BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026M11

Length=706
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603675.1|  PREDICTED: probable polygalacturonase              315   3e-102   
gb|KDO76503.1|  hypothetical protein CISIN_1g0134022mg                  305   4e-100   Citrus sinensis [apfelsine]
gb|KDO76502.1|  hypothetical protein CISIN_1g0134022mg                  305   2e-99    Citrus sinensis [apfelsine]
gb|KDO76501.1|  hypothetical protein CISIN_1g0134022mg                  303   6e-99    Citrus sinensis [apfelsine]
ref|XP_006439367.1|  hypothetical protein CICLE_v10020162mg             305   2e-98    Citrus clementina [clementine]
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         305   4e-98    
ref|XP_009767931.1|  PREDICTED: probable polygalacturonase              305   4e-98    Nicotiana sylvestris
emb|CDP12145.1|  unnamed protein product                                304   1e-97    Coffea canephora [robusta coffee]
ref|XP_011101030.1|  PREDICTED: probable polygalacturonase              302   7e-97    Sesamum indicum [beniseed]
ref|XP_010266478.1|  PREDICTED: probable polygalacturonase              301   9e-97    Nelumbo nucifera [Indian lotus]
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         301   1e-96    Solanum tuberosum [potatoes]
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    300   6e-96    Solanum lycopersicum
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    300   8e-96    Solanum lycopersicum
ref|XP_002304552.2|  glycoside hydrolase family 28 family protein       295   3e-94    Populus trichocarpa [western balsam poplar]
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              293   2e-93    Vitis vinifera
gb|KDP25309.1|  hypothetical protein JCGZ_20465                         292   4e-93    Jatropha curcas
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              292   4e-93    Sesamum indicum [beniseed]
gb|AIU50439.1|  pectin lyase-like superfamily protein                   290   1e-92    Solanum lycopersicum
gb|AIU50408.1|  pectin lyase-like superfamily protein                   289   3e-92    Citrus clementina [clementine]
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              290   4e-92    Nelumbo nucifera [Indian lotus]
gb|AIU50429.1|  pectin lyase-like superfamily protein                   288   5e-92    Solanum tuberosum [potatoes]
ref|XP_011022514.1|  PREDICTED: probable polygalacturonase              289   7e-92    Populus euphratica
ref|XP_002509949.1|  Polygalacturonase precursor, putative              288   1e-91    Ricinus communis
gb|AIU50426.1|  pectin lyase-like superfamily protein                   286   4e-91    Manihot esculenta [manioc]
ref|XP_003545367.1|  PREDICTED: probable polygalacturonase              285   4e-90    Glycine max [soybeans]
gb|KHN12010.1|  Putative polygalacturonase                              284   6e-90    Glycine soja [wild soybean]
gb|AIU50442.1|  pectin lyase-like superfamily protein                   281   2e-89    Vitis vinifera
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             282   3e-89    Phaseolus vulgaris [French bean]
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         282   3e-89    Cicer arietinum [garbanzo]
gb|AIU50430.1|  pectin lyase-like superfamily protein                   280   5e-89    Populus trichocarpa [western balsam poplar]
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             281   1e-88    Prunus persica
ref|XP_008239046.1|  PREDICTED: probable polygalacturonase              280   1e-88    Prunus mume [ume]
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         280   1e-88    Glycine max [soybeans]
gb|KHM99685.1|  Putative polygalacturonase                              280   2e-88    Glycine soja [wild soybean]
gb|KJB39696.1|  hypothetical protein B456_007G026000                    275   2e-88    Gossypium raimondii
gb|KHN28527.1|  Putative polygalacturonase                              280   2e-88    Glycine soja [wild soybean]
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         280   2e-88    Glycine max [soybeans]
gb|AIU50416.1|  pectin lyase-like superfamily protein                   278   7e-88    Buxus sinica
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              278   2e-87    Theobroma cacao [chocolate]
gb|AIU50410.1|  pectin lyase-like superfamily protein                   276   2e-87    Carica papaya [mamon]
gb|KHG27846.1|  putative polygalacturonase                              276   3e-87    Gossypium arboreum [tree cotton]
gb|KJB39695.1|  hypothetical protein B456_007G026000                    273   6e-87    Gossypium raimondii
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    275   2e-86    Medicago truncatula
ref|XP_008437386.1|  PREDICTED: probable polygalacturonase              275   2e-86    Cucumis melo [Oriental melon]
gb|AIU50435.1|  pectin lyase-like superfamily protein                   273   3e-86    Ricinus communis
gb|AIU50446.1|  pectin lyase-like superfamily protein                   273   3e-86    Platanus x hispanica [London plane tree]
gb|KJB39697.1|  hypothetical protein B456_007G026000                    274   4e-86    Gossypium raimondii
ref|XP_004298894.1|  PREDICTED: probable polygalacturonase              273   8e-86    Fragaria vesca subsp. vesca
ref|XP_003617307.1|  Glycoside hydrolase family 28 protein              273   9e-86    Medicago truncatula
gb|AIU50414.1|  pectin lyase-like superfamily protein                   271   2e-85    Glycine max [soybeans]
gb|EPS61079.1|  hypothetical protein M569_13719                         272   2e-85    Genlisea aurea
ref|XP_004143871.1|  PREDICTED: probable polygalacturonase-like         271   7e-85    Cucumis sativus [cucumbers]
gb|AIU50433.1|  pectin lyase-like superfamily protein                   269   1e-84    Phaseolus vulgaris [French bean]
gb|AIU50443.1|  pectin lyase-like superfamily protein                   269   1e-84    Lactuca sativa [cultivated lettuce]
gb|AIU50407.1|  pectin lyase-like superfamily protein                   269   1e-84    Sarcandra glabra
gb|AIU50431.1|  pectin lyase-like superfamily protein                   268   2e-84    Prunus persica
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             268   1e-83    Phaseolus vulgaris [French bean]
ref|XP_004491304.1|  PREDICTED: probable polygalacturonase-like         267   2e-83    Cicer arietinum [garbanzo]
gb|AIU50418.1|  pectin lyase-like superfamily protein                   266   3e-83    Chloranthus japonicus
gb|AIU50424.1|  pectin lyase-like superfamily protein                   265   4e-83    Medicago truncatula
ref|XP_010053124.1|  PREDICTED: probable polygalacturonase              266   8e-83    
gb|AIU50397.1|  pectin lyase-like superfamily protein                   265   9e-83    Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_010676306.1|  PREDICTED: probable polygalacturonase              265   1e-82    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU50405.1|  pectin lyase-like superfamily protein                   264   1e-82    Theobroma cacao [chocolate]
gb|KHG21610.1|  putative polygalacturonase                              263   6e-82    Gossypium arboreum [tree cotton]
gb|EYU40022.1|  hypothetical protein MIMGU_mgv1a006305mg                263   1e-81    Erythranthe guttata [common monkey flower]
gb|KJB24230.1|  hypothetical protein B456_004G134000                    262   3e-81    Gossypium raimondii
ref|XP_010055855.1|  PREDICTED: probable polygalacturonase              262   3e-81    Eucalyptus grandis [rose gum]
gb|AIU50409.1|  pectin lyase-like superfamily protein                   258   2e-80    Gossypium raimondii
ref|XP_006413510.1|  hypothetical protein EUTSA_v10025189mg             258   6e-80    Eutrema salsugineum [saltwater cress]
gb|AIU50434.1|  pectin lyase-like superfamily protein                   253   7e-80    Artemisia annua [sweet Annie]
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              258   7e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380525.1|  PREDICTED: probable polygalacturonase              256   3e-79    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU50402.1|  pectin lyase-like superfamily protein                   254   5e-79    Magnolia denudata [haku-mokuren]
gb|AIU50420.1|  pectin lyase-like superfamily protein                   254   7e-79    Chimonanthus praecox [wintersweet]
gb|KJB39694.1|  hypothetical protein B456_007G026000                    255   7e-79    Gossypium raimondii
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              255   8e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010925748.1|  PREDICTED: probable polygalacturonase              255   9e-79    
emb|CDY47619.1|  BnaA01g13460D                                          255   1e-78    Brassica napus [oilseed rape]
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    255   1e-78    Tarenaya hassleriana [spider flower]
ref|XP_010541551.1|  PREDICTED: probable polygalacturonase isofor...    255   2e-78    Tarenaya hassleriana [spider flower]
ref|XP_008790157.1|  PREDICTED: probable polygalacturonase              254   2e-78    Phoenix dactylifera
gb|AIU50441.1|  pectin lyase-like superfamily protein                   253   3e-78    Schrenkiella parvula
emb|CDY03516.1|  BnaC01g15660D                                          253   8e-78    
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              253   8e-78    Brassica rapa
gb|AIU50413.1|  pectin lyase-like superfamily protein                   251   9e-78    Eucalyptus grandis [rose gum]
gb|AIU50448.1|  pectin lyase-like superfamily protein                   251   1e-77    Houttuynia cordata [chameleon-plant]
ref|XP_010913844.1|  PREDICTED: probable polygalacturonase isofor...    249   1e-77    
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   252   2e-77    Arabidopsis halleri
emb|CDY10970.1|  BnaA03g46290D                                          251   5e-77    Brassica napus [oilseed rape]
emb|CDX94222.1|  BnaC07g38560D                                          251   7e-77    
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              250   7e-77    Brassica rapa
gb|AIU50423.1|  pectin lyase-like superfamily protein                   249   1e-76    Aristolochia tagala
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              249   1e-76    
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    250   1e-76    Elaeis guineensis
gb|AIU50427.1|  pectin lyase-like superfamily protein                   248   1e-76    Erythranthe guttata [common monkey flower]
gb|AIU50404.1|  pectin lyase-like superfamily protein                   248   2e-76    Pinellia ternata
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    249   2e-76    Arabidopsis thaliana [mouse-ear cress]
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    249   2e-76    Arabis alpina [alpine rockcress]
gb|AIU50421.1|  pectin lyase-like superfamily protein                   248   2e-76    Pandanus utilis
gb|AIU50437.1|  pectin lyase-like superfamily protein                   247   5e-76    Yucca filamentosa [Adam's-needle]
ref|NP_199002.1|  pectin lyase-like superfamily protein                 248   5e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441363.1|  PREDICTED: probable polygalacturonase              248   8e-76    Camelina sativa [gold-of-pleasure]
gb|AAO62947.1|  putative polygalacturonase-like protein                 239   1e-75    Lactuca sativa [cultivated lettuce]
gb|AIU50403.1|  pectin lyase-like superfamily protein                   245   2e-75    Musa acuminata [banana]
ref|XP_006283738.1|  hypothetical protein CARUB_v10004811mg             246   2e-75    Capsella rubella
gb|AIN44009.1|  polygalacturonase-like protein                          246   3e-75    Brassica juncea var. tumida [zha cai]
gb|AIU50415.1|  pectin lyase-like superfamily protein                   244   5e-75    Illicium henryi
gb|AIU50399.1|  pectin lyase-like superfamily protein                   244   5e-75    Arabidopsis lyrata [lyrate rockcress]
ref|XP_010448059.1|  PREDICTED: probable polygalacturonase              245   6e-75    Camelina sativa [gold-of-pleasure]
gb|AIU50401.1|  pectin lyase-like superfamily protein                   244   7e-75    Lilium brownii [Hong Kong lily]
gb|AIU50400.1|  pectin lyase-like superfamily protein                   244   9e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868572.1|  glycoside hydrolase family 28 protein              245   9e-75    Arabidopsis lyrata subsp. lyrata
gb|AIU50411.1|  pectin lyase-like superfamily protein                   243   1e-74    Capsella rubella
ref|XP_006405300.1|  hypothetical protein EUTSA_v10027765mg             244   2e-74    Eutrema salsugineum [saltwater cress]
ref|XP_006283728.1|  hypothetical protein CARUB_v10004799mg             244   3e-74    Capsella rubella
ref|XP_004961056.1|  PREDICTED: probable polygalacturonase-like         244   3e-74    Setaria italica
gb|AIU50422.1|  pectin lyase-like superfamily protein                   242   3e-74    Asparagus officinalis
ref|XP_009395761.1|  PREDICTED: probable polygalacturonase              243   5e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              243   7e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              242   8e-74    Camelina sativa [gold-of-pleasure]
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              242   9e-74    Phoenix dactylifera
gb|EAY85246.1|  hypothetical protein OsI_06620                          242   1e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              241   2e-73    Camelina sativa [gold-of-pleasure]
gb|AIU50425.1|  pectin lyase-like superfamily protein                   240   2e-73    Canna indica [canna]
gb|KFK32989.1|  hypothetical protein AALP_AA6G314900                    240   5e-73    Arabis alpina [alpine rockcress]
gb|AIU50450.1|  pectin lyase-like superfamily protein                   239   6e-73    Alisma plantago-aquatica
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              240   6e-73    Elaeis guineensis
dbj|BAD61522.1|  polygalacturonase-like                                 234   7e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010527633.1|  PREDICTED: probable polygalacturonase              231   2e-72    Tarenaya hassleriana [spider flower]
ref|NP_001046468.1|  Os02g0256100                                       239   2e-72    
gb|AIU50445.1|  pectin lyase-like superfamily protein                   238   2e-72    Cinnamomum camphora
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              238   3e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006654851.1|  PREDICTED: probable polygalacturonase-like         234   4e-72    
ref|NP_001043594.2|  Os01g0618900                                       233   7e-72    
emb|CDY13383.1|  BnaC06g13740D                                          237   9e-72    Brassica napus [oilseed rape]
ref|XP_002441600.1|  hypothetical protein SORBIDRAFT_09g030140          237   9e-72    Sorghum bicolor [broomcorn]
emb|CDX67513.1|  BnaA07g15530D                                          237   1e-71    
ref|XP_009125202.1|  PREDICTED: probable polygalacturonase              236   2e-71    Brassica rapa
emb|CDM83426.1|  unnamed protein product                                236   3e-71    Triticum aestivum [Canadian hard winter wheat]
gb|AIU50438.1|  pectin lyase-like superfamily protein                   234   5e-71    Setaria italica
gb|AIU50432.1|  pectin lyase-like superfamily protein                   233   1e-70    Panicum virgatum
ref|XP_004951285.1|  PREDICTED: probable polygalacturonase-like         234   2e-70    Setaria italica
gb|EAZ12715.1|  hypothetical protein OsJ_02632                          233   2e-70    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89948.1|  predicted protein                                      234   2e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94644.1|  predicted protein                                      234   2e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY74990.1|  hypothetical protein OsI_02888                          233   4e-70    Oryza sativa Indica Group [Indian rice]
gb|AIU50444.1|  pectin lyase-like superfamily protein                   230   2e-69    Ceratophyllum platyacanthum subsp. oryzetorum
ref|NP_001149385.1|  LOC100283011 precursor                             230   4e-69    
ref|XP_004969187.1|  PREDICTED: probable polygalacturonase-like         230   4e-69    Setaria italica
gb|AFW81284.1|  hypothetical protein ZEAMMB73_960645                    230   7e-69    
ref|XP_002455965.1|  hypothetical protein SORBIDRAFT_03g028140          229   1e-68    Sorghum bicolor [broomcorn]
gb|AIU50440.1|  pectin lyase-like superfamily protein                   228   1e-68    Sorghum bicolor [broomcorn]
ref|NP_001056466.1|  Os05g0587000                                       229   2e-68    
gb|EAY99223.1|  hypothetical protein OsI_21181                          229   2e-68    Oryza sativa Indica Group [Indian rice]
gb|AAT44156.1|  putative polygalacturonase                              229   2e-68    Oryza sativa Japonica Group [Japonica rice]
gb|ACN36471.1|  unknown                                                 226   2e-68    Zea mays [maize]
gb|AIU50436.1|  pectin lyase-like superfamily protein                   227   2e-68    Dioscorea oppositifolia
ref|NP_001141464.1|  uncharacterized protein LOC100273574 precursor     228   3e-68    Zea mays [maize]
ref|XP_006646109.1|  PREDICTED: probable polygalacturonase-like         228   4e-68    
ref|XP_003569374.1|  PREDICTED: probable polygalacturonase              227   8e-68    Brachypodium distachyon [annual false brome]
ref|NP_001170283.1|  uncharacterized protein LOC100384246 precursor     226   1e-67    Zea mays [maize]
ref|XP_006837459.1|  hypothetical protein AMTR_s00107p00122980          226   2e-67    Amborella trichopoda
gb|AIU50449.1|  pectin lyase-like superfamily protein                   224   2e-67    Zea mays [maize]
gb|AIU50451.1|  pectin lyase-like superfamily protein                   224   4e-67    Cabomba caroliniana
ref|XP_002451891.1|  hypothetical protein SORBIDRAFT_04g009310          223   3e-66    Sorghum bicolor [broomcorn]
gb|AIU50447.1|  pectin lyase-like superfamily protein                   215   9e-64    Ginkgo biloba [ginkgo]
gb|AIU50417.1|  pectin lyase-like superfamily protein                   214   2e-63    Iris japonica
gb|EMT32528.1|  Putative polygalacturonase                              212   3e-62    
gb|AIU50428.1|  pectin lyase-like superfamily protein                   199   3e-60    Persea americana
gb|AIU50419.1|  pectin lyase-like superfamily protein                   202   6e-59    Ceratophyllum demersum [hornwort]
gb|KHN38363.1|  Putative polygalacturonase                              194   2e-56    Glycine soja [wild soybean]
gb|EYU46764.1|  hypothetical protein MIMGU_mgv1a0060621mg               177   5e-50    Erythranthe guttata [common monkey flower]
ref|XP_007223360.1|  hypothetical protein PRUPE_ppa005599mg             176   3e-48    Prunus persica
ref|XP_008223260.1|  PREDICTED: probable polygalacturonase              176   3e-48    Prunus mume [ume]
ref|XP_011079616.1|  PREDICTED: probable polygalacturonase isofor...    175   5e-48    Sesamum indicum [beniseed]
ref|XP_011079615.1|  PREDICTED: probable polygalacturonase isofor...    175   5e-48    Sesamum indicum [beniseed]
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase              175   6e-48    Nicotiana sylvestris
ref|XP_009784607.1|  PREDICTED: probable polygalacturonase isofor...    174   8e-48    Nicotiana sylvestris
ref|XP_009784614.1|  PREDICTED: probable polygalacturonase isofor...    174   1e-47    Nicotiana sylvestris
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    174   1e-47    Glycine max [soybeans]
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     174   1e-47    Glycine max [soybeans]
ref|XP_009624281.1|  PREDICTED: probable polygalacturonase              174   1e-47    Nicotiana tomentosiformis
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    174   1e-47    Glycine max [soybeans]
ref|XP_003626072.1|  Polygalacturonase                                  174   2e-47    Medicago truncatula
gb|KHN14175.1|  Putative polygalacturonase                              174   2e-47    Glycine soja [wild soybean]
ref|XP_010649560.1|  PREDICTED: probable polygalacturonase              169   2e-47    
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    174   2e-47    Medicago truncatula
gb|KJB34666.1|  hypothetical protein B456_006G077400                    170   3e-47    Gossypium raimondii
ref|XP_004487815.1|  PREDICTED: probable polygalacturonase-like         173   3e-47    Cicer arietinum [garbanzo]
gb|KEH37171.1|  polygalacturonase/glycoside hydrolase family protein    171   3e-47    Medicago truncatula
ref|XP_009624502.1|  PREDICTED: probable polygalacturonase              175   3e-47    Nicotiana tomentosiformis
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              173   4e-47    Populus euphratica
emb|CDP17099.1|  unnamed protein product                                173   4e-47    Coffea canephora [robusta coffee]
gb|KJB34667.1|  hypothetical protein B456_006G077400                    169   5e-47    Gossypium raimondii
ref|XP_010094123.1|  putative polygalacturonase                         172   6e-47    
ref|XP_006584015.1|  PREDICTED: probable polygalacturonase-like i...    171   6e-47    Glycine max [soybeans]
ref|XP_006355845.1|  PREDICTED: probable polygalacturonase-like         172   7e-47    Solanum tuberosum [potatoes]
gb|KHN14635.1|  Putative polygalacturonase                              170   8e-47    Glycine soja [wild soybean]
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    172   8e-47    Glycine max [soybeans]
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    172   8e-47    Glycine max [soybeans]
gb|KEH37170.1|  polygalacturonase/glycoside hydrolase family protein    172   9e-47    Medicago truncatula
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              172   1e-46    Populus euphratica
gb|KDP28345.1|  hypothetical protein JCGZ_14116                         171   1e-46    Jatropha curcas
ref|XP_004240577.1|  PREDICTED: probable polygalacturonase              171   2e-46    Solanum lycopersicum
ref|XP_003528627.1|  PREDICTED: probable polygalacturonase-like i...    171   2e-46    Glycine max [soybeans]
gb|KHN02933.1|  Putative polygalacturonase                              171   2e-46    Glycine soja [wild soybean]
ref|XP_007138953.1|  hypothetical protein PHAVU_009G252200g             171   3e-46    Phaseolus vulgaris [French bean]
gb|KHN43408.1|  Putative polygalacturonase                              172   3e-46    Glycine soja [wild soybean]
ref|XP_006597720.1|  PREDICTED: probable polygalacturonase-like i...    170   3e-46    Glycine max [soybeans]
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    170   3e-46    
ref|XP_006597719.1|  PREDICTED: probable polygalacturonase-like i...    171   3e-46    Glycine max [soybeans]
ref|XP_008780530.1|  PREDICTED: probable polygalacturonase              164   4e-46    
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    170   4e-46    Elaeis guineensis
ref|XP_009387922.1|  PREDICTED: probable polygalacturonase              170   4e-46    
ref|XP_010544930.1|  PREDICTED: probable polygalacturonase              165   5e-46    Tarenaya hassleriana [spider flower]
ref|XP_010465709.1|  PREDICTED: probable polygalacturonase              169   6e-46    Camelina sativa [gold-of-pleasure]
ref|XP_009412155.1|  PREDICTED: probable polygalacturonase              169   6e-46    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010487555.1|  PREDICTED: probable polygalacturonase              169   7e-46    Camelina sativa [gold-of-pleasure]
ref|XP_003533248.1|  PREDICTED: probable polygalacturonase isofor...    169   8e-46    Glycine max [soybeans]
ref|XP_011463918.1|  PREDICTED: probable polygalacturonase isofor...    169   9e-46    Fragaria vesca subsp. vesca
gb|ABG34277.1|  polygalacturonase                                       164   1e-45    Eucalyptus globulus subsp. globulus
gb|KEH43186.1|  polygalacturonase/glycoside hydrolase family protein    168   1e-45    Medicago truncatula
