AS   P++A EDDD+E +PT      GKKRK+ 
Sbjct  432  LSGWTQAPRVEKDDNKTVGNGGSSTSNASSAMPVEAEEDDDIEFVPT------GKKRKVG  485

Query  307  D----TNPDRKVEELDDDGDGFVTLDG-NSDGSKKQRVQ  206
            +    TNP+  + ++ DD D  V LDG N D +KK+++Q
Sbjct  486  EISKATNPN--LSDVADD-DVLVMLDGENLDINKKKKLQ  521



>emb|CDO97017.1| unnamed protein product [Coffea canephora]
Length=648

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 58/105 (55%), Gaps = 18/105 (17%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLCD  305
            LSG T  L  + N++ + +NGAS+S  SQT  ++A EDD+L+ILP  + ++ GKKRKL D
Sbjct  545  LSGLTEALV-QKNDEASKENGASTSNVSQTVSVEAEEDDELQILPAVSGLA-GKKRKLPD  602

Query  304  ---------------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQ  215
                           T   RK  +  +D +  V LDGN +  KK+
Sbjct  603  NANSSNSDLSGVIDETKIPRKAID-REDSEAVVVLDGNGERKKKR  646



>ref|XP_003627740.1| SUMO activating enzyme [Medicago truncatula]
Length=175

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 51/101 (50%), Gaps = 15/101 (15%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL--  311
            LSGWT  +A+  N   +  NGA++S A  T    +  DDD+ I      ISP KKRKL  
Sbjct  80   LSGWTQPVAAAENEDKSVSNGANTSDAPITEVEKSENDDDVGI------ISPVKKRKLPD  133

Query  310  -------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  209
                    D     K  ++ DD D  V LDGN DG KK+RV
Sbjct  134  DSDKSNTADDERHHKKLQVIDDEDDLVMLDGNLDGFKKRRV  174



>gb|KEH19101.1| SUMO1 activating enzyme subunit 2 [Medicago truncatula]
Length=635

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 51/101 (50%), Gaps = 15/101 (15%)
 Frame = -1

Query  484  LSGWTPVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL--  311
            LSGWT  +A+  N   +  NGA++S A  T    +  DDD+ I      ISP KKRKL  
Sbjct  540  LSGWTQPVAAAENEDKSVSNGANTSDAPITEVEKSENDDDVGI------ISPVKKRKLPD  593

Query  310  -------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  209
                    D     K  ++ DD D  V LDGN DG KK+RV
Sbjct  594  DSDKSNTADDERHHKKLQVIDDEDDLVMLDGNLDGFKKRRV  634



>ref|XP_007133804.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
 gb|ESW05798.1| hypothetical protein PHAVU_011G210500g [Phaseolus vulgaris]
Length=642

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 60/106 (57%), Gaps = 23/106 (22%)
 Frame = -1

Query  484  LSGWT-PVLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKL-  311
            LSGW  PV A+EN +K+   NG S+S A+ TA +++ +DD++      T +S  KKRKL 
Sbjct  545  LSGWIQPVSAAENKDKSV-GNGGSTSDAAVTA-VESEKDDEI------TIVSTLKKRKLP  596

Query  310  ------------CDTNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  209
                         DT   +++E +DD+ D  V LDG+ D  KK+R+
Sbjct  597  DETDISSATTADADTKHQKQLEVIDDE-DDLVMLDGDLDSFKKRRL  641



>ref|XP_003541605.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Glycine max]
 gb|KHN37632.1| SUMO-activating enzyme subunit 2 [Glycine soja]
Length=638

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 18/102 (18%)
 Frame = -1

Query  484  LSGWTP-VLASENNNKTTHDNGASSSTASQTAPLDANEDDDLEILPTGTAISPGKKRKLC  308
            LSGWT  V A+EN +K+   NGAS+S A  TA +++ +DD++      T +S  KKRKL 
Sbjct  544  LSGWTQPVSAAENKDKSV-GNGASTSDALITA-VESEKDDEI------TIVSTLKKRKLP  595

Query  307  D---------TNPDRKVEELDDDGDGFVTLDGNSDGSKKQRV  209
            D          + ++K  E+ +D D  V LDG+SD  KK+R+
Sbjct  596  DESDISNSAAESKNQKQLEVIEDEDDLVMLDGDSDSVKKRRL  637



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550