gb|AFG59706.1|  hypothetical protein 0_17434_01                         160   1e-45    Pinus taeda
emb|CBI36899.3|  unnamed protein product                                169   1e-45    Vitis vinifera
ref|XP_010652214.1|  PREDICTED: probable polygalacturonase              169   1e-45    Vitis vinifera
ref|XP_004298828.1|  PREDICTED: probable polygalacturonase isofor...    169   1e-45    Fragaria vesca subsp. vesca
gb|KHN26517.1|  Putative polygalacturonase                              169   1e-45    Glycine soja [wild soybean]
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              169   1e-45    
gb|KJB34665.1|  hypothetical protein B456_006G077400                    168   1e-45    Gossypium raimondii
gb|ABG34275.1|  polygalacturonase                                       163   1e-45    Eucalyptus globulus subsp. globulus
ref|XP_011467185.1|  PREDICTED: probable polygalacturonase isofor...    168   2e-45    Fragaria vesca subsp. vesca
ref|XP_006841512.1|  hypothetical protein AMTR_s00003p00141260          169   2e-45    
ref|XP_006586911.1|  PREDICTED: probable polygalacturonase isofor...    169   2e-45    Glycine max [soybeans]
gb|KHG14610.1|  putative polygalacturonase                              168   2e-45    Gossypium arboreum [tree cotton]
gb|KJB72747.1|  hypothetical protein B456_011G194200                    168   2e-45    Gossypium raimondii
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase isofor...    168   2e-45    Fragaria vesca subsp. vesca
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             168   2e-45    
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             168   2e-45    Prunus persica
ref|XP_011458753.1|  PREDICTED: probable polygalacturonase isofor...    168   2e-45    Fragaria vesca subsp. vesca
gb|KHG12205.1|  putative polygalacturonase                              168   3e-45    Gossypium arboreum [tree cotton]
ref|XP_010241442.1|  PREDICTED: probable polygalacturonase isofor...    166   3e-45    Nelumbo nucifera [Indian lotus]
gb|ABG34278.1|  polygalacturonase                                       164   3e-45    Eucalyptus globulus subsp. globulus
ref|XP_002273305.1|  PREDICTED: probable polygalacturonase              167   3e-45    
ref|XP_003550546.2|  PREDICTED: probable polygalacturonase-like         167   3e-45    Glycine max [soybeans]
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             167   3e-45    
gb|AEW08036.1|  hypothetical protein 0_17434_01                         159   4e-45    Pinus radiata
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    168   4e-45    Medicago truncatula
ref|XP_008351179.1|  PREDICTED: probable polygalacturonase              162   4e-45    
ref|XP_011458751.1|  PREDICTED: probable polygalacturonase isofor...    167   4e-45    Fragaria vesca subsp. vesca
gb|KHN03332.1|  Putative polygalacturonase                              167   4e-45    Glycine soja [wild soybean]
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              167   4e-45    Phoenix dactylifera
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g             167   4e-45    Phaseolus vulgaris [French bean]
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    167   4e-45    Nelumbo nucifera [Indian lotus]
emb|CBI22951.3|  unnamed protein product                                167   5e-45    Vitis vinifera
ref|XP_003633958.1|  PREDICTED: probable polygalacturonase              167   5e-45    Vitis vinifera
gb|AFG59697.1|  hypothetical protein 0_17434_01                         158   6e-45    Pinus taeda
sp|A7PZL3.1|PGLR_VITVI  RecName: Full=Probable polygalacturonase;...    167   7e-45    Vitis vinifera
gb|AFK37962.1|  unknown                                                 167   7e-45    Lotus japonicus
ref|XP_003591306.1|  Polygalacturonase-like protein                     169   7e-45    
gb|KHN16795.1|  Putative polygalacturonase                              166   8e-45    Glycine soja [wild soybean]
ref|XP_003535296.2|  PREDICTED: probable polygalacturonase-like         167   8e-45    Glycine max [soybeans]
ref|XP_009607671.1|  PREDICTED: probable polygalacturonase              167   1e-44    Nicotiana tomentosiformis
ref|XP_002535132.1|  Polygalacturonase precursor, putative              166   1e-44    
gb|ABG34276.1|  polygalacturonase                                       160   1e-44    Eucalyptus globulus subsp. globulus
gb|KHM99951.1|  Putative polygalacturonase                              166   1e-44    Glycine soja [wild soybean]
gb|EMS62381.1|  putative polygalacturonase                              161   2e-44    Triticum urartu
ref|XP_003519731.2|  PREDICTED: probable polygalacturonase-like i...    166   2e-44    Glycine max [soybeans]
gb|KHN00242.1|  Putative polygalacturonase                              166   2e-44    Glycine soja [wild soybean]
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...    166   2e-44    Glycine max [soybeans]
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...    166   2e-44    Glycine max [soybeans]
gb|AFK44529.1|  unknown                                                 166   2e-44    Lotus japonicus
ref|XP_010259446.1|  PREDICTED: probable polygalacturonase              165   2e-44    Nelumbo nucifera [Indian lotus]
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...    166   2e-44    Glycine max [soybeans]
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              165   3e-44    Vitis vinifera
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...    166   3e-44    Glycine max [soybeans]
gb|AFG59707.1|  hypothetical protein 0_17434_01                         157   3e-44    Pinus taeda
ref|XP_004172519.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    165   3e-44    
gb|KDO86269.1|  hypothetical protein CISIN_1g0090751mg                  160   3e-44    Citrus sinensis [apfelsine]
ref|XP_004134229.1|  PREDICTED: probable polygalacturonase-like         165   3e-44    
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    165   4e-44    
ref|XP_006297662.1|  hypothetical protein CARUB_v10013686mg             164   4e-44    
ref|XP_007154320.1|  hypothetical protein PHAVU_003G108700g             164   4e-44    
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    165   5e-44    
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...    165   5e-44    
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    165   6e-44    
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    164   6e-44    
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    165   7e-44    
ref|XP_004503678.1|  PREDICTED: probable polygalacturonase-like i...    165   7e-44    
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg                164   7e-44    
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              164   8e-44    
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              164   9e-44    
ref|XP_010504717.1|  PREDICTED: probable polygalacturonase              164   9e-44    
ref|XP_009346202.1|  PREDICTED: probable polygalacturonase              164   1e-43    
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    164   1e-43    
gb|ABR18040.1|  unknown                                                 164   1e-43    
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase              164   1e-43    
ref|XP_009772512.1|  PREDICTED: probable polygalacturonase              164   1e-43    
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     163   1e-43    
ref|XP_002962842.1|  hypothetical protein SELMODRAFT_78556              163   1e-43    
ref|XP_008438913.1|  PREDICTED: probable polygalacturonase isofor...    163   1e-43    
ref|XP_008438914.1|  PREDICTED: probable polygalacturonase isofor...    163   1e-43    
ref|XP_010091430.1|  putative polygalacturonase                         163   1e-43    
ref|XP_007145093.1|  hypothetical protein PHAVU_007G209200g             163   1e-43    
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              163   2e-43    
emb|CDX67875.1|  BnaA07g19150D                                          163   2e-43    
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              163   2e-43    
ref|XP_011011881.1|  PREDICTED: probable polygalacturonase isofor...    162   2e-43    
ref|XP_010089056.1|  putative polygalacturonase                         163   2e-43    
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    163   2e-43    
ref|XP_011011880.1|  PREDICTED: probable polygalacturonase isofor...    163   2e-43    
ref|XP_002986281.1|  hypothetical protein SELMODRAFT_124011             162   2e-43    
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              163   2e-43    
ref|XP_003609706.1|  hypothetical protein MTR_4g120730                  163   2e-43    
ref|XP_002511903.1|  polygalacturonase, putative                        163   2e-43    
ref|XP_008361956.1|  PREDICTED: probable polygalacturonase              161   2e-43    
ref|XP_011007067.1|  PREDICTED: probable polygalacturonase              162   2e-43    
ref|XP_010914786.1|  PREDICTED: probable polygalacturonase              163   2e-43    
ref|XP_008386709.1|  PREDICTED: probable polygalacturonase              162   3e-43    
ref|XP_008390608.1|  PREDICTED: probable polygalacturonase              162   3e-43    
gb|EPS72197.1|  hypothetical protein M569_02558                         162   3e-43    
ref|XP_002526639.1|  polygalacturonase, putative                        163   3e-43    
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...    163   3e-43    
gb|KDO36047.1|  hypothetical protein CISIN_1g038330mg                   157   3e-43    
ref|XP_002509850.1|  polygalacturonase, putative                        162   3e-43    
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...    162   3e-43    
emb|CDY25090.1|  BnaC06g18320D                                          162   3e-43    
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                   162   3e-43    
ref|XP_004508182.1|  PREDICTED: probable polygalacturonase-like         162   3e-43    
ref|XP_006439488.1|  hypothetical protein CICLE_v10019941mg             162   3e-43    
ref|XP_010679488.1|  PREDICTED: probable polygalacturonase isofor...    162   4e-43    
ref|XP_010679489.1|  PREDICTED: probable polygalacturonase isofor...    162   4e-43    
ref|XP_002989426.1|  hypothetical protein SELMODRAFT_129742             162   4e-43    
ref|XP_009378739.1|  PREDICTED: probable polygalacturonase isofor...    162   4e-43    
ref|XP_002314352.2|  hypothetical protein POPTR_0010s00770g             162   4e-43    
ref|XP_002988771.1|  hypothetical protein SELMODRAFT_128450             162   4e-43    
gb|KHG15710.1|  hypothetical protein F383_10492                         162   4e-43    
gb|KHG15709.1|  hypothetical protein F383_10492                         162   5e-43    
gb|KJB41375.1|  hypothetical protein B456_007G102200                    160   5e-43    
ref|XP_009378738.1|  PREDICTED: probable polygalacturonase isofor...    162   5e-43    
emb|CDY11403.1|  BnaA09g39690D                                          162   5e-43    
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase              162   6e-43    
gb|KDP42567.1|  hypothetical protein JCGZ_24341                         162   6e-43    
ref|XP_007201026.1|  hypothetical protein PRUPE_ppa006130mg             161   6e-43    
ref|XP_008340766.1|  PREDICTED: probable polygalacturonase              161   6e-43    
ref|XP_006380233.1|  glycoside hydrolase family 28 family protein       161   6e-43    
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              162   7e-43    
gb|KFK39027.1|  hypothetical protein AALP_AA3G191200                    161   9e-43    
ref|XP_008390626.1|  PREDICTED: probable polygalacturonase              163   9e-43    
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              161   9e-43    
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             161   1e-42    
emb|CDP12065.1|  unnamed protein product                                160   1e-42    
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             160   1e-42    
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         161   1e-42    
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like         160   2e-42    
gb|KJB52729.1|  hypothetical protein B456_008G274700                    160   2e-42    
emb|CAN69072.1|  hypothetical protein VITISV_012807                     151   2e-42    
ref|XP_010523770.1|  PREDICTED: probable polygalacturonase isofor...    160   2e-42    
gb|KJB41376.1|  hypothetical protein B456_007G102200                    160   2e-42    
gb|KJB41374.1|  hypothetical protein B456_007G102200                    160   2e-42    
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             161   2e-42    
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             160   2e-42    
ref|XP_010676424.1|  PREDICTED: probable polygalacturonase              160   3e-42    
ref|XP_009346609.1|  PREDICTED: probable polygalacturonase isofor...    159   3e-42    
ref|XP_009346610.1|  PREDICTED: probable polygalacturonase isofor...    159   3e-42    
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         160   3e-42    
ref|XP_002307030.2|  hypothetical protein POPTR_0005s06430g             160   3e-42    
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    160   4e-42    
gb|KHG19694.1|  putative polygalacturonase                              159   4e-42    
ref|XP_010941157.1|  PREDICTED: probable polygalacturonase              160   4e-42    
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase              160   4e-42    
ref|XP_010523769.1|  PREDICTED: probable polygalacturonase isofor...    159   4e-42    
ref|XP_010245458.1|  PREDICTED: probable polygalacturonase isofor...    159   5e-42    
ref|XP_010245459.1|  PREDICTED: probable polygalacturonase isofor...    159   5e-42    
ref|XP_010276903.1|  PREDICTED: probable polygalacturonase isofor...    159   5e-42    
ref|XP_009383709.1|  PREDICTED: probable polygalacturonase              159   5e-42    
ref|XP_002883030.1|  hypothetical protein ARALYDRAFT_318449             159   6e-42    
ref|XP_008345224.1|  PREDICTED: probable polygalacturonase isofor...    159   6e-42    
gb|KJB11781.1|  hypothetical protein B456_001G158900                    159   7e-42    
gb|KEH21119.1|  polygalacturonase/glycoside hydrolase family protein    159   7e-42    
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g             159   7e-42    
gb|AAM62920.1|  polygalacturonase, putative                             159   7e-42    
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    158   7e-42    
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         159   8e-42    
dbj|BAA95779.1|  polygalacturonase-like protein                         158   8e-42    
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              159   8e-42    
ref|NP_188308.1|  pectin lyase-like superfamily protein                 158   8e-42    
ref|XP_006386609.1|  hypothetical protein POPTR_0002s16390g             156   8e-42    
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase              159   8e-42    
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       158   9e-42    
emb|CDX76617.1|  BnaC08g32030D                                          158   9e-42    
ref|XP_009395434.1|  PREDICTED: probable polygalacturonase isofor...    159   1e-41    
ref|XP_009395433.1|  PREDICTED: probable polygalacturonase isofor...    159   1e-41    
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              158   1e-41    
ref|XP_008345223.1|  PREDICTED: probable polygalacturonase isofor...    158   1e-41    
ref|XP_010276902.1|  PREDICTED: probable polygalacturonase isofor...    159   1e-41    
gb|KJB38841.1|  hypothetical protein B456_006G260100                    157   1e-41    
ref|NP_567126.1|  pectin lyase-like superfamily protein                 158   1e-41    
ref|XP_010027649.1|  PREDICTED: probable polygalacturonase              159   1e-41    
emb|CAB71871.1|  putative protein                                       158   1e-41    
gb|KDO71782.1|  hypothetical protein CISIN_1g012788mg                   158   1e-41    
ref|XP_009384145.1|  PREDICTED: probable polygalacturonase              158   1e-41    
ref|XP_011462745.1|  PREDICTED: probable polygalacturonase              158   1e-41    
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    158   1e-41    
ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...    158   1e-41    
gb|KHN30667.1|  Putative polygalacturonase                              158   1e-41    
gb|KJB49712.1|  hypothetical protein B456_008G134500                    158   1e-41    
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         158   2e-41    
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_011092828.1|  PREDICTED: probable polygalacturonase              158   2e-41    
emb|CDX92101.1|  BnaA05g23060D                                          157   2e-41    
ref|XP_010933983.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_008794777.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_006829063.1|  hypothetical protein AMTR_s00001p00258260          158   2e-41    
gb|KHN08663.1|  Putative polygalacturonase                              155   2e-41    
ref|XP_004240097.1|  PREDICTED: probable polygalacturonase              158   2e-41    
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_010276899.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    158   2e-41    
ref|XP_006588584.1|  PREDICTED: probable polygalacturonase-like         157   2e-41    
gb|KDP28587.1|  hypothetical protein JCGZ_14358                         158   2e-41    
gb|KJB49711.1|  hypothetical protein B456_008G134500                    157   2e-41    
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_010933982.1|  PREDICTED: probable polygalacturonase isofor...    158   2e-41    
ref|XP_006842393.1|  hypothetical protein AMTR_s00209p00025840          158   2e-41    
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              157   2e-41    
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              157   2e-41    
ref|XP_007035679.1|  Pectin lyase-like superfamily protein              159   2e-41    
ref|XP_009146055.1|  PREDICTED: probable polygalacturonase              157   3e-41    
gb|KJB38840.1|  hypothetical protein B456_006G260100                    157   3e-41    
gb|KJB38842.1|  hypothetical protein B456_006G260100                    157   3e-41    
gb|KJB20605.1|  hypothetical protein B456_003G155800                    157   3e-41    
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              157   3e-41    
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              157   3e-41    
emb|CDP20376.1|  unnamed protein product                                157   3e-41    
gb|KDP25392.1|  hypothetical protein JCGZ_20548                         157   4e-41    
ref|XP_002301370.1|  polygalacturonase-like family protein              157   4e-41    
ref|XP_006362679.1|  PREDICTED: probable polygalacturonase-like         157   4e-41    
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...    157   4e-41    
ref|XP_006589526.1|  PREDICTED: probable polygalacturonase-like i...    157   4e-41    
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase              157   5e-41    
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...    157   5e-41    
gb|KHN21786.1|  Putative polygalacturonase                              156   5e-41    
ref|XP_003592200.1|  Polygalacturonase-like protein                     157   5e-41    
ref|XP_006664631.1|  PREDICTED: probable polygalacturonase-like         155   5e-41    
gb|EPS71596.1|  hypothetical protein M569_03160                         157   5e-41    
ref|XP_008810195.1|  PREDICTED: probable polygalacturonase isofor...    156   5e-41    
ref|XP_008810197.1|  PREDICTED: probable polygalacturonase isofor...    156   5e-41    
ref|XP_003535597.1|  PREDICTED: probable polygalacturonase-like i...    156   5e-41    
ref|XP_009138190.1|  PREDICTED: probable polygalacturonase              157   5e-41    
ref|XP_011023292.1|  PREDICTED: probable polygalacturonase isofor...    156   5e-41    
ref|XP_011023291.1|  PREDICTED: probable polygalacturonase isofor...    156   5e-41    
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              157   5e-41    
ref|XP_006280304.1|  hypothetical protein CARUB_v10026227mg             157   5e-41    
gb|KJB20604.1|  hypothetical protein B456_003G155800                    157   5e-41    
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         157   5e-41    
ref|XP_008807914.1|  PREDICTED: probable polygalacturonase              156   5e-41    
ref|XP_008235135.1|  PREDICTED: probable polygalacturonase              156   5e-41    
ref|XP_008810198.1|  PREDICTED: probable polygalacturonase isofor...    156   6e-41    
ref|XP_007051732.1|  Polygalacturonase, putative isoform 2              156   6e-41    
ref|XP_003548644.2|  PREDICTED: probable polygalacturonase-like i...    157   6e-41    
gb|KHN46704.1|  Putative polygalacturonase                              156   6e-41    
gb|KDP27854.1|  hypothetical protein JCGZ_18934                         156   6e-41    
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase              156   6e-41    
gb|EMT30389.1|  Putative polygalacturonase                              156   6e-41    
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like         156   6e-41    
ref|XP_008810196.1|  PREDICTED: probable polygalacturonase isofor...    156   6e-41    
ref|XP_006598941.1|  PREDICTED: probable polygalacturonase-like i...    156   6e-41    
ref|XP_007219266.1|  hypothetical protein PRUPE_ppa018224mg             156   7e-41    
gb|KHG23155.1|  putative polygalacturonase                              156   7e-41    
ref|XP_003575492.1|  PREDICTED: probable polygalacturonase              156   7e-41    
ref|XP_003624048.1|  Polygalacturonase                                  156   8e-41    
gb|EMS62063.1|  putative polygalacturonase                              156   8e-41    
gb|KJB24315.1|  hypothetical protein B456_004G138900                    156   8e-41    
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...    156   8e-41    
ref|XP_003519755.1|  PREDICTED: probable polygalacturonase              155   8e-41    
ref|XP_002310517.2|  glycoside hydrolase family 28 family protein       155   8e-41    
ref|XP_010530415.1|  PREDICTED: probable polygalacturonase              155   9e-41    
ref|XP_010436419.1|  PREDICTED: probable polygalacturonase              154   9e-41    
ref|XP_006295548.1|  hypothetical protein CARUB_v10024654mg             155   1e-40    
ref|XP_006419481.1|  hypothetical protein CICLE_v10004942mg             155   1e-40    
ref|XP_009393955.1|  PREDICTED: probable polygalacturonase              150   1e-40    
ref|XP_009613774.1|  PREDICTED: probable polygalacturonase              156   1e-40    
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              155   1e-40    
ref|XP_009137085.1|  PREDICTED: probable polygalacturonase              156   1e-40    
ref|XP_003622464.1|  Polygalacturonase-like protein                     155   1e-40    
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...    155   1e-40    
ref|XP_009399273.1|  PREDICTED: probable polygalacturonase isofor...    155   1e-40    
gb|KHN20382.1|  Putative polygalacturonase                              154   1e-40    
gb|AFK43011.1|  unknown                                                 155   1e-40    
ref|XP_006402475.1|  hypothetical protein EUTSA_v10005939mg             155   1e-40    
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g             155   1e-40    
gb|ACG41831.1|  glycoside hydrolase, family 28                          155   1e-40    
ref|XP_009399272.1|  PREDICTED: probable polygalacturonase isofor...    155   1e-40    
ref|XP_007209970.1|  hypothetical protein PRUPE_ppa004996mg             155   2e-40    
gb|AES62452.2|  pectin lyase superfamily protein                        155   2e-40    
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    155   2e-40    
ref|XP_007040335.1|  Pectin lyase-like superfamily protein isoform 1    155   2e-40    
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          155   2e-40    



>ref|XP_009603675.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=448

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 171/198 (86%), Gaps = 1/198 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+VDVLAEHINL+N
Sbjct  251  DDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHINLFN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVSNVYMEN RTGIKIAGDVGDHPD  FNPNALP+V GIK
Sbjct  311  MGVGIHIKTNIGRGGVIRNITVSNVYMENTRTGIKIAGDVGDHPDENFNPNALPVVKGIK  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSPW  168
            I+DVWG+KV Q G IRG K SPF+ ICLSNI+L+G +  PRN PWKCSDV GAAIQVSPW
Sbjct  371  IKDVWGEKVLQAGLIRGLKNSPFSGICLSNINLHGNNPGPRNSPWKCSDVSGAAIQVSPW  430

Query  167  PCSELAXNHRYGACSATL  114
            PCSEL  + + GACS  L
Sbjct  431  PCSELTSSQQTGACSTYL  448



>gb|KDO76503.1| hypothetical protein CISIN_1g0134022mg [Citrus sinensis]
Length=280

 Score =   305 bits (780),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P  GI IRRVTGSSPFSGI+VGSET GG+ +VLAEHINLYN
Sbjct  84   DDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINLYN  143

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+GI 
Sbjct  144  VGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNGIT  203

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG KV Q G I+G K SPFT ICLSNI+L G + P +PP KCSDV G+A QV PWP
Sbjct  204  IKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKPWP  263

Query  164  CSELAXNHRYGACS  123
            CSEL+ + + GACS
Sbjct  264  CSELSSSQQTGACS  277



>gb|KDO76502.1| hypothetical protein CISIN_1g0134022mg [Citrus sinensis]
Length=328

 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P  GI IRRVTGSSPFSGI+VGSET GG+ +VLAEHINLYN
Sbjct  132  DDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINLYN  191

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+GI 
Sbjct  192  VGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNGIT  251

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG KV Q G I+G K SPFT ICLSNI+L G + P +PP KCSDV G+A QV PWP
Sbjct  252  IKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKPWP  311

Query  164  CSELAXNHRYGACS  123
            CSEL+ + + GACS
Sbjct  312  CSELSSSQQTGACS  325



>gb|KDO76501.1| hypothetical protein CISIN_1g0134022mg, partial [Citrus sinensis]
Length=335

 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P  GI IRRVTGSSPFSGI+VGSET GG+ +VLAEHINLYN
Sbjct  139  DDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINLYN  198

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+GI 
Sbjct  199  VGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNGIT  258

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG KV Q G I+G K SPFT ICLSNI+L G + P +PP KCSDV G+A QV PWP
Sbjct  259  IKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKPWP  318

Query  164  CSELAXNHRYGACS  123
            CSEL+ + + GACS
Sbjct  319  CSELSSSQQTGACS  332



>ref|XP_006439367.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
 gb|ESR52607.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
Length=443

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P  GI IRRVTGSSPFSGI+VGSET GG+ +VLAEHINLYN
Sbjct  247  DDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINLYN  306

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+GI 
Sbjct  307  VGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNGIT  366

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG KV Q G I+G K SPFT ICLSNI+L G + P +PP KCSDV G+A QV PWP
Sbjct  367  IKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGVAGPTSPPLKCSDVSGSAYQVKPWP  426

Query  164  CSELAXNHRYGACS  123
            CSEL+ + + GACS
Sbjct  427  CSELSSSQQTGACS  440



>ref|XP_006476397.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=443

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P  GI IRRVTGSSPFSGI+VGSET GG+ +VLAEHINLYN
Sbjct  247  DDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINLYN  306

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+GI 
Sbjct  307  VGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNGIT  366

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG KV Q G I+G K SPFT ICLSNI+L+G + P +PP KCSDV G+A QV PWP
Sbjct  367  IKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLHGVAGPTSPPLKCSDVSGSAYQVKPWP  426

Query  164  CSELAXNHRYGACS  123
            CSEL+ + + GACS
Sbjct  427  CSELSGSQQTGACS  440



>ref|XP_009767931.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=454

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 167/192 (87%), Gaps = 1/192 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+ DVLAEHINL++
Sbjct  251  DDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVADVLAEHINLFD  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVSNVYMEN RTGIKIAGDVGDHPD +FNPNALP+V GIK
Sbjct  311  MGVGIHIKTNIGRGGVIRNITVSNVYMENTRTGIKIAGDVGDHPDEKFNPNALPVVKGIK  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSPW  168
            I+DVWG+KV Q G IRG K SPF+ ICLSNI+L+G +  PRN PWKCSDV GAAIQVSPW
Sbjct  371  IKDVWGEKVLQAGLIRGLKNSPFSGICLSNINLHGNNPGPRNSPWKCSDVSGAAIQVSPW  430

Query  167  PCSELAXNHRYG  132
            PCSEL  + + G
Sbjct  431  PCSELTSSQQTG  442



>emb|CDP12145.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRVTGSSPF+GI++GSET GGI DVLAEHINLYN
Sbjct  251  DDLVAVKSGWDEYGIAYGRPSHGITIRRVTGSSPFAGIAIGSETSGGIEDVLAEHINLYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTN+GRGG IRNITVSNVYM+NAR GIKIAGDVGDHPD  +NPNALP+V  + 
Sbjct  311  MGVGIHLKTNVGRGGVIRNITVSNVYMQNARKGIKIAGDVGDHPDTNYNPNALPVVKDVT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG+ V Q G I+G K SPFT ICLSNI+L G   PRNPPWKCSDV GAA++VSPWP
Sbjct  371  IKDVWGEGVLQSGQIQGLKNSPFTGICLSNINLQGNVGPRNPPWKCSDVSGAAVRVSPWP  430

Query  164  CSELAXNHRYGACSATL  114
            CSEL   ++ G+CS + 
Sbjct  431  CSELTSTYQAGSCSNSF  447



>ref|XP_011101030.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=447

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 167/197 (85%), Gaps = 0/197 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD ++VKSGWDEYGIAYGRP  GI IRRVTGSSPF+GI+VGSET GG+ DVLAEHINL+N
Sbjct  251  DDLIAVKSGWDEYGIAYGRPSHGITIRRVTGSSPFAGIAVGSETSGGVEDVLAEHINLFN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTN+GRGG IRNITVSNVYME+AR GIKI+GDVGDHPD  +N NALP++  + 
Sbjct  311  MGVGIHLKTNVGRGGVIRNITVSNVYMEDARKGIKISGDVGDHPDEYYNRNALPVLKDVV  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+++WG++V QPG I G K +PFT ICLSNIHL GA  PRN PW+CSDV GAA+QVSPWP
Sbjct  371  IKNIWGERVQQPGLIHGLKNAPFTGICLSNIHLRGARGPRNLPWQCSDVRGAAVQVSPWP  430

Query  164  CSELAXNHRYGACSATL  114
            CS+L  + + GACS++ 
Sbjct  431  CSQLTSHQQTGACSSSF  447



>ref|XP_010266478.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=448

 Score =   301 bits (772),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRVTGSSPFSGI++GSET GG+ DVLAE+INLYN
Sbjct  252  DDLVAVKSGWDEYGIAYGRPSSGITIRRVTGSSPFSGIAIGSETSGGVEDVLAENINLYN  311

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIH+KTNIGRGG IRNITVS+VYMENA+ GI+IAGDVGDHPD++FNPNALP+V+G+ 
Sbjct  312  MGIGIHLKTNIGRGGFIRNITVSDVYMENAQKGIRIAGDVGDHPDDKFNPNALPVVNGVM  371

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV Q G I+G K SPFT ICLSNI+L GA +P + PWKCSDV GAA+QVSPWP
Sbjct  372  IKNVWGVKVQQSGSIQGLKNSPFTQICLSNINLRGAVAPGSTPWKCSDVSGAAVQVSPWP  431

Query  164  CSELAXNHRYGACSA  120
            CSEL    R  +CS+
Sbjct  432  CSELIGTGRTASCSS  446



>ref|XP_006343870.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=447

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+VDVLAEHI+L+N
Sbjct  251  DDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISLFN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVSNVYMENARTGIKIAGDVGDHP+  FNPNALP+V GIK
Sbjct  311  MGVGIHIKTNIGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPNENFNPNALPVVKGIK  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG+KV Q G I G K SPF+ ICLSNI+L+G    +N  WKCSDV GAAIQVSP+P
Sbjct  371  IKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLHGNPGSQNSIWKCSDVSGAAIQVSPFP  430

Query  164  CSELAXNHRYGACSA  120
            C+EL  + + GACS 
Sbjct  431  CAELTSSQQTGACST  445



>ref|XP_010325363.1| PREDICTED: probable polygalacturonase isoform X1 [Solanum lycopersicum]
Length=476

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+VDVLAEHI+L+N
Sbjct  260  DDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISLFN  319

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN+GRGG IRNITVSNVYMENARTGIKIAGDVGDHPD  FNPNALP+V GIK
Sbjct  320  MGVGIHIKTNVGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPDENFNPNALPVVKGIK  379

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG+KV Q G I G K SPF+ ICLSNI+L G   PRN  WKCSDV GAAIQVSP+P
Sbjct  380  IKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLRGNPGPRNSIWKCSDVSGAAIQVSPFP  439

Query  164  CSELAXNHRYG  132
            C+EL  + + G
Sbjct  440  CAELTSSQKTG  450



>ref|XP_004245522.1| PREDICTED: probable polygalacturonase isoform X2 [Solanum lycopersicum]
Length=466

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+VDVLAEHI+L+N
Sbjct  260  DDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISLFN  319

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN+GRGG IRNITVSNVYMENARTGIKIAGDVGDHPD  FNPNALP+V GIK
Sbjct  320  MGVGIHIKTNVGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPDENFNPNALPVVKGIK  379

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG+KV Q G I G K SPF+ ICLSNI+L G   PRN  WKCSDV GAAIQVSP+P
Sbjct  380  IKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLRGNPGPRNSIWKCSDVSGAAIQVSPFP  439

Query  164  CSELAXNHRYGA  129
            C+EL  + + G 
Sbjct  440  CAELTSSQKTGC  451



>ref|XP_002304552.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE79531.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=447

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPFSGI+VGSET GG+ +VL E++NLYN
Sbjct  251  DDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFSGIAVGSETSGGVKNVLVENVNLYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG I+NITV++VYMEN R GIKIAGDVGDHPD+ FNPNALP+V GI 
Sbjct  311  MGVGIHIKTNIGRGGFIKNITVTDVYMENVRKGIKIAGDVGDHPDDSFNPNALPVVYGIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++ +WG+KV QPG I+G K SPFT ICLSNI+L+G   PR+ PWKCSDV G+A+ VSPWP
Sbjct  371  LKSIWGEKVQQPGSIQGLKNSPFTGICLSNINLHGVPGPRSSPWKCSDVSGSALLVSPWP  430

Query  164  CSELAXNHRYGACS  123
            CSEL   H+ G+CS
Sbjct  431  CSELTSPHQTGSCS  444



>ref|XP_010659126.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 emb|CBI34471.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   293 bits (750),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+ +V AEHINLYN
Sbjct  251  DDLVAVKSGWDEYGIAYGRPSSGITIRRITGSSPFAGIAVGSETSGGVQNVFAEHINLYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVSNVYME ARTGIKIAGDVGDHPD+ FNPNALP+V G+ 
Sbjct  311  MGVGIHLKTNIGRGGVIRNITVSNVYMEKARTGIKIAGDVGDHPDDNFNPNALPVVKGVV  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  V QPG I G K SPFT ICLS I+L+G   P   PWKCSDV GAA+ VSPWP
Sbjct  371  IRDVWGLDVLQPGSIIGLKNSPFTGICLSKINLHGKIKPGTAPWKCSDVSGAAVGVSPWP  430

Query  164  CSELAXNHRYGACSATL  114
            CSEL    + G+CS+ +
Sbjct  431  CSELTSPGQTGSCSSFI  447



>gb|KDP25309.1| hypothetical protein JCGZ_20465 [Jatropha curcas]
Length=448

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+ +V AE+INLY+
Sbjct  251  DDLVAVKSGWDEYGIAYGRPSSGITIRRITGSSPFAGIAVGSETSGGVENVFAENINLYD  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVS+VYMEN R GIKIAGDVGDHPD+ +NPNALP+V GI 
Sbjct  311  MGVGIHVKTNIGRGGFIRNITVSDVYMENVRKGIKIAGDVGDHPDDDYNPNALPVVKGIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRN-PPWKCSDVHGAAIQVSPW  168
            ++ VWG+KV QPG I+G K SPFT ICLSNI+L+G   PR+ PPWKCS V GAA++VSPW
Sbjct  371  LKGVWGEKVLQPGSIQGVKNSPFTGICLSNINLHGVPGPRSTPPWKCSYVSGAALEVSPW  430

Query  167  PCSELAXNHRYGACS  123
            PCSELA   + G+CS
Sbjct  431  PCSELATTSQVGSCS  445



>ref|XP_011073737.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
 ref|XP_011073743.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=449

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTGSSPF+GI+VGSET GG+ DVLAEHINL+N
Sbjct  253  DDLVAVKSGWDEYGIAYGRPSQDITIRRVTGSSPFAGIAVGSETSGGVEDVLAEHINLFN  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G GIH+KTNIGRGG IRNIT+SNVYM+ AR GIKI+GDVGDHPD  +NP ALP++  +K
Sbjct  313  MGFGIHLKTNIGRGGVIRNITISNVYMDKARKGIKISGDVGDHPDENYNPKALPVLKDVK  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG +V QPG IRG K +PF+ ICLSNI L GA+  R+ PW+CSDV G A+QVSP P
Sbjct  373  IKDVWGDRVQQPGLIRGLKDAPFSGICLSNISLGGATGQRDLPWQCSDVSGGAVQVSPLP  432

Query  164  CSELAXNHRYGACSATL  114
            CSEL  + + GAC+++ 
Sbjct  433  CSELTSSQQIGACASSF  449



>gb|AIU50439.1| pectin lyase-like superfamily protein, partial [Solanum lycopersicum]
Length=406

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 161/189 (85%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+VDVLAEHI+L+N
Sbjct  223  DDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISLFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN+GRGG IRNITVSNVYMENARTGIKIAGDVGDHPD  FNPNALP+V GIK
Sbjct  283  MGVGIHIKTNVGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPDENFNPNALPVVKGIK  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG+KV Q G I G K SPF+ ICLSNI+L G     N  WKCSDV GAAIQVSP+P
Sbjct  343  IKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLRG-----NSIWKCSDVSGAAIQVSPFP  397

Query  164  CSELAXNHR  138
            C+EL  + +
Sbjct  398  CAELTSSQK  406



>gb|AIU50408.1| pectin lyase-like superfamily protein, partial [Citrus clementina]
 gb|AIU50412.1| pectin lyase-like superfamily protein, partial [Citrus sinensis]
Length=406

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 160/189 (85%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P  GI IRRVTGSSPFSGI+VGSET GG+ +VLAEHINLYN
Sbjct  223  DDLVAVKSGWDEYGIAYGHPSSGITIRRVTGSSPFSGIAVGSETSGGVENVLAEHINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+GI 
Sbjct  283  VGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG KV Q G I+G K SPFT ICLSNI+L G+     PP KCSDV G+A QV PWP
Sbjct  343  IKDVWGTKVQQSGLIQGLKNSPFTGICLSNINLQGS-----PPLKCSDVSGSAYQVKPWP  397

Query  164  CSELAXNHR  138
            CSEL+ + +
Sbjct  398  CSELSSSQQ  406



>ref|XP_010261531.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
 ref|XP_010261532.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=447

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 159/195 (82%), Gaps = 0/195 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTGSSPF+GI++GSET GG+ +VLAE+INLY 
Sbjct  251  DDMVAVKSGWDEYGIAYGRPSSNITIRRVTGSSPFAGIAIGSETSGGVENVLAENINLYK  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD+ FNPNALP+V GI 
Sbjct  311  MGVGIHIKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDNFNPNALPVVKGIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG +V Q G I+G K SPFT ICLSNI+L G   P   PWKCSDV GAA +VSPWP
Sbjct  371  IKNVWGVQVQQSGSIQGLKNSPFTEICLSNINLRGVLVPGTTPWKCSDVSGAAFEVSPWP  430

Query  164  CSELAXNHRYGACSA  120
            CSEL      G+CS 
Sbjct  431  CSELISKSGTGSCSV  445



>gb|AIU50429.1| pectin lyase-like superfamily protein, partial [Solanum tuberosum]
Length=406

 Score =   288 bits (737),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 162/189 (86%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+VDVLAEHI+L+N
Sbjct  223  DDLVAVKSGWDQYGIAYGRPSHGITIRRITGSSPFAGIAVGSETSGGVVDVLAEHISLFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVSNVYMENARTGIKIAGDVGDHP+  FNPNALP+V GIK
Sbjct  283  MGVGIHIKTNIGRGGMIRNITVSNVYMENARTGIKIAGDVGDHPNENFNPNALPVVKGIK  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG+KV Q G I G K SPF+ ICLSNI+L+G     N  WKCSDV GAAIQVSP+P
Sbjct  343  IKDVWGEKVLQAGLIHGLKNSPFSGICLSNINLHG-----NSIWKCSDVSGAAIQVSPFP  397

Query  164  CSELAXNHR  138
            C+EL  + +
Sbjct  398  CAELTSSQQ  406



>ref|XP_011022514.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=447

 Score =   289 bits (740),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 163/194 (84%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI+VGSET GG+ +VL E+I+LYN
Sbjct  251  DDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAVGSETSGGVKNVLVENISLYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG I+NI+V++VYMEN R GIKIAGDVGDHPD  FNPNALP+V GI 
Sbjct  311  MGVGIHIKTNIGRGGFIKNISVTDVYMENVRKGIKIAGDVGDHPDESFNPNALPVVYGIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++ +WG+KV  PG I+G K SPFT ICLSNI+L+G   PR+ PWKCSDV G+A+ VSPWP
Sbjct  371  LKSIWGEKVQHPGSIQGLKNSPFTGICLSNINLHGVPGPRSSPWKCSDVSGSALLVSPWP  430

Query  164  CSELAXNHRYGACS  123
            CSEL+  H+ G+CS
Sbjct  431  CSELSSPHQTGSCS  444



>ref|XP_002509949.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF51336.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=446

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI+VGSET GG+  VLAE+INLY+
Sbjct  250  DDLVAVKSGWDEYGIAYGRPSSHITIRRITGSSPFAGIAVGSETSGGVEHVLAENINLYD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG+H+KTNIGRGG IRNIT S+VYM+NAR GIKIAGDVGDHPD+ +NPNALP+V GI 
Sbjct  310  MGVGLHVKTNIGRGGFIRNITFSDVYMKNARKGIKIAGDVGDHPDDNYNPNALPVVKGII  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             + VWG+ V QPG I+G K SPFT ICLSNI+L+G   PR+ PWKCSDV GAA++VSP+P
Sbjct  370  FRGVWGENVLQPGAIQGLKSSPFTGICLSNINLHGVPGPRSTPWKCSDVSGAALEVSPFP  429

Query  164  CSELAXNHRYGACS  123
            CSELA  H+ G+CS
Sbjct  430  CSELATTHQTGSCS  443



>gb|AIU50426.1| pectin lyase-like superfamily protein, partial [Manihot esculenta]
Length=406

 Score =   286 bits (731),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 162/189 (86%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRVTGSSPF+GI+VGSET GG+ +VLAE+INLY+
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSGITIRRVTGSSPFAGIAVGSETSGGVENVLAENINLYD  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNIT+S+VYMEN R GIKIAGDVGDHPD++FNP ALP+V GI 
Sbjct  283  MGVGIHVKTNIGRGGFIRNITISDVYMENVRKGIKIAGDVGDHPDDKFNPYALPVVKGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++ VWG+KV QPG I+G K SPFT ICLSNI+L+G++     PWKCSDV GAA++VSPWP
Sbjct  343  LKGVWGEKVQQPGSIQGLKDSPFTGICLSNINLHGST-----PWKCSDVSGAALEVSPWP  397

Query  164  CSELAXNHR  138
            CSEL   H+
Sbjct  398  CSELTTTHQ  406



>ref|XP_003545367.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=446

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GG+ +VLAEHINLYN
Sbjct  251  DDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAIGSETSGGVENVLAEHINLYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN GRGG I+NIT+S+VYME AR GI+I+GDVGDHPD++F+ NALP+V G+ 
Sbjct  311  MGIGIHIKTNTGRGGFIKNITMSHVYMEEARKGIRISGDVGDHPDDKFDANALPLVKGVT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV Q G I+G + SPFT ICL +I+L+G + PR PPWKCSDV G A QVSPWP
Sbjct  371  IKNVWGMKVLQAGLIQGLRNSPFTDICLYDINLHGVTGPRTPPWKCSDVSGFAHQVSPWP  430

Query  164  CSELAXNHRYGACS  123
            CSEL+ N + G+C+
Sbjct  431  CSELSSNQQ-GSCA  443



>gb|KHN12010.1| Putative polygalacturonase [Glycine soja]
Length=446

 Score =   284 bits (726),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GG+ +VLAEHINLYN
Sbjct  251  DDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAIGSETSGGVENVLAEHINLYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN GRGG I+NIT+S+VYME AR GI+I+GDVGDHPD++F+ NALP+V G+ 
Sbjct  311  MGIGIHIKTNTGRGGFIKNITMSHVYMEEARKGIRISGDVGDHPDDKFDVNALPLVKGVT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV Q G I+G + SPFT ICL +I+L+G + PR PPWKCSDV G A QVSPWP
Sbjct  371  IKNVWGMKVLQAGLIQGLRNSPFTDICLYDINLHGVTGPRTPPWKCSDVSGFAHQVSPWP  430

Query  164  CSELAXNHRYGACS  123
            CSEL+ N + G+C+
Sbjct  431  CSELSSNQQ-GSCA  443



>gb|AIU50442.1| pectin lyase-like superfamily protein, partial [Vitis vinifera]
Length=406

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 155/185 (84%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+ +V AEHINLYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSGITIRRITGSSPFAGIAVGSETSGGVQNVFAEHINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG IRNITVSNVYME ARTGIKIAGDVGDHPD+ FNPNALP+V G+ 
Sbjct  283  MGVGIHLKTNIGRGGVIRNITVSNVYMEKARTGIKIAGDVGDHPDDNFNPNALPVVKGVV  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  V QPG I G K SPFT ICLS I+L+G +     PWKCSDV GAA+ VSPWP
Sbjct  343  IRDVWGLDVLQPGSIIGLKNSPFTGICLSKINLHGTA-----PWKCSDVSGAAVGVSPWP  397

Query  164  CSELA  150
            CSEL 
Sbjct  398  CSELT  402



>ref|XP_007141479.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
 gb|ESW13473.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
Length=442

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P   I IRRV+GSSPF+GI++GSET GG+ +VLAEHINLY 
Sbjct  247  DDLVAVKSGWDEYGIAYGLPSSNITIRRVSGSSPFAGIAIGSETSGGVENVLAEHINLYK  306

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN GRGG I+NITVS+VYME+AR GI+I+GDVGDHPD++F+PNALPIV G+ 
Sbjct  307  MGIGIHIKTNSGRGGFIKNITVSHVYMEDARKGIRISGDVGDHPDDKFDPNALPIVKGVT  366

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++VWG KV Q G I+G K SPF+ ICL +I+L G + PR PPWKCSDV G A QVSPWP
Sbjct  367  MKNVWGVKVLQAGLIQGVKNSPFSDICLYDINLGGVTGPRTPPWKCSDVSGFAHQVSPWP  426

Query  164  CSELAXNHRYGACS  123
            CSEL+ NH+ G+C+
Sbjct  427  CSELSSNHQ-GSCA  439



>ref|XP_004499965.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=449

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 163/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGI+YGRP  GI IRR+TGSSPF+GI++GSET GG+ ++LAEHINL+N
Sbjct  254  DDLVAVKSGWDEYGISYGRPSYGITIRRLTGSSPFAGIAIGSETSGGVENILAEHINLFN  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG I+NITVSNVY+ENAR GIKIAGDVGDHPD  F+PNALP+V GI 
Sbjct  314  MGVGIHIKTNIGRGGFIKNITVSNVYIENARQGIKIAGDVGDHPDENFDPNALPVVKGIT  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++VWG KV Q G I G + SPFT IC  +I+ +G + PR+PPWKCSDV G + QVSPWP
Sbjct  374  VKNVWGVKVLQAGLIHGLRDSPFTEICFYDINFHGVTGPRSPPWKCSDVFGFSHQVSPWP  433

Query  164  CSELAXNHRYGACS  123
            CS+L+ + + G+C+
Sbjct  434  CSQLS-SQQPGSCT  446



>gb|AIU50430.1| pectin lyase-like superfamily protein, partial [Populus trichocarpa]
Length=406

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPFSGI+VGSET GG+ +VL E++NLYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFSGIAVGSETSGGVKNVLVENVNLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG I+NITV++VYMEN R GIKIAGDVGDHPD+ FNPNALP+V GI 
Sbjct  283  MGVGIHIKTNIGRGGFIKNITVTDVYMENVRKGIKIAGDVGDHPDDSFNPNALPVVYGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++ +WG+KV QPG I+G K SPFT ICLSNI+L+G+S     PWKCSDV G+A+ VSPWP
Sbjct  343  LKSIWGEKVQQPGSIQGLKNSPFTGICLSNINLHGSS-----PWKCSDVSGSALLVSPWP  397

Query  164  CSELAXNHR  138
            CSEL   H+
Sbjct  398  CSELTSPHQ  406



>ref|XP_007209143.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
 gb|EMJ10342.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
Length=442

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRV GSSPF+GI++GSET GG+ +VLAEHINLYN
Sbjct  246  DDLVAVKSGWDEYGIAYGRPSSGITIRRVRGSSPFAGIAIGSETSGGVENVLAEHINLYN  305

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVS+VYME  R GIKIAGDVGDHPD+++N NALP+V GI 
Sbjct  306  MGVGIHIKTNIGRGGFIRNITVSDVYMEEVRRGIKIAGDVGDHPDDKYNQNALPVVKGIT  365

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++D+WG +V Q G I G K SPFT ICLSNI+L+G +  R+PPWKCSD+ GAA  VSP  
Sbjct  366  LKDIWGVQVQQAGVILGLKNSPFTGICLSNINLHGMTGSRSPPWKCSDISGAAHLVSPLQ  425

Query  164  CSELAXNHRYGACS  123
            CSEL+   +   CS
Sbjct  426  CSELSGAQQASTCS  439



>ref|XP_008239046.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=442

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 156/194 (80%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRV GSSPF+GI++GSET GG+ +VLAEHINLYN
Sbjct  246  DDLVAVKSGWDEYGIAYGRPSSGITIRRVRGSSPFAGIAIGSETSGGVENVLAEHINLYN  305

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRG  IRNITVS+VYME  R GIKIAGDVGDHPD+++N NALP+V GI 
Sbjct  306  MGVGIHIKTNIGRGAFIRNITVSDVYMEKVRRGIKIAGDVGDHPDDKYNQNALPVVKGIT  365

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++DVWG +  Q G I G K SPFT ICLSNI+L+G +  R+PPWKCSD+ GAA  VSP  
Sbjct  366  LKDVWGVQAQQAGVILGLKNSPFTGICLSNINLHGMTGSRSPPWKCSDISGAAHLVSPLQ  425

Query  164  CSELAXNHRYGACS  123
            CSEL+   R   CS
Sbjct  426  CSELSSAQRASTCS  439



>ref|XP_003551949.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=442

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 162/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRVTGSSPF+GI++GSET GG+ +VLAEHINL+N
Sbjct  249  DDLVAVKSGWDEYGIAYGRPSYGITIRRVTGSSPFAGIAIGSETSGGVENVLAEHINLFN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V GI 
Sbjct  309  MGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKGIT  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV+Q G I G + SPFT +CLS+I+ +G   PR+P WKCSDV G A QVSPWP
Sbjct  369  IKNVWGVKVNQAGLIHGLRNSPFTDVCLSDINFHGMEGPRSPSWKCSDVFGFAHQVSPWP  428

Query  164  CSELAXNHRYGACS  123
            CS+L+ +   G+C+
Sbjct  429  CSQLS-SQEPGSCA  441



>gb|KHM99685.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 162/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI++GSET GG+ +VLAEHINL+N
Sbjct  232  DDLVAVKSGWDEYGIAYGRPSYGITIRRLTGSSPFAGIAIGSETSGGVENVLAEHINLFN  291

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V GI 
Sbjct  292  MGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKGIT  351

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG +V+Q G I G + SPFT +CLSNI+ +G   PR+P WKCSDV G A QVSPWP
Sbjct  352  IKNVWGVRVNQAGLIHGLRNSPFTDVCLSNINFHGMRGPRSPSWKCSDVFGFAHQVSPWP  411

Query  164  CSELAXNHRYGACS  123
            CS+L+ +   G+C+
Sbjct  412  CSQLS-SQEPGSCA  424



>gb|KJB39696.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=280

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTGSSPF+GI+VGSET GG+  VLAE+I +YN
Sbjct  84   DDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVIYN  143

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G+ 
Sbjct  144  SGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKGVT  203

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG KV + G I+G K +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP P
Sbjct  204  LKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSPSP  263

Query  164  CSELAXNHRYGACS  123
            C++L+   + G+C+
Sbjct  264  CAQLSSPQQSGSCA  277



>gb|KHN28527.1| Putative polygalacturonase [Glycine soja]
Length=457

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 162/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRVTGSSPF+GI++GSET GG+ +VLAEHINL+N
Sbjct  264  DDLVAVKSGWDEYGIAYGRPSYGITIRRVTGSSPFAGIAIGSETSGGVENVLAEHINLFN  323

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V GI 
Sbjct  324  MGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKGIT  383

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV+Q G I G + SPFT +CLS+I+ +G   PR+P WKCSDV G A QVSPWP
Sbjct  384  IKNVWGVKVNQAGLIHGLRNSPFTDVCLSDINFHGMEGPRSPSWKCSDVFGFAHQVSPWP  443

Query  164  CSELAXNHRYGACS  123
            CS+L+ +   G+C+
Sbjct  444  CSQLS-SQEPGSCA  456



>ref|XP_006586032.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=443

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 162/194 (84%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI++GSET GG+ +VLAEHINL+N
Sbjct  250  DDLVAVKSGWDEYGIAYGRPSYGITIRRLTGSSPFAGIAIGSETSGGVENVLAEHINLFN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG I+NITV++VY+ENAR GIKIAGDVG HPD +FNPNALP+V GI 
Sbjct  310  MGVGIHIKTNSGRGGLIKNITVAHVYVENARQGIKIAGDVGGHPDEKFNPNALPVVKGIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG +V+Q G I G + SPFT +CLSNI+ +G   PR+P WKCSDV G A QVSPWP
Sbjct  370  IKNVWGVRVNQAGLIHGLRNSPFTDVCLSNINFHGMRGPRSPSWKCSDVFGFAHQVSPWP  429

Query  164  CSELAXNHRYGACS  123
            CS+L+ +   G+C+
Sbjct  430  CSQLS-SQEPGSCA  442



>gb|AIU50416.1| pectin lyase-like superfamily protein, partial [Buxus sinica]
Length=406

 Score =   278 bits (710),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 156/185 (84%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIA+GRP   I IRR+TGSSPF+GI++GSET GG+ ++LAE+INLYN
Sbjct  223  DDMVAVKSGWDEYGIAFGRPSSSITIRRITGSSPFAGIAIGSETSGGVENILAENINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            IGVGIH+KTNIGRGG IRNITVS+VYMENAR GIKIAGDVGDHPD++FNPNALP+V+GI 
Sbjct  283  IGVGIHVKTNIGRGGFIRNITVSDVYMENARKGIKIAGDVGDHPDDKFNPNALPVVNGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+ VWG KV QPG I+G K SPFT ICLSNI+L+G +     PWKCSDV G AI V PWP
Sbjct  343  IRRVWGVKVQQPGLIQGLKNSPFTGICLSNINLHGGT-----PWKCSDVSGTAIVVKPWP  397

Query  164  CSELA  150
            CS+  
Sbjct  398  CSQFT  402



>ref|XP_007040496.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY24997.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=448

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTG+SPFSGI+VGSET GG+ +VLAE+I LYN
Sbjct  252  DDLVAVKSGWDEYGIAYGRPSSCITIRRVTGTSPFSGIAVGSETSGGVENVLAENIVLYN  311

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G+++KTNIGRGG I+NITVS V+MEN RTGIKIAGD GDHPDN FNPNALP V G+ 
Sbjct  312  TGIGVNVKTNIGRGGFIKNITVSEVFMENVRTGIKIAGDTGDHPDNNFNPNALPYVKGVT  371

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +++WG KV + G I+G K +PFT ICLS ++L+G + P +PPWKCSDV GAAI+VSPWP
Sbjct  372  FKNIWGVKVQRAGSIQGLKNAPFTGICLSKVNLHGTTGPGSPPWKCSDVSGAAIEVSPWP  431

Query  164  CSELAXNHRYGACSA  120
            C+EL    + G+C++
Sbjct  432  CAELTSPQQSGSCAS  446



>gb|AIU50410.1| pectin lyase-like superfamily protein, partial [Carica papaya]
Length=405

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 160/188 (85%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI++GSET GG+++VLAEHINL++
Sbjct  222  DDLVAVKSGWDEYGIAYGRPSFGITIRRITGSSPFAGIAIGSETSGGVLNVLAEHINLFD  281

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGI++KTNIGRGG I NIT+S+VYMEN RTG+KIAGD GDHPD++FNPNALP+V GI 
Sbjct  282  MGVGINVKTNIGRGGVIENITISDVYMENVRTGLKIAGDTGDHPDDKFNPNALPVVKGIT  341

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G I G K SPFT ICL+N++L+G     +P WKCSDV GAA++VSPWP
Sbjct  342  IKNVWGVKVQRAGSILGLKDSPFTGICLANVNLHG-----DPTWKCSDVSGAALKVSPWP  396

Query  164  CSELAXNH  141
            CSELA  +
Sbjct  397  CSELASTY  404



>gb|KHG27846.1| putative polygalacturonase [Gossypium arboreum]
Length=404

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGI YGRP   I IRRVTGSSPF+GI+VGSET GG+  VLAE+I +YN
Sbjct  208  DDLVAVKSGWDEYGIGYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVIYN  267

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G++IKTNIGRGG I+NITVS V+MEN RTGIKIAGD GDHPDNRFNPNALP V G+ 
Sbjct  268  SGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKIAGDTGDHPDNRFNPNALPYVKGVT  327

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG KV + G I+G K +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP P
Sbjct  328  LKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSPSP  387

Query  164  CSELAXNHRYGACS  123
            C++L+   + G+C+
Sbjct  388  CAQLSSPQQSGSCA  401



>gb|KJB39695.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=343

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTGSSPF+GI+VGSET GG+  VLAE+I +YN
Sbjct  147  DDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVIYN  206

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G+ 
Sbjct  207  SGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKGVT  266

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG KV + G I+G K +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP P
Sbjct  267  LKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSPSP  326

Query  164  CSELAXNHRYGACS  123
            C++L+   + G+C+
Sbjct  327  CAQLSSPQQSGSCA  340



>gb|KEH33635.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=451

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 160/195 (82%), Gaps = 2/195 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD YGI+YGRP   I IRR+TGSSPF+GI+VGSET GG+ +VLAEHINL+N
Sbjct  255  DDLVAVKSGWDAYGISYGRPSNDITIRRITGSSPFAGIAVGSETSGGVQNVLAEHINLFN  314

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG I+NITVSNVY+EN+R GIKIAGDVGDHPD  FNPNALP+V GI 
Sbjct  315  MGVGIHIKTNIGRGGLIKNITVSNVYIENSRQGIKIAGDVGDHPDENFNPNALPVVKGIT  374

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSPW  168
            I+ VWG KV Q G I G + SPFT IC  +I+L+G + S R+PPWKCSDV G + QVSPW
Sbjct  375  IKSVWGVKVLQAGLIHGLRNSPFTEICFYDINLHGETGSGRSPPWKCSDVFGFSKQVSPW  434

Query  167  PCSELAXNHRYGACS  123
            PCS+L+ +   G+C+
Sbjct  435  PCSQLS-SQEPGSCT  448



>ref|XP_008437386.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=445

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGR    I IRR++GSSPF+G++VGSET GG+ +VLAEH+N Y+
Sbjct  249  DDLVAVKSGWDEYGIAYGRSSYDITIRRISGSSPFAGVAVGSETSGGVANVLAEHLNFYD  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGI+IKTNIGRGG I+NITVSNVYMEN+R G+KIAGD GDHPD++F+PNALPIV  I 
Sbjct  309  MGVGINIKTNIGRGGFIKNITVSNVYMENSRKGLKIAGDTGDHPDDKFDPNALPIVKDIT  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++ WG KV Q G I G + SPFT ICLSNI+  G + PR+ PW CS V GAA+ VSPWP
Sbjct  369  IKNAWGVKVQQAGSIYGLRDSPFTGICLSNINFRGTTRPRSVPWTCSYVSGAALMVSPWP  428

Query  164  CSELAXNHRYGACS  123
            CSEL    + G CS
Sbjct  429  CSELTSTEQDGLCS  442



>gb|AIU50435.1| pectin lyase-like superfamily protein, partial [Ricinus communis]
Length=406

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI+VGSET GG+  VLAE+INLY+
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSHITIRRITGSSPFAGIAVGSETSGGVEHVLAENINLYD  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG+H+KTNIGRGG IRNIT S+VYM+NAR GIKIAGDVGDHPD+ +NPNALP+V GI 
Sbjct  283  MGVGLHVKTNIGRGGFIRNITFSDVYMKNARKGIKIAGDVGDHPDDNYNPNALPVVKGII  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             + VWG+ V QPG I+G K SPFT ICLSNI+L+G++     PWKCSDV GAA++VSP+P
Sbjct  343  FRGVWGENVLQPGAIQGLKSSPFTGICLSNINLHGST-----PWKCSDVSGAALEVSPFP  397

Query  164  CSELAXNHR  138
            CSELA  H+
Sbjct  398  CSELATTHQ  406



>gb|AIU50446.1| pectin lyase-like superfamily protein, partial [Platanus x acerifolia]
Length=406

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 156/188 (83%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGR   GI IRR+TGSSPF+GI++GSET GG+ + LAE+INLYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRRSSGITIRRITGSSPFAGIAIGSETSGGVENFLAENINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIH+KTN+GRGG I+NIT+S+V+MEN R GI+IAGDVGDHPD+ FNPNALP+V G+ 
Sbjct  283  TGIGIHLKTNVGRGGVIKNITISDVFMENVRKGIRIAGDVGDHPDDYFNPNALPVVKGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV QPG I+G K SPFT ICLSNI+L+G +     PWKCSDV GAAI V+PWP
Sbjct  343  IKNVWGVKVQQPGSIQGIKNSPFTRICLSNINLHGTT-----PWKCSDVSGAAIGVNPWP  397

Query  164  CSELAXNH  141
            CSEL   H
Sbjct  398  CSELISTH  405



>gb|KJB39697.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=446

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTGSSPF+GI+VGSET GG+  VLAE+I +YN
Sbjct  250  DDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVIYN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G+ 
Sbjct  310  SGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKGVT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG KV + G I+G K +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+VSP P
Sbjct  370  LKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIEVSPSP  429

Query  164  CSELAXNHRYGACS  123
            C++L+   + G+C+
Sbjct  430  CAQLSSPQQSGSCA  443



>ref|XP_004298894.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
 ref|XP_011463978.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGIAYGRP   I IRR+ GSSPF+GI+VGSET GG+ +V  EHINL+N
Sbjct  247  DDLVAVKSGWDQYGIAYGRPSSDITIRRIRGSSPFAGIAVGSETSGGVENVFVEHINLHN  306

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVSNVYME AR GIKIAGDVGDHPDN +NPNALP+V GI 
Sbjct  307  VGVGIHIKTNIGRGGFIRNITVSNVYMEKARKGIKIAGDVGDHPDNNYNPNALPVVKGIT  366

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGA-SSPRNPPWKCSDVHGAAIQVSPW  168
            + D+WG +V Q G I+G K SPFT ICLSNI+L+G   + R PPWKCSD+ GAA  VSP 
Sbjct  367  LTDIWGIQVLQAGLIQGLKNSPFTGICLSNINLHGMPGTSRTPPWKCSDISGAAHLVSPI  426

Query  167  PCSELAXNHRYGACS  123
             CSEL       +CS
Sbjct  427  QCSELTSAQHASSCS  441



>ref|XP_003617307.1| Glycoside hydrolase family 28 protein [Medicago truncatula]
 gb|AET00266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=450

 Score =   273 bits (699),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 161/196 (82%), Gaps = 3/196 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGR    I IRRV+GSSPF+GI+VGSET GG+ ++LAEHINLYN
Sbjct  253  DDLVAVKSGWDEYGIAYGRSSSNITIRRVSGSSPFAGIAVGSETSGGVENILAEHINLYN  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTNIGRGG I+NI VSNVY+ENAR GIKI+GDVGDH D++++ NALPIV GI 
Sbjct  313  MGIGIHIKTNIGRGGYIKNINVSNVYIENARKGIKISGDVGDHADDKYDSNALPIVKGIT  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGA--SSPRNPPWKCSDVHGAAIQVSP  171
            + +VWG KV Q G I+G K SPFT ICLS+I+L+G   +  R P W+CSDV G A+QVSP
Sbjct  373  MANVWGVKVLQAGLIKGMKHSPFTDICLSDINLHGVNGTRSRTPSWQCSDVSGVALQVSP  432

Query  170  WPCSELAXNHRYGACS  123
            WPCSEL  +H+ G+C+
Sbjct  433  WPCSELI-SHQLGSCA  447



>gb|AIU50414.1| pectin lyase-like superfamily protein, partial [Glycine max]
Length=406

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 156/189 (83%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GG+ +VLAEHINLYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSDITIRRITGSSPFAGIAIGSETSGGVENVLAEHINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN GRGG I+NIT+S+VYME AR GI+I+GDVGDHPD++F+ NALP+V G+ 
Sbjct  283  MGIGIHIKTNTGRGGFIKNITMSHVYMEEARKGIRISGDVGDHPDDKFDANALPLVKGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV Q G I+G + SPFT ICL +I+L+G      PPWKCSDV G A QVSPWP
Sbjct  343  IKNVWGMKVLQAGLIQGLRNSPFTDICLYDINLHGT-----PPWKCSDVSGFAHQVSPWP  397

Query  164  CSELAXNHR  138
            CSEL+ N +
Sbjct  398  CSELSSNQQ  406



>gb|EPS61079.1| hypothetical protein M569_13719, partial [Genlisea aurea]
Length=416

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (82%), Gaps = 1/192 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGI+Y RP  GI IRRVTGSSPF+GI+VGSET GG+ DVLAEH+ L+N
Sbjct  225  DDLVAIKSGWDEYGISYNRPSRGITIRRVTGSSPFAGIAVGSETSGGVEDVLAEHVTLFN  284

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTN+GRGG +RNITVSNVYMENAR GIKIAGDVGDHPD  ++P ALP ++ I 
Sbjct  285  VGVGIHLKTNVGRGGIVRNITVSNVYMENARLGIKIAGDVGDHPDGGYDPKALPELTDIV  344

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSPW  168
            I++VWG++V QPG I G K +PFT ICLSNIHL GA  +  + PW CSDV G+A+QVSPW
Sbjct  345  IRNVWGERVLQPGLIHGLKGAPFTGICLSNIHLIGAQGASDSKPWLCSDVSGSAVQVSPW  404

Query  167  PCSELAXNHRYG  132
            PC++L  +   G
Sbjct  405  PCAQLTVSQHTG  416



>ref|XP_004143871.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
 ref|XP_004161459.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
 gb|KGN50025.1| hypothetical protein Csa_5G150430 [Cucumis sativus]
Length=445

 Score =   271 bits (693),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGR    I IRR++GSSPF+G++VGSE  GG+ +VLAEH+N Y+
Sbjct  249  DDLVAVKSGWDEYGIAYGRCSYDITIRRISGSSPFAGVAVGSEASGGVANVLAEHLNFYD  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGI+IKTNIGRGG I+NITVSNVYMEN+R G+KIAGD GDHPD++F+PNALPIV  I 
Sbjct  309  MGVGINIKTNIGRGGFIKNITVSNVYMENSRKGLKIAGDAGDHPDDKFDPNALPIVKDIT  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+++WG  V Q G I G + SPFT ICLSNI+L GA+ PR+ PW CS V GAA  VSPWP
Sbjct  369  IKNIWGVNVQQAGSIYGLRDSPFTGICLSNINLRGATRPRSVPWTCSYVSGAASLVSPWP  428

Query  164  CSELAXNHRYGACS  123
            CSEL    + G CS
Sbjct  429  CSELTSTDQDGLCS  442



>gb|AIU50433.1| pectin lyase-like superfamily protein, partial [Phaseolus vulgaris]
Length=406

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 156/189 (83%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG P   I IRRV+GSSPF+GI++GSET GG+ +VLAEHINLY 
Sbjct  223  DDLVAVKSGWDEYGIAYGLPSSNITIRRVSGSSPFAGIAIGSETSGGVENVLAEHINLYK  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN GRGG I+NITVS+VYME+AR GI+I+GDVGDHPD++F+PNALPIV G+ 
Sbjct  283  MGIGIHIKTNSGRGGFIKNITVSHVYMEDARKGIRISGDVGDHPDDKFDPNALPIVKGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++VWG KV Q G I+G K SPF+ ICL +I+L G      PPWKCSDV G A QVSPWP
Sbjct  343  MKNVWGVKVLQAGLIQGVKNSPFSDICLYDINLGGT-----PPWKCSDVSGFAHQVSPWP  397

Query  164  CSELAXNHR  138
            CSEL+ NH+
Sbjct  398  CSELSSNHQ  406



>gb|AIU50443.1| pectin lyase-like superfamily protein, partial [Lactuca sativa]
Length=406

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 153/189 (81%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI+VGSET GG+ +VLAEHI LYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSNDITIRRLTGSSPFAGIAVGSETSGGVTNVLAEHITLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIH+KTNIGRGG IRNITVSNV+M+  R GIKIAGDVGDHPD  +NPNALP++  I+
Sbjct  283  TGIGIHLKTNIGRGGIIRNITVSNVFMDKVRKGIKIAGDVGDHPDENYNPNALPVMKHIR  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG+ V QPG I+G K SPFT ICLSNI+L G     N PWKC+DV G A+QVSP P
Sbjct  343  IKNVWGENVQQPGLIQGLKNSPFTDICLSNINLFG-----NVPWKCADVSGGAVQVSPSP  397

Query  164  CSELAXNHR  138
            CSEL  + +
Sbjct  398  CSELISSRQ  406



>gb|AIU50407.1| pectin lyase-like superfamily protein, partial [Sarcandra glabra]
Length=406

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +VLAEHIN++N
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSYITIRRLTGSSPFAGIAIGSETSGGIENVLAEHINIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             GVGIH+KTN+GRGG IRNIT ++VYMEN R GIKIAGDVGDHPD++FNPNALP V G+ 
Sbjct  283  SGVGIHLKTNVGRGGVIRNITFTDVYMENVRKGIKIAGDVGDHPDDKFNPNALPTVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + QPG ++G K SPFT ICLSN++L G +     PWKCSDV G+A+ V PWP
Sbjct  343  IRNVWGVNIQQPGSMQGLKNSPFTRICLSNVNLRGGT-----PWKCSDVSGSALGVHPWP  397

Query  164  CSELAXNH  141
            CSEL   H
Sbjct  398  CSELISTH  405



>gb|AIU50431.1| pectin lyase-like superfamily protein, partial [Prunus persica]
Length=406

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 153/185 (83%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRRV GSSPF+GI++GSET GG+ +VLAEHINLYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSGITIRRVRGSSPFAGIAIGSETSGGVENVLAEHINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTNIGRGG IRNITVS+VYME  R GIKIAGDVGDHPD+++N NALP+V GI 
Sbjct  283  MGVGIHIKTNIGRGGFIRNITVSDVYMEEVRRGIKIAGDVGDHPDDKYNQNALPVVKGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++D+WG +V Q G I G K SPFT ICLSNI+L+G+     PPWKCSD+ GAA  VSP  
Sbjct  343  LKDIWGVQVQQAGVILGLKNSPFTGICLSNINLHGS-----PPWKCSDISGAAHLVSPLQ  397

Query  164  CSELA  150
            CSEL+
Sbjct  398  CSELS  402



>ref|XP_007146299.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
 gb|ESW18293.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
Length=456

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI+VGSET GG+ +VLAE+INL+N
Sbjct  263  DDLVAVKSGWDEYGIAYGRPSSGITIRRLTGSSPFAGIAVGSETSGGVENVLAENINLFN  322

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG I+NITV++VY+ENAR GIKIAGDVG HPD ++NP+ALP+V GI 
Sbjct  323  MGVGIHIKTNKGRGGFIKNITVAHVYVENARQGIKIAGDVGGHPDEKYNPDALPVVKGIT  382

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV++ G I G K SPFT +CLS I+ +G +  R P WKCSDV G A QVSPWP
Sbjct  383  IRNVWGVKVNRAGLINGLKNSPFTDVCLSVINFHGMAGSRAPNWKCSDVSGFAYQVSPWP  442

Query  164  CSELAXNHRYGACS  123
            CS+L  +   G+C+
Sbjct  443  CSQL-HSQEPGSCA  455



>ref|XP_004491304.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=452

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 155/196 (79%), Gaps = 1/196 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYG+P   I IRRV GSSPF+GI+VGSE  GG+ +VLAEHINL N
Sbjct  253  DDLVAVKSGWDEYGIAYGQPSSNITIRRVNGSSPFAGIAVGSEASGGVENVLAEHINLQN  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTNIGRGG I+NI VSNVYMEN R GIKIAGDVGDHPD++++ NA+PIV GI 
Sbjct  313  MGIGIHIKTNIGRGGYIKNINVSNVYMENTRKGIKIAGDVGDHPDDKYDKNAVPIVKGIV  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV Q G I G + SPF+ ICLSNI+L+G    R P WKCS V G A QVSP P
Sbjct  373  IENVWGVKVLQAGLITGIRNSPFSDICLSNINLHGVVGTRAPTWKCSSVIGVAYQVSPLP  432

Query  164  CSELAXNHRYGACSAT  117
            CSEL  +H+ G+C  T
Sbjct  433  CSELV-SHQSGSCGIT  447



>gb|AIU50418.1| pectin lyase-like superfamily protein, partial [Chloranthus japonicus]
Length=406

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +VLAEH+N++N
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSHITIRRLTGSSPFAGIAIGSETSGGIENVLAEHVNIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIH+KTN GRGG I+NITV++VYMEN R GI+IAGDVGDHPD++FNPNALPIV G+ 
Sbjct  283  CGIGIHVKTNAGRGGVIQNITVTDVYMENVRKGIRIAGDVGDHPDDKFNPNALPIVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V QPG ++G K SPFT ICLSN++L G +     PWKCSDV G+A+ V PWP
Sbjct  343  IGNVWGVNVQQPGSMQGIKNSPFTRICLSNVNLRGGT-----PWKCSDVSGSALGVHPWP  397

Query  164  CSELAXNH  141
            C+EL   H
Sbjct  398  CAELISTH  405



>gb|AIU50424.1| pectin lyase-like superfamily protein, partial [Medicago truncatula]
Length=406

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 152/184 (83%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGR    I IRRV+GSSPF+GI+VGSET GG+ ++LAEHINLYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRSSSNITIRRVSGSSPFAGIAVGSETSGGVENILAEHINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTNIGRGG I+NI VSNVY+ENAR GIKI+GDVGDH D++++ NALPIV GI 
Sbjct  283  MGIGIHIKTNIGRGGYIKNINVSNVYIENARKGIKISGDVGDHADDKYDSNALPIVKGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            + +VWG KV Q G I+G K SPFT ICLS+I+L+G      P W+CSDV G A+QVSPWP
Sbjct  343  MANVWGVKVLQAGLIKGMKHSPFTDICLSDINLHGT-----PSWQCSDVSGVALQVSPWP  397

Query  164  CSEL  153
            CSEL
Sbjct  398  CSEL  401



>ref|XP_010053124.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010053125.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77376.1| hypothetical protein EUGRSUZ_D01730 [Eucalyptus grandis]
Length=449

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD VSVKSGWDEYGI YGR   GI IRR+TGSSPF+GISVGSET GG+ +V  E+INLYN
Sbjct  251  DDLVSVKSGWDEYGIRYGRRSSGITIRRITGSSPFAGISVGSETSGGVENVWIENINLYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTNIGRGG IR+ITVSNV+MEN R GI+I G+VGDHPD  +NP+ALP V GI+
Sbjct  311  VGIGIHIKTNIGRGGFIRDITVSNVFMENVRKGIRIMGNVGDHPDEYYNPSALPYVKGIR  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG KV + G I+G K +PFT ICLSNI+L+G    R   W CSDV GAA++VSP  
Sbjct  371  IKDVWGVKVQEAGLIQGLKNAPFTGICLSNIYLHGVPGQRRATWTCSDVSGAALEVSPGV  430

Query  164  CSELAXNHRYGACS  123
            CSELA  +    CS
Sbjct  431  CSELASTYHSSICS  444



>gb|AIU50397.1| pectin lyase-like superfamily protein, partial [Aquilegia coerulea]
Length=406

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGI YGR   GI IRRVTGSSPF+GI++GSET GG+ +VLAEHINL+N
Sbjct  223  DDLVAVKSGWDEYGIKYGRKSYGITIRRVTGSSPFAGIAIGSETSGGVENVLAEHINLFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIH+KTNIGRGG I+NIT+S+VYMENAR GIKIAGDVGDHPD  ++PNALP+V G+ 
Sbjct  283  MGLGIHVKTNIGRGGYIKNITISDVYMENARKGIKIAGDVGDHPDENYDPNALPVVHGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG+KV QPG I+G K SPFT IC SNIHL+G      P WKCSDV G A  VSP P
Sbjct  343  MRNIWGEKVLQPGSIQGLKNSPFTGICFSNIHLHGT-----PLWKCSDVSGTASAVSPSP  397

Query  164  CSELA  150
            C++L 
Sbjct  398  CAQLT  402



>ref|XP_010676306.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=441

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 160/193 (83%), Gaps = 3/193 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYG+A+GRP   I IRR+TGSSPFSGI++GSE  GG+ +VLAEHINL+N
Sbjct  248  DDMVAIKSGWDEYGLAFGRPSSDITIRRITGSSPFSGIAIGSEMSGGVENVLAEHINLFN  307

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KT +GRGG IRNITV+N+Y++NA+ G+KI+GDVGDH D++F+P A+P+V  I+
Sbjct  308  MGVGIHLKTKVGRGGYIRNITVANIYIKNAKKGVKISGDVGDHADDKFDPKAIPVVQDIR  367

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++ +WG+ + QPG ++G K +PFT+ICLS+I+L G+   R  PW+CSDV G++++VSPWP
Sbjct  368  MKSIWGENIQQPGLVKGIKNAPFTNICLSDINLYGSFKLRTRPWECSDVEGSSLEVSPWP  427

Query  164  CSELAXNHRYGAC  126
            CSEL  +   G+C
Sbjct  428  CSELLSS---GSC  437



>gb|AIU50405.1| pectin lyase-like superfamily protein, partial [Theobroma cacao]
Length=406

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 152/185 (82%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTG+SPFSGI+VGSET GG+ +VLAE+I LYN
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSCITIRRVTGTSPFSGIAVGSETSGGVENVLAENIVLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G+++KTNIGRGG I+NITVS V+MEN RTGIKIAGD GDHPDN FNPNALP V G+ 
Sbjct  283  TGIGVNVKTNIGRGGFIKNITVSEVFMENVRTGIKIAGDTGDHPDNNFNPNALPYVKGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +++WG KV + G I+G K +PFT ICLS ++L+G+     PPWKCSDV GAAI+VSPWP
Sbjct  343  FKNIWGVKVQRAGSIQGLKNAPFTGICLSKVNLHGS-----PPWKCSDVSGAAIEVSPWP  397

Query  164  CSELA  150
            C+EL 
Sbjct  398  CAELT  402



>gb|KHG21610.1| putative polygalacturonase [Gossypium arboreum]
Length=448

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 155/195 (79%), Gaps = 0/195 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I +RRVTGS+PF+G++VGSET GG+ +VLAE+INLYN
Sbjct  252  DDLVAVKSGWDEYGIAYGRPSSYITVRRVTGSTPFAGVAVGSETSGGVENVLAENINLYN  311

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             GVG+HIKTNIGRGG I+NITVS ++MEN RTGIK+AGD GDHPDN FNPNALP V  + 
Sbjct  312  SGVGVHIKTNIGRGGVIKNITVSELFMENVRTGIKVAGDTGDHPDNNFNPNALPYVKDLT  371

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG  V + G++ G + + FT ICLSN+ L G + PR P W C+ + GAAI+VSP P
Sbjct  372  LKNIWGVNVQRAGWMHGIENATFTGICLSNVTLQGTTGPRPPSWNCNAIRGAAIEVSPRP  431

Query  164  CSELAXNHRYGACSA  120
            C+ELA   + G+C++
Sbjct  432  CAELASVEQSGSCAS  446



>gb|EYU40022.1| hypothetical protein MIMGU_mgv1a006305mg [Erythranthe guttata]
Length=449

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGI+Y RP  GI IRR+TGSSPF+GI+VGSET GG+ DV+AEHINL N
Sbjct  253  DDLVAVKSGWDQYGISYNRPSQGITIRRLTGSSPFAGIAVGSETSGGVADVIAEHINLSN  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIH+KTNIGRGG IRNI++SNVYM  AR GIKI+GDVGDHPD  ++ NALP++  + 
Sbjct  313  MGIGIHLKTNIGRGGVIRNISISNVYMYKARKGIKISGDVGDHPDENYDRNALPVLKDVV  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G  V QPG I G KK+PF+ ICLSN+ L G    R+  W+CSDV G A++VSP P
Sbjct  373  IKDVSGDFVQQPGLIHGLKKAPFSGICLSNVSLGGVVGVRDSGWQCSDVSGGAVRVSPLP  432

Query  164  CSELAXNHRYGACSATL  114
            C+EL  + + G+C +TL
Sbjct  433  CAELTSSQQIGSCFSTL  449



>gb|KJB24230.1| hypothetical protein B456_004G134000 [Gossypium raimondii]
Length=448

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 154/195 (79%), Gaps = 0/195 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I +RRVTGS+PF+G++VGSET GG+ +VLAE+INLYN
Sbjct  252  DDLVAVKSGWDEYGIAYGRPSSYITVRRVTGSTPFAGVAVGSETSGGVENVLAENINLYN  311

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             GVG+HIKTNIGRGG I+NITVS ++MEN RTGIK+AGD GDHPDN FNPNALP V  + 
Sbjct  312  SGVGVHIKTNIGRGGVIKNITVSELFMENVRTGIKVAGDTGDHPDNNFNPNALPYVKDLM  371

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG  V + G++ G + + FT ICLSN+ L G + PR P W C+ + GAAI+VSP P
Sbjct  372  LKNIWGVNVQRAGWMHGIENATFTGICLSNVTLQGTTGPRPPSWNCNAIRGAAIEVSPRP  431

Query  164  CSELAXNHRYGACSA  120
            C+EL    + G+C++
Sbjct  432  CAELTSVEQSGSCAS  446



>ref|XP_010055855.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW72401.1| hypothetical protein EUGRSUZ_E00853 [Eucalyptus grandis]
Length=451

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 153/194 (79%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD VSVKSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSE  GGI +VL E++NLY 
Sbjct  255  DDVVSVKSGWDEYGIAYGRPSSNITIRRLTGSSPFAGIAIGSEMSGGIENVLVENVNLYK  314

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIH+KTN GRG  IRNITVS+VY+E+AR GIKI+GDVGDHPD+ ++PNALP+V+GI 
Sbjct  315  VGIGIHVKTNSGRGAFIRNITVSDVYVEDARKGIKISGDVGDHPDDGYDPNALPVVTGIL  374

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++D+ G  V Q G IRG K SPFT +CLSN++L+G   PR  PW CSDV GAA +VSP P
Sbjct  375  VKDMRGTNVQQAGLIRGIKNSPFTGLCLSNVNLHGKPGPREDPWSCSDVSGAAFKVSPSP  434

Query  164  CSELAXNHRYGACS  123
            CSEL       +C+
Sbjct  435  CSELTSVSDRDSCA  448



>gb|AIU50409.1| pectin lyase-like superfamily protein, partial [Gossypium raimondii]
Length=406

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 153/185 (83%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTGSSPF+GI+VGSET GG+  VLAE+I +YN
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVIYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G+ 
Sbjct  283  SGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG KV + G I+G K +PFT+ICLS I+L+G+     PPWKCSDV GAAI+VSP P
Sbjct  343  LKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGS-----PPWKCSDVSGAAIEVSPSP  397

Query  164  CSELA  150
            C++L+
Sbjct  398  CAQLS  402



>ref|XP_006413510.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
 gb|ESQ54963.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
Length=449

 Score =   258 bits (660),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L+N
Sbjct  254  DDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLFN  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENAR GIK+AGD GDHPD  +NPNALPIV GI 
Sbjct  314  MGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKLAGDTGDHPDAYYNPNALPIVKGIH  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+++WG  V   G IRG K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  374  IKNIWGVNVQNAGSIRGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSPWP  432

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  433  CSELRTTGGSYSCSSTF  449



>gb|AIU50434.1| pectin lyase-like superfamily protein, partial [Artemisia annua]
Length=277

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 150/184 (82%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD ++VKSGWD+YGIAYGRP   I IRR+TGSSPF+GI+VGSET GG+ +VLAEHI L +
Sbjct  94   DDLIAVKSGWDQYGIAYGRPSNDITIRRITGSSPFAGIAVGSETSGGVTNVLAEHITLSH  153

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIH+KTNIGRGG IRNIT+S+V+M+  R GIKIAGDVGDHPD+ ++PNALP++  ++
Sbjct  154  TGIGIHLKTNIGRGGIIRNITISDVFMDTVRKGIKIAGDVGDHPDDNYDPNALPVLKHVR  213

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG+KV + G I+G K SPFT ICLSN+HL G     + PW C+DV G ++QVSP P
Sbjct  214  IKNVWGEKVLEAGLIKGLKNSPFTDICLSNVHLTG-----HGPWTCADVSGGSVQVSPSP  268

Query  164  CSEL  153
            CSEL
Sbjct  269  CSEL  272



>ref|XP_009413832.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413833.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=445

 Score =   258 bits (659),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPFSG+++GSET GG+ +VL E++NLY+
Sbjct  250  DDLVAVKSGWDEYGIAYGRPSSGITIRRLTGSSPFSGVAIGSETSGGVENVLVENVNLYD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN+GRGG +RNITV NV M   R GI+IAGDVGDHPD  F+  A+P V GI 
Sbjct  310  TGIGIHIKTNVGRGGFVRNITVVNVSMNKVRKGIRIAGDVGDHPDEYFDRRAIPTVDGIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I+G K SPFT ICLSN+ L G +  R+ PWKC DV GAA+ V PWP
Sbjct  370  IKNVWGVDVQQPGSIQGIKNSPFTRICLSNVKLWGVAK-RSAPWKCVDVSGAALGVQPWP  428

Query  164  CSELAXNHRYGACSATL  114
            CS LA     G CS   
Sbjct  429  CSALARTISSGYCSTAF  445



>ref|XP_009380525.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=446

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 143/197 (73%), Gaps = 0/197 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRR+ GSSPFSGI++GSET GG+ +VL E+INLYN
Sbjct  250  DDLVAIKSGWDEYGIAYGRPSSGITIRRLQGSSPFSGIAIGSETSGGVENVLVENINLYN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TV NV M   R GI+IAGDVGDHPD  FN  A+P V G+ 
Sbjct  310  TGFGIHIKTNAGRGGYIRNVTVVNVSMNKVRKGIRIAGDVGDHPDEYFNRYAMPTVDGVT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + QPG I G + SPFT ICLSN+ L GA      PWKC DV GAA+ V PWP
Sbjct  370  IKNVWGVDIQQPGSIEGIRSSPFTRICLSNVKLWGALMHYEQPWKCMDVSGAALGVQPWP  429

Query  164  CSELAXNHRYGACSATL  114
            CS+L      G CS+  
Sbjct  430  CSQLTGTFSAGFCSSAF  446



>gb|AIU50402.1| pectin lyase-like superfamily protein, partial [Magnolia denudata]
Length=392

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 149/188 (79%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR++GS+PF+GI++GSET GG+ +VLAE+++L+N
Sbjct  209  DDLVAVKSGWDEYGIAYGRPSSGITIRRLSGSTPFAGIAIGSETSGGVENVLAENVSLFN  268

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             GVGIH+KTNIGRGG IRNITV +V M+N R GIKIAGDVGDHPDN FNPNALPIV G+ 
Sbjct  269  TGVGIHVKTNIGRGGFIRNITVQDVRMDNVRKGIKIAGDVGDHPDNNFNPNALPIVDGVM  328

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG  + QPG ++G K SPFT ICLSN++  G +      WKC+D+ GAA+ V P P
Sbjct  329  LRNLWGVNIQQPGVMQGLKNSPFTQICLSNVNFGGGAV-----WKCADISGAALGVEPSP  383

Query  164  CSELAXNH  141
            C EL   H
Sbjct  384  CPELTSTH  391



>gb|AIU50420.1| pectin lyase-like superfamily protein, partial [Chimonanthus 
praecox]
Length=406

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 152/188 (81%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGI+YGRP   I IRR+ GSSPF+G+++GSE  GG+ +V AE+I LY+
Sbjct  223  DDLVAVKSGWDEYGISYGRPSYDITIRRLRGSSPFAGVAIGSEASGGVHNVFAENITLYD  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             GVGIH+KTNIGRGG IRNITV++V+M+N R GIK+AGDVGDHPD++FNPNALP V GI 
Sbjct  283  TGVGIHVKTNIGRGGIIRNITVTDVHMDNVRKGIKVAGDVGDHPDDKFNPNALPTVDGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG KV Q G I+G K SPFT ICLS+I+L G+S     PWKCSD+ GAA++V+P P
Sbjct  343  VKNMWGVKVQQAGSIQGLKDSPFTRICLSSINLGGSS-----PWKCSDITGAALEVNPSP  397

Query  164  CSELAXNH  141
            C+EL   H
Sbjct  398  CAELTTTH  405



>gb|KJB39694.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=427

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP   I IRRVTGSSPF+GI+VGSET GG+  VLAE+I +YN
Sbjct  250  DDLVAVKSGWDEYGIAYGRPSSHITIRRVTGSSPFAGIAVGSETSGGVEHVLAENIVIYN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G++IKTNIGRGG I+NITVS V+MEN RTGIKI GD GDHPDN+FNPNALP V G+ 
Sbjct  310  SGIGVNIKTNIGRGGFIKNITVSQVFMENVRTGIKITGDTGDHPDNQFNPNALPYVKGVT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG KV + G I+G K +PFT+ICLS I+L+G + PR+PPWKCSDV GAAI+    P
Sbjct  370  LKNIWGVKVQKAGSIQGLKNAPFTNICLSKINLHGMTGPRSPPWKCSDVSGAAIER---P  426

Query  164  C  162
            C
Sbjct  427  C  427



>ref|XP_009404468.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404469.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   255 bits (652),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 151/194 (78%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI +RR+TGSSPFSGI++GSET GG+ +VL E+INLY+
Sbjct  250  DDLVAVKSGWDEYGIAYGRPSSGITVRRLTGSSPFSGIAIGSETSGGVENVLVENINLYD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN+GRGG IRNIT+S+V M N R  I+IAGDVGDHPD  F+PNA+P V G+ 
Sbjct  310  VGIGIHIKTNVGRGGYIRNITISDVNMNNVRKAIRIAGDVGDHPDENFDPNAVPTVDGVT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG++V QPG I G K SPFT +CLSN+ L G  +    PWKC+DV GAA+ V+P P
Sbjct  370  IKNVWGEEVEQPGSIEGIKNSPFTRVCLSNVKLWGVGA---SPWKCTDVTGAALGVNPGP  426

Query  164  CSELAXNHRYGACS  123
            C +L  +     CS
Sbjct  427  CPQLTSSFAMSYCS  440



>ref|XP_010925748.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
 ref|XP_010925749.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=441

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 146/194 (75%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRR+TGSSPFSGI++GSE  GG+ +VL E+I+L+N
Sbjct  247  DDLVAIKSGWDEYGIAYGRPSSGITIRRLTGSSPFSGIAIGSEASGGVENVLVENISLFN  306

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN+GRGG IRNIT S+V M   R G++IAGDVGDHPD +FNP A+P V  + 
Sbjct  307  TGIGIHIKTNVGRGGYIRNITFSDVNMNKVRKGVRIAGDVGDHPDEKFNPYAIPTVDDVT  366

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I G K SPFT ICL N+ L G   P+N PWKC+ V GAA+ V PWP
Sbjct  367  IKNVWGTNVQQPGSIEGIKTSPFTRICLFNVKLWGG--PQNTPWKCAAVSGAALGVQPWP  424

Query  164  CSELAXNHRYGACS  123
            C+EL      G CS
Sbjct  425  CTELTRTSESGFCS  438



>emb|CDY47619.1| BnaA01g13460D [Brassica napus]
Length=444

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I IRR+TGS+PF+GI++GSET GGI +++AEHI+L N
Sbjct  249  DDLVAIKSGWDEYGIAFGRPSSNITIRRITGSTPFAGIAIGSETSGGIKNIVAEHISLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENAR GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKIAGDTGDHPDTYYNPNALPVVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G I+G K SPFT ICLS I+++G S   N  WKCSDV G +++VSPWP
Sbjct  369  INNVWGVNVRNAGSIQGLKDSPFTGICLSEINIHG-SLNTNRTWKCSDVIGTSLKVSPWP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+TL
Sbjct  428  CSELRTTGGSYSCSSTL  444



>ref|XP_010541559.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=446

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 152/193 (79%), Gaps = 1/193 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIA+GRP   I IRR+TGSSPF+GI++GSET GGI ++LA+HI L N
Sbjct  251  DDLVAVKSGWDEYGIAFGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNILAQHITLSN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +S+VY+ENAR GIKIAGD GDHPD  +NPNALPIV GIK
Sbjct  311  MGVGVNIKTNIGRGGFIQNIRISDVYVENARYGIKIAGDTGDHPDGNYNPNALPIVKGIK  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G IRG K SPFT ICLS I+L+G  +   P WKCSDV G +++VSPWP
Sbjct  371  INNVWGVNVLNAGSIRGLKGSPFTGICLSEINLHGRWNSY-PTWKCSDVIGTSLKVSPWP  429

Query  164  CSELAXNHRYGAC  126
            CSEL    +  +C
Sbjct  430  CSELRSTGKASSC  442



>ref|XP_010541551.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=463

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 152/193 (79%), Gaps = 1/193 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIA+GRP   I IRR+TGSSPF+GI++GSET GGI ++LA+HI L N
Sbjct  268  DDLVAVKSGWDEYGIAFGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNILAQHITLSN  327

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +S+VY+ENAR GIKIAGD GDHPD  +NPNALPIV GIK
Sbjct  328  MGVGVNIKTNIGRGGFIQNIRISDVYVENARYGIKIAGDTGDHPDGNYNPNALPIVKGIK  387

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G IRG K SPFT ICLS I+L+G  +   P WKCSDV G +++VSPWP
Sbjct  388  INNVWGVNVLNAGSIRGLKGSPFTGICLSEINLHGRWNSY-PTWKCSDVIGTSLKVSPWP  446

Query  164  CSELAXNHRYGAC  126
            CSEL    +  +C
Sbjct  447  CSELRSTGKASSC  459



>ref|XP_008790157.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008790230.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=442

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 149/194 (77%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYG P  GI IRR+TGSSPFSGI++GSE  GG+ +VL E+I+L+N
Sbjct  248  DDLVAIKSGWDEYGIAYGHPSSGITIRRLTGSSPFSGIAIGSEASGGVENVLVENISLFN  307

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN+GRGG IRNIT ++V M N R G++IAGDVGDHPD++FNP A+P+V  + 
Sbjct  308  TGIGIHIKTNVGRGGYIRNITFADVNMNNVRKGVRIAGDVGDHPDDKFNPYAIPVVDKVT  367

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I G K SPFT ICL N+ L G   P+N PW+C+ V GAA+ V PWP
Sbjct  368  IKNVWGINVQQPGSIEGIKTSPFTRICLFNVKLWG--RPQNTPWECTAVSGAALGVQPWP  425

Query  164  CSELAXNHRYGACS  123
            C+EL  N   G CS
Sbjct  426  CAELTGNSESGFCS  439



>gb|AIU50441.1| pectin lyase-like superfamily protein, partial [Schrenkiella 
parvula]
Length=406

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 149/184 (81%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L+N
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENAR GIK+AGD GDHPD  +NPNALPIV GI 
Sbjct  283  MGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKLAGDTGDHPDAYYNPNALPIVKGIH  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+++WG  V   G IRG K SPFT ICLS I+L+G  +     WKCSDV G +++VSPWP
Sbjct  343  IKNIWGVNVQNAGSIRGLKGSPFTGICLSEINLHGYRT-----WKCSDVIGTSLKVSPWP  397

Query  164  CSEL  153
            CSEL
Sbjct  398  CSEL  401



>emb|CDY03516.1| BnaC01g15660D [Brassica napus]
Length=444

 Score =   253 bits (645),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 155/197 (79%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I IRR+TGS+PF+GI++GSET GGI +++AEHI+L N
Sbjct  249  DDLVAIKSGWDEYGIAFGRPSSNITIRRITGSTPFAGIAIGSETSGGIKNIVAEHISLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENAR GIKIAGD GDHPD  +NPNALP+V GI+
Sbjct  309  MGVGVNIKTNIGRGGYIKNIKISNVYVENARYGIKIAGDTGDHPDAYYNPNALPVVKGIR  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G I+G K SPFT ICLS I+++G+ +     WKCSDV G +++VSPWP
Sbjct  369  INNVWGVNVRNAGSIQGLKDSPFTGICLSEINIHGSLNTYR-TWKCSDVIGTSLKVSPWP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  428  CSELRTTGGSYSCSSTF  444



>ref|XP_009137402.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=444

 Score =   253 bits (645),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I IRR+TGS+PF+GI++GSET GGI +++AEHI+L N
Sbjct  249  DDLVAIKSGWDEYGIAFGRPSSNITIRRITGSTPFAGIAIGSETSGGIKNIVAEHISLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENAR GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIRISNVYVENARYGIKIAGDTGDHPDAYYNPNALPVVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G I+G K SPFT ICLS I+++G S   N  WKCSDV G +++VSPWP
Sbjct  369  INNVWGVNVRNAGSIQGLKDSPFTGICLSEINIHG-SLNTNRTWKCSDVIGTSLKVSPWP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  428  CSELRTTGGSYSCSSTF  444



>gb|AIU50413.1| pectin lyase-like superfamily protein, partial [Eucalyptus grandis]
Length=406

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 148/185 (80%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD VSVKSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSE  GGI +VL E++NLY 
Sbjct  223  DDVVSVKSGWDEYGIAYGRPSSNITIRRLTGSSPFAGIAIGSEMSGGIENVLVENVNLYK  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIH+KTN GRG  IRNITVS+VY+E+AR GIKI+GDVGDHPD+ ++PNALP+V+GI 
Sbjct  283  VGIGIHVKTNSGRGAFIRNITVSDVYVEDARKGIKISGDVGDHPDDGYDPNALPVVTGIL  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++D+ G  V Q G IRG K SPFT +CLSN++L+G       PW CSDV GAA +VSP P
Sbjct  343  VKDMRGTNVQQAGLIRGIKNSPFTGLCLSNVNLHGED-----PWSCSDVSGAAFKVSPSP  397

Query  164  CSELA  150
            CSEL 
Sbjct  398  CSELT  402



>gb|AIU50448.1| pectin lyase-like superfamily protein, partial [Houttuynia cordata]
Length=406

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 146/188 (78%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIA+GRP  GI IRR+TGS+PF+GI++GSE  GG+ +V AEHIN+ N
Sbjct  223  DDLVAVKSGWDEYGIAFGRPSFGITIRRITGSTPFAGIAIGSEASGGVENVYAEHINILN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG I+NITVS+VYM+  R GIKI+G+VGDHPDN +NPNALPIV GI 
Sbjct  283  SGIGIHIKTNTGRGGTIKNITVSDVYMDKVRKGIKISGNVGDHPDNGYNPNALPIVDGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  V Q G ++G K SPFT ICLSN+ L G        W+C D+ GAA+QV P P
Sbjct  343  IKDVWGMNVEQAGSMQGIKNSPFTRICLSNVKLFGGMM-----WQCGDISGAALQVKPSP  397

Query  164  CSELAXNH  141
            CSEL  +H
Sbjct  398  CSELISSH  405



>ref|XP_010913844.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=349

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYG+AY RP  GI IRR+TGSSPF+GI+VGSET GG+ +VL E I++YN
Sbjct  154  DDLVAVKSGWDEYGMAYARPSSGITIRRLTGSSPFAGIAVGSETSGGVENVLVESIHIYN  213

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG IRNITVS V + N R  ++IAGDVGDHPD+ +NPNALPIV+G+ 
Sbjct  214  TGIGIHIKTNSGRGGYIRNITVSGVNLSNVRKALRIAGDVGDHPDDMYNPNALPIVNGLT  273

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  + QPG I G K SPFT +CLSN+ LNG  + R  PWKC+DV G A+ V P P
Sbjct  274  IKDVWGVDIQQPGSIDGIKNSPFTGVCLSNVKLNGDGT-REVPWKCADVSGGALGVQPSP  332

Query  164  CSELAXNHRYGACS  123
            C+EL        C+
Sbjct  333  CTELTSISGLSFCT  346



>gb|ACC91250.1| glycoside hydrolase family 28 protein [Arabidopsis halleri]
Length=444

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  249  DDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKI GD GDHPD  +NPNALPIV GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIKISDVYIDTAKYGIKITGDTGDHPDENYNPNALPIVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  369  IKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGSLNSYK-TWKCSDVIGTSLKVSPWP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL     Y  CS+T 
Sbjct  428  CSELRTTGGYNLCSSTF  444



>emb|CDY10970.1| BnaA03g46290D [Brassica napus]
Length=451

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I IRR+TGSSP++GI++GSET GGI +++AEHI+L N
Sbjct  256  DDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISLSN  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NPNALPIV GI 
Sbjct  316  MGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAFYNPNALPIVKGIH  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  376  INNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSY-LTWKCSDVIGTSLKVSPWP  434

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  435  CSELRTTSGSYSCSSTF  451



>emb|CDX94222.1| BnaC07g38560D [Brassica napus]
Length=451

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I IRR+TGSSP++GI++GSET GGI +++AEHI+L N
Sbjct  256  DDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISLSN  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NPNALPIV GI 
Sbjct  316  MGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAFYNPNALPIVKGIH  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  376  INNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSPWP  434

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  435  CSELRTTGGSYSCSSTF  451



>ref|XP_009137393.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=451

 Score =   250 bits (639),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I IRR+TGSSP++GI++GSET GGI +++AEHI+L N
Sbjct  256  DDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISLSN  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+G++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NPNALPIV GI 
Sbjct  316  MGLGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAFYNPNALPIVKGIH  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  376  INNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSPWP  434

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  435  CSELRTTSGSYSCSSTF  451



>gb|AIU50423.1| pectin lyase-like superfamily protein, partial [Aristolochia 
tagala]
Length=406

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 148/184 (80%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TG++PF+GI+VGSET GG+++V+AEH+NL+N
Sbjct  223  DDLVAVKSGWDEYGIAYGRPSDGITIRRLTGTTPFAGIAVGSETSGGVMNVVAEHVNLFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             GVGIH+KTNIGRGG I+NIT S++YM+  R GIKIAGDVGDHPDN +NPNALP V G+ 
Sbjct  283  SGVGIHLKTNIGRGGVIKNITCSDIYMDRVRKGIKIAGDVGDHPDNGYNPNALPRVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++WG  V Q G ++G K SPFT ICLSN++L+GA S     WKC D+ GAA  V P P
Sbjct  343  LKNIWGVNVLQAGSLQGLKGSPFTRICLSNVNLSGAVS-----WKCGDISGAAQLVHPSP  397

Query  164  CSEL  153
            C EL
Sbjct  398  CQEL  401



>ref|XP_002867688.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43947.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  249  DDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALPIV GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIKISDVYIDTAKYGIKIAGDTGDHPDENYNPNALPIVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  369  IKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGSLNSYK-TWKCSDVIGTSLKVSPWP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  428  CSELRTTGGSYSCSSTF  444



>ref|XP_010913831.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913836.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913839.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=450

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 147/194 (76%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYG+AY RP  GI IRR+TGSSPF+GI+VGSET GG+ +VL E I++YN
Sbjct  255  DDLVAVKSGWDEYGMAYARPSSGITIRRLTGSSPFAGIAVGSETSGGVENVLVESIHIYN  314

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG IRNITVS V + N R  ++IAGDVGDHPD+ +NPNALPIV+G+ 
Sbjct  315  TGIGIHIKTNSGRGGYIRNITVSGVNLSNVRKALRIAGDVGDHPDDMYNPNALPIVNGLT  374

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  + QPG I G K SPFT +CLSN+ LNG  + R  PWKC+DV G A+ V P P
Sbjct  375  IKDVWGVDIQQPGSIDGIKNSPFTGVCLSNVKLNGDGT-REVPWKCADVSGGALGVQPSP  433

Query  164  CSELAXNHRYGACS  123
            C+EL        C+
Sbjct  434  CTELTSISGLSFCT  447



>gb|AIU50427.1| pectin lyase-like superfamily protein, partial [Erythranthe guttata]
Length=406

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 148/189 (78%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGI+Y RP  GI IRR+TGSSPF+GI+VGSET GG+ DV+AEHINL N
Sbjct  223  DDLVAVKSGWDQYGISYNRPSQGITIRRLTGSSPFAGIAVGSETSGGVADVIAEHINLSN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIH+KTNIGRGG IRNI++SNVYM  AR GIKI+GDVGDHPD  ++ NALP++  + 
Sbjct  283  MGIGIHLKTNIGRGGVIRNISISNVYMYKARKGIKISGDVGDHPDENYDRNALPVLKDVV  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G  V QPG I G KK+PF+ ICLSN+ L G S      W+CSDV G A++VSP P
Sbjct  343  IKDVSGDFVQQPGLIHGLKKAPFSGICLSNVSLGGDSG-----WQCSDVSGGAVRVSPLP  397

Query  164  CSELAXNHR  138
            C+EL  + +
Sbjct  398  CAELTSSQQ  406



>gb|AIU50404.1| pectin lyase-like superfamily protein, partial [Pinellia ternata]
Length=406

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 147/185 (79%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYG+A+ RP  GI IRR+TGSSPF+GI+VGSET GGI +VL E+INL N
Sbjct  223  DDLVAVKSGWDEYGMAFRRPSYGITIRRITGSSPFAGIAVGSETSGGIENVLVENINLSN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN+GRGG I+NIT+S+V M   R G++IAG+VGDHPD+ +NPNA+P V GI 
Sbjct  283  MGIGIHIKTNVGRGGYIKNITISDVNMNTTRKGLRIAGNVGDHPDDNYNPNAVPFVDGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I+G K SPFT +CLSN+ L G       PWKC+DV GAA++V PWP
Sbjct  343  IKNVWGVNVLQPGTIQGIKGSPFTRVCLSNVKLWGEV-----PWKCTDVSGAALEVQPWP  397

Query  164  CSELA  150
            CSEL 
Sbjct  398  CSELT  402



>ref|NP_194113.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
 emb|CAA23048.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAB81300.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAL32775.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAM91193.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE84810.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
Length=444

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  249  DDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIIAEHITLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIKISDVYVDTAKYGIKIAGDTGDHPDENYNPNALPVVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  369  IKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGSLNSYK-TWKCSDVSGTSLKVSPWP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL        CS+T 
Sbjct  428  CSELRTTGGSNLCSSTF  444



>gb|KFK28938.1| hypothetical protein AALP_AA7G068200 [Arabis alpina]
Length=445

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+ RP   I IRR+TGSSPF+GI++GSET GGI ++ AEHI+L N
Sbjct  250  DDLVAIKSGWDEYGIAFNRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIFAEHISLSN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKI G+ GDHPD  +NPNALPIV GI 
Sbjct  310  MGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKINGETGDHPDANYNPNALPIVKGIH  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  370  IKNVWGFNVQNAGSIQGLKGSPFTEICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSPWP  428

Query  164  CSELAXNHRYGACSATL  114
            CSEL       +CS+T 
Sbjct  429  CSELRTTGGSNSCSSTF  445



>gb|AIU50421.1| pectin lyase-like superfamily protein, partial [Pandanus utilis]
Length=406

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGI YGRP  GI IRR+ GSSPF+G++VGSE  GG+ +VL E++N++N
Sbjct  223  DDLVAVKSGWDEYGIVYGRPSSGITIRRLAGSSPFAGVAVGSENSGGVENVLVENLNIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG IRNIT+S+V M   + GI+I GDVGDHPD++FNPNALP+V G+ 
Sbjct  283  SGLGIHIKTNTGRGGYIRNITISDVNMNKVQKGIRIVGDVGDHPDDKFNPNALPVVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + QPG I+G K SPFT ICLSN+ L G       PWKC DV GAA++V PWP
Sbjct  343  IKNVWGVDIEQPGSIQGIKDSPFTRICLSNVKLWGEV-----PWKCDDVSGAALEVQPWP  397

Query  164  CSELA  150
            C+EL 
Sbjct  398  CTELT  402



>gb|AIU50437.1| pectin lyase-like superfamily protein, partial [Yucca filamentosa]
Length=406

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 147/185 (79%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGI+YGRP  GI IRRVTGSSPF+ I+VGSET GG+ +VL E++N++N
Sbjct  223  DDLVAVKSGWDEYGISYGRPSSGITIRRVTGSSPFAAIAVGSETSGGVENVLVENVNIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN+GRGG IRNIT++ V M N R G++IAGDVGDHPD++F+PNA+P+VSG+ 
Sbjct  283  SGFGIHIKTNVGRGGYIRNITITEVNMNNVRKGLRIAGDVGDHPDDKFSPNAIPVVSGLT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I+G K SPFT ICL N+ L+        PWKC+DV G+A+ V P P
Sbjct  343  IKNVWGMNVQQPGSIQGIKNSPFTGICLYNVKLSNEV-----PWKCTDVSGSALVVQPGP  397

Query  164  CSELA  150
            CSELA
Sbjct  398  CSELA  402



>ref|NP_199002.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 dbj|BAB10662.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAT85725.1| At5g41870 [Arabidopsis thaliana]
 gb|AED94738.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=449

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 151/194 (78%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I IRR+TGSSPF+GI++GSET GGI +V  E+I LYN
Sbjct  254  DDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITLYN  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTNIGRGG I+ IT+S VY+E  RTGIKI+GD GDHPD++FN +ALPIV GI 
Sbjct  314  SGIGIHIKTNIGRGGSIQGITISGVYLEKVRTGIKISGDTGDHPDDKFNTSALPIVRGIT  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G ++G K SPFT++C SN+ L G  + R+P WKCSDV GAA +V+P P
Sbjct  374  IKNVWGIKVERAGMVQGLKDSPFTNLCFSNVTLTG--TKRSPIWKCSDVVGAADKVNPTP  431

Query  164  CSEL-AXNHRYGAC  126
            C EL A   + G+C
Sbjct  432  CPELSATTQQGGSC  445



>ref|XP_010441363.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010441364.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 148/194 (76%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY R    I IRR+TGSS F+GI++GSET GGI ++  E+I LYN
Sbjct  253  DDLVAVKSGWDEYGIAYNRSSRDITIRRITGSSRFAGIAIGSETSGGIQNITVENITLYN  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG IR IT+S VYMEN RTGIKI+GD GDHPD++FN  ALP+VSGI 
Sbjct  313  SGIGIHIKTNTGRGGSIRGITISGVYMENVRTGIKISGDTGDHPDDKFNLTALPVVSGIT  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G I+G + SPFT++C SN+ L G  SP  P WKCSDV GAA +V+P P
Sbjct  373  IKNVWGIKVERAGMIQGLEDSPFTNLCFSNVTLTGTKSP--PTWKCSDVVGAAHKVNPTP  430

Query  164  CSEL-AXNHRYGAC  126
            C EL A   + G+C
Sbjct  431  CPELTATTQQGGSC  444



>gb|AAO62947.1| putative polygalacturonase-like protein [Lactuca sativa]
 gb|AAO62948.1| putative polygalacturonase-like protein, partial [Lactuca sativa]
Length=193

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 137/172 (80%), Gaps = 1/172 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWD+YGI Y RP   I IRR+TGSSPF+GI++GSET GG+ +VLAEHI L N
Sbjct  22   DDLVAVKSGWDQYGIKYARPSNDITIRRLTGSSPFAGIAIGSETSGGVYNVLAEHITLKN  81

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIH+KTNIGRGG IRNITVS+VYM N R GIKI+ DVGDHPD  +NPNALP++  ++
Sbjct  82   MGIGIHLKTNIGRGGIIRNITVSDVYMVNVRKGIKISADVGDHPDKNYNPNALPVLKHVR  141

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGA-SSPRNPPWKCSDVHG  192
            I++VWGKKV Q G I G K SPFT ICLSNI+L G   S RN PWKCS V G
Sbjct  142  IKNVWGKKVQQAGLIHGLKNSPFTDICLSNINLQGPIISTRNVPWKCSYVSG  193



>gb|AIU50403.1| pectin lyase-like superfamily protein, partial [Musa acuminata]
Length=396

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 138/185 (75%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRR+ GSSPFSGI++GSET GG+ +VL E+INLYN
Sbjct  213  DDLVAIKSGWDEYGIAYGRPSSGITIRRLQGSSPFSGIAIGSETSGGVENVLVENINLYN  272

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TV NV M   R GI+IAGDVGDHPD  FN  A+P V G+ 
Sbjct  273  TGFGIHIKTNAGRGGYIRNVTVVNVSMNKVRKGIRIAGDVGDHPDEYFNRYAMPTVDGVT  332

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + QPG I G + SPFT ICLSN+ L G       PWKC DV GAA+ V PWP
Sbjct  333  IKNVWGVDIQQPGSIEGIRSSPFTRICLSNVKLWGEQ-----PWKCMDVSGAALGVQPWP  387

Query  164  CSELA  150
            CS+L 
Sbjct  388  CSQLT  392



>ref|XP_006283738.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
 gb|EOA16636.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
Length=444

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  249  DDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIRISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVEGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V + G I+G K SPFT ICLS I+L+G+ +     WKC+DV G +++VSPWP
Sbjct  369  IKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGSLNMYR-TWKCADVIGTSMKVSPWP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL  +     CS+  
Sbjct  428  CSELRTSGGSNVCSSAF  444



>gb|AIN44009.1| polygalacturonase-like protein [Brassica juncea var. tumida]
Length=451

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 152/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I IRR+TGSSP++GI++GSET GGI +++AEHI+L N
Sbjct  256  DDLVAIKSGWDEYGIAFGRPSSNITIRRITGSSPYAGIAIGSETSGGIKNIVAEHISLSN  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY+ENA+ GIKIAGD GDHPD  +NP ALP+V GI 
Sbjct  316  MGVGVNIKTNIGRGGYIKNIKISNVYVENAKYGIKIAGDTGDHPDAYYNPKALPVVKGIH  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V   G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSPWP
Sbjct  376  INNVWGVNVQNAGSIQGLKGSPFTGICLSEINLHGSLNSYR-TWKCSDVIGTSLKVSPWP  434

Query  164  CSELAXNHRYGACSATL  114
            CSEL        CS++ 
Sbjct  435  CSELRATGGSYLCSSSF  451



>gb|AIU50415.1| pectin lyase-like superfamily protein, partial [Illicium henryi]
Length=406

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 145/185 (78%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD VS+KSGWDEYGIAYGRP   I IRR+T SSPF+GI++GSE  GG+ +VL E+IN++N
Sbjct  223  DDLVSIKSGWDEYGIAYGRPSSDITIRRITCSSPFAGIAIGSEMSGGVRNVLVENINIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIH+KTN+GRGG IRNIT+S VYMEN R GI+ AG+VGDHPD+++NPNALP+V GIK
Sbjct  283  AGIGIHLKTNLGRGGFIRNITISEVYMENVRKGIRFAGNVGDHPDDKYNPNALPVVDGIK  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            + +VWG  V QPG I+G K SPFT +C SNI+L+G+S      W+C D+ G+A+ V P  
Sbjct  343  VTNVWGVNVQQPGSIQGLKDSPFTRLCFSNINLHGSSL-----WQCRDISGSALGVHPLA  397

Query  164  CSELA  150
            C EL 
Sbjct  398  CPELT  402



>gb|AIU50399.1| pectin lyase-like superfamily protein, partial [Arabidopsis lyrata]
Length=406

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 147/184 (80%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALPIV GI 
Sbjct  283  MGVGVNIKTNIGRGGYIKNIKISDVYIDTAKYGIKIAGDTGDHPDENYNPNALPIVKGIH  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V   G I+G K SPFT ICLS I+L+G  +     WKCSDV G +++VSPWP
Sbjct  343  IKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGYKT-----WKCSDVIGTSLKVSPWP  397

Query  164  CSEL  153
            CSEL
Sbjct  398  CSEL  401



>ref|XP_010448059.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   245 bits (626),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 147/194 (76%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY R    I IRR+TGSS F+GI++GSET GGI ++  E+I LYN
Sbjct  253  DDLVAVKSGWDEYGIAYNRSSRDITIRRITGSSRFAGIAIGSETSGGIQNITVENITLYN  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG I+ IT+S VYMEN RTGIKI+GD GDHPD++FN  ALP+V GI 
Sbjct  313  SGIGIHIKTNTGRGGSIQGITISGVYMENVRTGIKISGDTGDHPDDKFNLTALPVVRGIT  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G I+G K SPFT++C SN+ L G  SP  P WKCSDV GAA +V+P P
Sbjct  373  IKNVWGIKVERAGMIQGLKDSPFTNLCFSNVTLTGTKSP--PTWKCSDVVGAAHKVNPTP  430

Query  164  CSEL-AXNHRYGAC  126
            C EL A   + G+C
Sbjct  431  CPELTATTQQGGSC  444



>gb|AIU50401.1| pectin lyase-like superfamily protein, partial [Lilium brownii]
Length=406

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I +RR+TGSSP++GI+VGSET GG+ ++  ++IN++N
Sbjct  223  DDLVAVKSGWDEYGIAYNRPSSDITVRRITGSSPYAGIAVGSETSGGVQNIFVQNINIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN+GRGG I+NIT+S+V M N R G+KI GD GDHPD++F+PNALP+V G+ 
Sbjct  283  SGIGIHIKTNVGRGGYIKNITISDVNMYNVRYGLKIEGDAGDHPDDKFDPNALPVVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  + QPG IRG K +PFT ICLSN+  +        PWKC+DV GAA++V P P
Sbjct  343  IRDVWGADIQQPGSIRGIKNAPFTRICLSNVRFSAEV-----PWKCTDVSGAALEVQPGP  397

Query  164  CSELA  150
            C+EL 
Sbjct  398  CAELT  402



>gb|AIU50400.1| pectin lyase-like superfamily protein, partial [Arabidopsis thaliana]
Length=406

 Score =   244 bits (622),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 147/184 (80%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  223  DDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIIAEHITLSN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +S+VY++ A+ GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  283  MGVGVNIKTNIGRGGYIKNIKISDVYVDTAKYGIKIAGDTGDHPDENYNPNALPVVKGIH  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V   G I+G K SPFT ICLS I+L+G  +     WKCSDV G +++VSPWP
Sbjct  343  IKNVWGVNVRNAGSIQGLKGSPFTGICLSEINLHGYKT-----WKCSDVSGTSLKVSPWP  397

Query  164  CSEL  153
            CSEL
Sbjct  398  CSEL  401



>ref|XP_002868572.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44831.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY  P   I IRR+TGSSPF+GI++GSET GGI +V  E+I LYN
Sbjct  254  DDLVAVKSGWDEYGIAYNLPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITLYN  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTNIGRGG I+ IT+S VY+E  RTGIKI+GD GDHPD++FN +ALPIV GI 
Sbjct  314  SGIGIHIKTNIGRGGSIQGITISGVYLEKVRTGIKISGDTGDHPDDKFNTSALPIVRGIT  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G ++G K SPFT++C SN+ L G  S   P WKCSDV GAA +V+P P
Sbjct  374  IKNVWGIKVERAGMVQGLKDSPFTNLCFSNVTLTGTKS--TPIWKCSDVVGAASKVNPTP  431

Query  164  CSELAXNHRYG  132
            C EL    + G
Sbjct  432  CPELTTTTQQG  442



>gb|AIU50411.1| pectin lyase-like superfamily protein, partial [Capsella rubella]
Length=406

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 148/184 (80%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  223  DDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  283  MGVGVNIKTNIGRGGYIKNIRISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVEGIH  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V + G I+G K SPFT ICLS I+L+G  +     WKC+DV G +++VSPWP
Sbjct  343  IKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGYRT-----WKCADVIGTSMKVSPWP  397

Query  164  CSEL  153
            CSEL
Sbjct  398  CSEL  401



>ref|XP_006405300.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 ref|XP_006405301.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46753.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46754.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
Length=447

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I IRR+TGSSPF+GI++GSET GGI +V  E+I LY+
Sbjct  258  DDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITLYS  317

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTNIGRGG +  IT+S V+ME  RTGIKI+G+ GDHPD+RFN +ALPIVSGI 
Sbjct  318  SGIGIHIKTNIGRGGSVHGITISGVHMEKVRTGIKISGNTGDHPDDRFNTSALPIVSGIT  377

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G ++G K SPFT++CLSN+ L G  S  +P WKCSDV GAA +V+P  
Sbjct  378  IKNVWGIKVERAGMVQGLKDSPFTNLCLSNVTLTGTKS--SPIWKCSDVVGAAEKVTPTA  435

Query  164  CSELAXNHRYG  132
            C ELA   + G
Sbjct  436  CPELASTTQQG  446



>ref|XP_006283728.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
 gb|EOA16626.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
Length=448

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 148/194 (76%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I IRR+TGSSPF+GI++GSET GGI ++  E+I LYN
Sbjct  253  DDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNITVENITLYN  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTNIGRGG I+ IT+S VY+E  RTGIKI+GD G+HPD+ FNP ALPIV GI 
Sbjct  313  SGIGIHIKTNIGRGGSIQGITISGVYLEKVRTGIKISGDTGNHPDDNFNPTALPIVRGIT  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G ++G K SPFT++C SN+ L G  S  +P WKCS V GAA +V+P P
Sbjct  373  IKNVWGIKVERAGMVQGLKDSPFTNLCFSNVTLTGTKS--SPIWKCSYVVGAANKVNPTP  430

Query  164  CSEL-AXNHRYGAC  126
            C EL A   + G+C
Sbjct  431  CPELTATTQQGGSC  444



>ref|XP_004961056.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=445

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 145/195 (74%), Gaps = 2/195 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGIA+GRP  GI IRR+TGS PF+G +VGSET GG+ +VL EH+NL++
Sbjct  253  DDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVLVEHLNLFS  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG IRNITVS V +  AR G++IAGDVG HPD  +NPN LP+V  + 
Sbjct  313  MGVGIHIKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDTSYNPNVLPVVHSVT  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG+ + Q G IRG + S F+ ICLSN+ L G++S    PWKC DV G A+ V P P
Sbjct  373  IKNVWGQNIRQAGLIRGIRNSVFSRICLSNVKLYGSASIG--PWKCRDVSGGALDVQPSP  430

Query  164  CSELAXNHRYGACSA  120
            C+ELA     G C+ 
Sbjct  431  CTELASTSETGFCTT  445



>gb|AIU50422.1| pectin lyase-like superfamily protein, partial [Asparagus officinalis]
Length=406

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRVTGSSPF+GI+VGSET GG+ +V  E+I ++N
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSSGITIRRVTGSSPFAGIAVGSETSGGVENVWIENITIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN+GRGG IRNIT+++V M   R G++IAGDVGDHPD++FNPNALP VSG+ 
Sbjct  283  SGFGIHIKTNVGRGGYIRNITITDVKMTEVRYGLRIAGDVGDHPDDKFNPNALPAVSGLM  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG++V QPG I+G K SPFT ICL N+ L         PWKC+DV G+A+ V P  
Sbjct  343  IKNVWGEEVQQPGLIKGIKNSPFTGICLYNVKL-----LNEVPWKCTDVSGSALVVQPGA  397

Query  164  CSELA  150
            CSEL 
Sbjct  398  CSELT  402



>ref|XP_009395761.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 147/185 (79%), Gaps = 1/185 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP  GI +RR+TGSSPF+G +VGSET GGI ++LAE++N++ 
Sbjct  254  DDLVAVKSGWDEYGIAYARPSSGIIVRRLTGSSPFAGFAVGSETSGGIENILAENLNIFK  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             GVGIHIKTN GRGG I+NIT+S+V + N R G++IAG+VGDHPD+R++PNALP+V G+ 
Sbjct  314  TGVGIHIKTNSGRGGFIKNITISDVNLSNVRKGLRIAGNVGDHPDDRYDPNALPVVDGLT  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG ++ QPG I+G K SPFT I LSN+ L+  +SPR   W C+DV G A+ V P P
Sbjct  374  IKNVWGVRIQQPGSIQGIKNSPFTQIHLSNVKLD-VASPRGVAWACADVSGGALDVQPSP  432

Query  164  CSELA  150
            C+EL 
Sbjct  433  CAELT  437



>ref|XP_010433858.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   243 bits (619),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  249  DDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIKISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V + G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSP P
Sbjct  369  IKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGSLNTYR-TWKCSDVIGTSLKVSPSP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL        CS+  
Sbjct  428  CSELRTTGGSSFCSSAF  444



>ref|XP_010448653.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  249  DDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIKISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V + G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSP P
Sbjct  369  IKNVWGVNVRKAGSIQGLKGSPFTGICLSEINLHGSLNTYR-TWKCSDVIGTSLKVSPSP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL        CS+  
Sbjct  428  CSELRTTGGSNFCSSAF  444



>ref|XP_008810829.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810830.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810831.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=450

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 142/194 (73%), Gaps = 1/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYG+AY  P  GI +RR+TGSSPFSGI++GSET GG+ +VL E I+++N
Sbjct  255  DDLVAVKSGWDEYGMAYAHPSSGITVRRLTGSSPFSGIAIGSETSGGVENVLVESIHIHN  314

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG IRNITVS V + N R  ++IAGDVG HPD+ +NPNALPIV  + 
Sbjct  315  TGIGIHIKTNSGRGGFIRNITVSGVNLNNVRKAVRIAGDVGGHPDSMYNPNALPIVDALT  374

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  + QPG + G K SPFT ICLSN+ LNG  + R  PWKC DV G A +V P P
Sbjct  375  IKDVWGVDIQQPGSMEGIKNSPFTRICLSNVKLNGDGA-REVPWKCEDVSGGATEVQPSP  433

Query  164  CSELAXNHRYGACS  123
            C+EL        C+
Sbjct  434  CTELTGTSGMSFCA  447



>gb|EAY85246.1| hypothetical protein OsI_06620 [Oryza sativa Indica Group]
Length=443

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRV GSSPFSGI++GSE  GG+ DVL E  +++N
Sbjct  251  DDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVSDVLVEDCSIFN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTNIGRGG IRNITV NV M + R G++IAGDVGDHPD  F+  ALP V G+ 
Sbjct  311  SGYGIHIKTNIGRGGFIRNITVDNVRMNSVRNGLRIAGDVGDHPDEHFSQLALPTVDGVS  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I G + SPFT ICL+N+ L G  +  N  WKC DVHGAA+ V P P
Sbjct  371  IKNVWGVNVQQPGSIEGIRNSPFTRICLANVKLFGWRN--NAAWKCRDVHGAALGVQPGP  428

Query  164  CSELAXNHRYGACS  123
            C+EL  +   G CS
Sbjct  429  CAELTTSLSSGFCS  442



>ref|XP_010439131.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP   I IRR+TGSSPF+GI++GSET GGI +++AEHI L N
Sbjct  249  DDLVAIKSGWDQYGIAYGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNIVAEHITLSN  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG++IKTNIGRGG I+NI +SNVY++ A+ GIKIAGD GDHPD  +NPNALP+V GI 
Sbjct  309  MGVGVNIKTNIGRGGYIKNIKISNVYVDTAKYGIKIAGDTGDHPDANYNPNALPVVKGIH  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + + G I+G K SPFT ICLS I+L+G+ +     WKCSDV G +++VSP P
Sbjct  369  IKNVWGVNIRKAGSIQGLKGSPFTGICLSEINLHGSLNTYR-TWKCSDVIGTSLKVSPSP  427

Query  164  CSELAXNHRYGACSATL  114
            CSEL        CS+  
Sbjct  428  CSELRTTGGSDFCSSAF  444



>gb|AIU50425.1| pectin lyase-like superfamily protein, partial [Canna indica]
Length=406

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRR+TGSSPFSGI++GSET GG+ +VL E++NLYN
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSSGITIRRLTGSSPFSGIAIGSETSGGVENVLVENVNLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G+HIKTN+GRGG IRN+ V++V M   R GI+IAGDVGDHPD  F+ +A+P V G+ 
Sbjct  283  TGIGLHIKTNVGRGGYIRNVRVTDVTMNKVRKGIRIAGDVGDHPDEYFSRDAIPKVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I G K SPFT ICLSN+ L G +     PWKC+ V GAA+ V P P
Sbjct  343  IKNVWGVGVQQPGSIEGIKNSPFTRICLSNVKLWGRA-----PWKCAAVSGAALGVRPSP  397

Query  164  CSELA  150
            CSELA
Sbjct  398  CSELA  402



>gb|KFK32989.1| hypothetical protein AALP_AA6G314900 [Arabis alpina]
Length=443

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 148/195 (76%), Gaps = 3/195 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I IRR+TGSSPF+GI++GSET GG+ ++  E+I LYN
Sbjct  248  DDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGVQNITVENITLYN  307

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTNIGRGG I+ I +S V+ME  RTGIKI+GD GDHPD++FNP+ALP+V GI 
Sbjct  308  SGIGIHIKTNIGRGGSIQGIKISGVHMEKVRTGIKISGDTGDHPDDKFNPSALPVVRGIT  367

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+++WG KV + G ++G K SPFT++C SN+ L G     +P WKCSDV G+ ++V+P P
Sbjct  368  IKNIWGIKVERAGTVQGLKDSPFTNLCFSNVTLTGTKG--SPIWKCSDVVGSTVKVNPTP  425

Query  164  CSEL-AXNHRYGACS  123
            C EL A   + G C 
Sbjct  426  CPELTATAQQGGTCE  440



>gb|AIU50450.1| pectin lyase-like superfamily protein, partial [Alisma plantago-aquatica]
Length=406

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 143/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI +RR+TGSSPF+GI++GSE  GG+ +VL EHIN+YN
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSYGITVRRITGSSPFAGIAIGSEASGGVENVLVEHINIYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G+HIKTN GRGG I+N+T S+V + N R G++IAG+VGDHPDN FNP+A+P+V G+ 
Sbjct  283  TGIGVHIKTNTGRGGYIKNVTFSDVILNNVRKGVRIAGNVGDHPDNNFNPSAVPVVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G KV QPG + G K SPFT +CL N+ L         PW+C+DV G A++V P P
Sbjct  343  IKNVVGMKVQQPGTLIGIKDSPFTRVCLDNVKLYSEV-----PWQCTDVSGGAVEVQPSP  397

Query  164  CSELAXNH  141
            CSEL   +
Sbjct  398  CSELMGTY  405



>ref|XP_010924850.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=448

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 141/185 (76%), Gaps = 3/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD ++VKSGWDEYGIAY  P   + +RR+TGSSPF+GI+VGSET GG+ +VLAE I++YN
Sbjct  255  DDLIAVKSGWDEYGIAYAHPSSDVTVRRLTGSSPFAGIAVGSETSGGVENVLAERIHIYN  314

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              VGIHIKTN GRGG IRNIT+S V M + R G++I GDVG HPD+++NPNALP+V G+ 
Sbjct  315  TSVGIHIKTNSGRGGYIRNITISGVNMNHVRNGLRIKGDVGGHPDDKYNPNALPVVDGLT  374

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + QPG I G K SPFT ICLSNI LNGA    + PWKC DV G A +V P P
Sbjct  375  IKNVWGVDIQQPGLIEGIKNSPFTRICLSNITLNGAG---DVPWKCKDVSGGAHKVQPSP  431

Query  164  CSELA  150
            C+EL 
Sbjct  432  CTELT  436



>dbj|BAD61522.1| polygalacturonase-like [Oryza sativa Japonica Group]
Length=261

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG+AYGRP   I IRR+TGSSPF+G +VGSET GG+  VLAEH+N ++
Sbjct  67   DDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNFFS  126

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G+ 
Sbjct  127  SGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDGLT  186

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P P
Sbjct  187  IKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQPSP  244

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  245  CTELTSTSGMSFCTNSL  261



>ref|XP_010527633.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=186

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 139/184 (76%), Gaps = 2/184 (1%)
 Frame = -3

Query  677  WDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYNIGVGIHIKT  498
            WDEYGIAY RP   I IRR+TGSSP++GI++GSE+ G I +V AE I LYN G G+HIKT
Sbjct  1    WDEYGIAYNRPSHDITIRRITGSSPYAGIAIGSESSGSIHNVTAEDITLYNSGFGVHIKT  60

Query  497  NIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIKIQDVWGKKV  318
            NIGRGG ++NI +S +YMEN RTGI+I+G  GDHPD++FNP ALPIV  I I++V G KV
Sbjct  61   NIGRGGTVQNIRISGLYMENVRTGIRISGATGDHPDDKFNPKALPIVRDIMIKNVKGVKV  120

Query  317  SQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWPCSELAXNHR  138
               G ++G + SPFT++CLSN+ L    +  +PPWKCSDV GAA++VSP PC+EL    +
Sbjct  121  QHAGLVQGLRDSPFTNVCLSNVTLTDPKA--SPPWKCSDVTGAAVKVSPLPCAELVATTQ  178

Query  137  YGAC  126
             G+C
Sbjct  179  GGSC  182



>ref|NP_001046468.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAD29699.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAD27952.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAF08382.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAG87758.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87044.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56682.1| hypothetical protein OsJ_06128 [Oryza sativa Japonica Group]
Length=443

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRV GSSPFSGI++GSE  GG+ +VL E  +++N
Sbjct  251  DDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVSNVLVEDCSIFN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTNIGRGG IRNITV NV M + R G++IAGDVGDHPD  F+  ALP V  + 
Sbjct  311  SGYGIHIKTNIGRGGFIRNITVDNVRMNSVRNGLRIAGDVGDHPDEHFSQLALPTVDAVS  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I G + SPFT ICL+N+ L G  +  N  WKC DVHGAA+ V P P
Sbjct  371  IKNVWGVNVQQPGSIEGIRNSPFTRICLANVKLFGWRN--NAAWKCRDVHGAALGVQPGP  428

Query  164  CSELAXNHRYGACS  123
            C+EL  +   G CS
Sbjct  429  CAELTTSLSSGFCS  442



>gb|AIU50445.1| pectin lyase-like superfamily protein, partial [Cinnamomum camphora]
Length=406

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 145/188 (77%), Gaps = 5/188 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPF+GI++GSE  GG+++V AE+I+L+N
Sbjct  223  DDMVAVKSGWDEYGIAYGRPSYGITIRRLTGSSPFAGIAIGSEASGGVLNVFAENISLFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG I+NITV +V+M+  R GIKIAGDVG HPD +F+P ALP+V  I 
Sbjct  283  MGVGIHVKTNIGRGGIIKNITVRDVHMDTVRKGIKIAGDVGGHPDEKFDPTALPVVDSIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++V G KV QPG ++G K  PFT ICL+ I++   S+     W+C DV GAA  V+P P
Sbjct  343  VKNVVGVKVLQPGLLKGLKDLPFTRICLTGINMGNGSA-----WQCEDVTGAAYGVNPSP  397

Query  164  CSELAXNH  141
            C+EL   H
Sbjct  398  CTELITTH  405



>ref|XP_009396562.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP  GI +RRVTGS+ F+GI++GSET GGI +V AE++++++
Sbjct  254  DDLVAVKSGWDEYGIAYARPSSGITVRRVTGSNQFAGIAIGSETSGGIENVFAENLDIFD  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+GIHIKTN GRGG IRNIT+S+V + N R  +KI+G  GDHPD+ ++PNALP+V G+ 
Sbjct  314  SGIGIHIKTNSGRGGFIRNITISDVNLNNVRKALKISGKAGDHPDDGYDPNALPVVDGLT  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG I+G K SPFTHICLSN+ L   +S R  PW C+DV G A++V P P
Sbjct  374  IKNVWGVGVRQPGSIQGIKDSPFTHICLSNVTLK-VNSSREVPWTCADVSGGALEVQPSP  432

Query  164  CSELAXNHRYGACSATL  114
            C+EL   +    C+  L
Sbjct  433  CAELTSVNGVRFCTNAL  449



>ref|XP_006654851.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=306

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGIA+GRP  GI IRR+TGS PF+G +VGSET GG+ +V  EH+N ++
Sbjct  114  DDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNFFS  173

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG IRNITVS V ++ AR G++IAGDVG HPD  +NP+ LP V G+ 
Sbjct  174  MGVGIHIKTNSGRGGFIRNITVSEVTLDGARYGLRIAGDVGGHPDASYNPSMLPAVDGVT  233

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG+ + Q G IRG + S F+ ICLSN+ L G++S    PWKC  V G A+ V P P
Sbjct  234  IKNVWGQNIRQAGLIRGIRNSVFSRICLSNVKLYGSASVG--PWKCRAVSGGALDVQPLP  291

Query  164  CSELAXNHRYGACS  123
            C+EL    +   C+
Sbjct  292  CAELTNTSKMSFCT  305



>ref|NP_001043594.2| Os01g0618900 [Oryza sativa Japonica Group]
 dbj|BAD61521.1| polygalacturonase-like [Oryza sativa Japonica Group]
 dbj|BAF05508.2| Os01g0618900 [Oryza sativa Japonica Group]
Length=308

 Score =   233 bits (595),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG+AYGRP   I IRR+TGSSPF+G +VGSET GG+  VLAEH+N ++
Sbjct  114  DDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNFFS  173

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G+ 
Sbjct  174  SGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDGLT  233

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P P
Sbjct  234  IKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQPSP  291

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  292  CTELTSTSGMSFCTNSL  308



>emb|CDY13383.1| BnaC06g13740D [Brassica napus]
Length=445

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I IRR+TGSSPF+GI++GSET GGI +V  E+I LYN
Sbjct  250  DDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITLYN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G+HIKTNIGRGG I+ ITVS +++E  RTGIKI+GD GDHPD++FN +ALP+V GI 
Sbjct  310  SGIGVHIKTNIGRGGSIQGITVSGIHLEKVRTGIKISGDTGDHPDDKFNTSALPVVQGIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G ++G K +PFT++C SN+   G     +P WKCSDV GAA +V+P  
Sbjct  370  IKNVWGIKVERAGMVQGLKDAPFTNLCFSNVTFTGTKG--SPIWKCSDVVGAAEKVNPTA  427

Query  164  CSELAXNHRYG  132
            C EL    + G
Sbjct  428  CPELTSTSQQG  438



>ref|XP_002441600.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
 gb|EES20030.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
Length=439

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 146/195 (75%), Gaps = 2/195 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGIA+GRP  GI IRR+TGS PF+G +VGSET GG+ +VL EH+NL+ 
Sbjct  247  DDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVLVEHLNLFG  306

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIHIKTN GRGG IRNITVS V +  AR G++IAGDVG HPD  +NP+ LP+V+ + 
Sbjct  307  MGVGIHIKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYNPSVLPVVNSVT  366

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + Q G IRG + S F++ICLSN+ L G++S    PWKC  V GAA+ V P P
Sbjct  367  IKNVLGQNIRQAGLIRGIRNSVFSNICLSNVKLYGSASIG--PWKCRAVSGAALDVQPSP  424

Query  164  CSELAXNHRYGACSA  120
            C+ELA     G C++
Sbjct  425  CTELASTSETGFCTS  439



>emb|CDX67513.1| BnaA07g15530D [Brassica napus]
Length=447

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I IRR+TGSSPF+GI++GSET GGI +V  E+I LYN
Sbjct  252  DDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITLYN  311

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G+HIKTNIGRGG I+ ITVS V++E  RTGIKI+GD GDHPD++FN +ALP+V GI 
Sbjct  312  SGIGVHIKTNIGRGGSIQGITVSGVHLEKVRTGIKISGDTGDHPDDKFNASALPVVRGIT  371

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G ++G K +PFT++C SN+   G     +P WKCSDV GAA +V+P  
Sbjct  372  IKNVWGIKVERAGMVQGLKDAPFTNLCFSNVTFTGTKG--SPIWKCSDVVGAAEKVNPTA  429

Query  164  CSELAXNHRYG  132
            C EL    + G
Sbjct  430  CPELTSTSQQG  440



>ref|XP_009125202.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAY RP   I IRR+TGSSPF+GI++GSET GGI +V  E+I LYN
Sbjct  252  DDLVAVKSGWDEYGIAYNRPSRDITIRRITGSSPFAGIAIGSETSGGIQNVTVENITLYN  311

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G+G+HIKTNIGRGG I+ ITVS V++E  RTGIKI+GD GDHPD++FN +ALP+V GI 
Sbjct  312  SGIGVHIKTNIGRGGSIQGITVSGVHLEKVRTGIKISGDTGDHPDDKFNVSALPVVRGIT  371

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG KV + G ++G K +PFT++C SN+   G     +P WKCSDV GAA +V+P  
Sbjct  372  IKNVWGIKVERAGMVQGLKDAPFTNLCFSNVTFTGTKG--SPIWKCSDVVGAAEKVNPTA  429

Query  164  CSELAXNHRYG  132
            C EL    + G
Sbjct  430  CPELTSTSQQG  440



>emb|CDM83426.1| unnamed protein product [Triticum aestivum]
Length=450

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I IRR+TGSSPF+G SVGSET GG+ +VLAEH+N Y+
Sbjct  256  DDLIAIKSGWDEYGIAYGRPSSDITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNFYS  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N NALPIV  + 
Sbjct  316  SGFGVHIKTNSGRGGFIRNITVSDVVLDNVRYGLRIAGDVGGHPDERYNHNALPIVDSLT  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ V + G I+G   S F+ ICLSNI L+G++  R  PWKC+ V G A+ V P P
Sbjct  376  IKNVQGQNVREAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCAAVSGGALDVQPSP  433

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  434  CTELTSTSGMSFCTNSL  450



>gb|AIU50438.1| pectin lyase-like superfamily protein, partial [Setaria italica]
Length=406

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 140/187 (75%), Gaps = 5/187 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRV GSSPFSGI++GSE  GG+ DVL E  ++++
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSIFD  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKT++GRGG IRN+TV NV M   R+G++IAGD GDHPD RF+  A+P+V  ++
Sbjct  283  SGYGIHIKTSVGRGGYIRNVTVDNVRMSRVRSGVRIAGDAGDHPDGRFSQRAVPMVDAVR  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + QPG + G + SPFT ICL N+ L G ++     W+C DV GAA+ V PWP
Sbjct  343  IRNVWGVGIQQPGSLEGIRNSPFTRICLDNVKLFGGAA-----WRCRDVRGAALGVQPWP  397

Query  164  CSELAXN  144
            C+ELA +
Sbjct  398  CAELATS  404



>gb|AIU50432.1| pectin lyase-like superfamily protein, partial [Panicum virgatum]
Length=406

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 140/187 (75%), Gaps = 5/187 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRV GSSPFSGI++GSE  GG+ DVL E  +++N
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN+GRGG IRN+TV NV M   R+G++IAGDVGDHPD RF+  A+P V  ++
Sbjct  283  SGYGIHIKTNVGRGGYIRNVTVDNVRMSGVRSGVRIAGDVGDHPDGRFSQLAVPTVDAVR  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  V QPG + G + SPFT ICLSN+ L G ++     W+C DV GAA+ V P P
Sbjct  343  IRNVWGVGVQQPGSLEGIRNSPFTRICLSNVKLFGGAA-----WRCRDVRGAALGVHPSP  397

Query  164  CSELAXN  144
            C+ELA +
Sbjct  398  CAELATS  404



>ref|XP_004951285.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=447

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 139/187 (74%), Gaps = 2/187 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRV GSSPFSGI++GSE  GG+ DVL E  ++++
Sbjct  254  DDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSIFD  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKT++GRGG IRN+TV NV M   R+G++IAGD GDHPD RF+  A+P+V  ++
Sbjct  314  SGYGIHIKTSVGRGGYIRNVTVDNVRMSRVRSGVRIAGDAGDHPDGRFSQRAVPMVDAVR  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG  + QPG + G + SPFT ICL N+ L G  +     W+C DV GAA+ V PWP
Sbjct  374  IRNVWGVGIQQPGSLEGIRNSPFTRICLDNVKLFGWRT--GAAWRCRDVRGAALGVQPWP  431

Query  164  CSELAXN  144
            C+ELA +
Sbjct  432  CAELATS  438



>gb|EAZ12715.1| hypothetical protein OsJ_02632 [Oryza sativa Japonica Group]
Length=419

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG+AYGRP   I IRR+TGSSPF+G +VGSET GG+  VLAEH+N ++
Sbjct  225  DDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNFFS  284

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G+ 
Sbjct  285  SGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDGLT  344

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P P
Sbjct  345  IKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQPSP  402

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  403  CTELTSTSGMSFCTNSL  419



>dbj|BAJ89948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I IRR+TGSSPF+G SVGSET GG+ +VLAEH+N Y+
Sbjct  256  DDLIAIKSGWDEYGIAYGRPSSDITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNFYS  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N NALPIV  + 
Sbjct  316  SGFGVHIKTNSGRGGFIRNITVSDVILDNVRYGLRIAGDVGGHPDERYNHNALPIVDSLM  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSNI L+G++  R  PWKC  V G A+ V P P
Sbjct  376  IKNVQGQNIKEAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCQAVSGGALDVQPSP  433

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  434  CTELTSMSGMSFCTNSL  450



>dbj|BAJ94644.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91541.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 144/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I IRR+TGSSPF+G SVGSET GG+ +VLAEH+N Y+
Sbjct  256  DDLIAIKSGWDEYGIAYGRPSSDITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNFYS  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N NALPIV  + 
Sbjct  316  SGFGVHIKTNSGRGGFIRNITVSDVILDNVRYGLRIAGDVGGHPDERYNHNALPIVDSLM  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSNI L+G++  R  PWKC  V G A+ V P P
Sbjct  376  IKNVQGQNIKEAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCQAVSGGALDVQPSP  433

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  434  CTELTSMSGMSFCTNSL  450



>gb|EAY74990.1| hypothetical protein OsI_02888 [Oryza sativa Indica Group]
Length=445

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG+AYGRP   I IRR+TGSSPF+G +VGSET GG+  VLAEH+N ++
Sbjct  251  DDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSGGVEHVLAEHLNFFS  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TVS+V +++ R G++IAGDVG HPD+R++ NALP+V G+ 
Sbjct  311  SGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDDRYDRNALPVVDGLT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSN+ LNG ++ R  PWKC  V GAA+ V P P
Sbjct  371  IKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKCEAVSGAALDVQPSP  428

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  429  CTELTSTSGMSFCTNSL  445



>gb|AIU50444.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=406

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP  GI IRR+TGS+PF+GI++GSE  GG+ +VLAE + +YN
Sbjct  223  DDLVAIKSGWDQYGIAYGRPSSGITIRRLTGSTPFAGIAIGSEMSGGVENVLAEDVTIYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GI++KT IGRGG I+NITVS +Y+ N R  I+IAG+VGDHPD+ F+P+A+PIV+GI 
Sbjct  283  SGFGINLKTTIGRGGIIKNITVSGLYVANVRKAIRIAGNVGDHPDDGFDPDAVPIVNGIT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G  V QPG I G K SPFT ICLSNI++     P    WKCSD+ G A  V PWP
Sbjct  343  IKDVRGVDVLQPGSIEGIKSSPFTQICLSNINI-----PIGTAWKCSDISGVAQSVYPWP  397

Query  164  CSEL  153
            CS L
Sbjct  398  CSNL  401



>ref|NP_001149385.1| LOC100283011 precursor [Zea mays]
 gb|ACG35253.1| polygalacturonase [Zea mays]
Length=446

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 142/194 (73%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYG+A+GRP  GI +RR+TGS PF+G +VGSET GG+ DV+AEH++   
Sbjct  253  DDLISIKSGWDEYGVAFGRPSSGITVRRITGSGPFAGFAVGSETSGGVEDVVAEHLSFSG  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG+H+KTN GRGG IRN+TVS V ++ AR G++IAGDVG HP   +N + LP+V G+ 
Sbjct  313  VGVGVHVKTNSGRGGFIRNVTVSQVTLDGARYGLRIAGDVGGHPGASYNASLLPVVDGVA  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++VWG+ V Q G IRG + S F++ICLSN+ L G  S    PW+C  V G+A+ V P P
Sbjct  373  VRNVWGRNVRQAGLIRGIRDSVFSNICLSNVKLYGIGSDSIGPWRCRAVSGSALDVQPSP  432

Query  164  CSELAXNHRYGACS  123
            C+ELA     G C+
Sbjct  433  CAELASTSGTGFCT  446



>ref|XP_004969187.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=444

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 143/197 (73%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP   I +RR+TGSSPF+G +VGSET GG+ +VLAEH+N ++
Sbjct  250  DDAVAIKSGWDEYGIAYGRPSSDITVRRITGSSPFAGFAVGSETSGGVQNVLAEHLNFFS  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRNITVS+V ++N R G++I GDVGDHPD+ +N +ALP+V  + 
Sbjct  310  SGFGIHIKTNTGRGGFIRNITVSDVTLDNVRYGLRITGDVGDHPDDSYNRSALPVVDTLT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSN+ L+G +  R  PWKC  V G A+ V P P
Sbjct  370  IKNVQGQNIREAGLIKGITNSAFSRICLSNVKLSGGTPVR--PWKCEAVTGGALDVQPSP  427

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  428  CTELTSTSGTSFCTNSL  444



>gb|AFW81284.1| hypothetical protein ZEAMMB73_960645 [Zea mays]
Length=458

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 142/194 (73%), Gaps = 0/194 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYG+A+GRP  GI +RR+TGS PF+G +VGSET GG+ DV+AEH++   
Sbjct  265  DDLISIKSGWDEYGVAFGRPSSGITVRRITGSGPFAGFAVGSETSGGVEDVVAEHLSFSG  324

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVG+H+KTN GRGG IRN+TVS V ++ AR G++IAGDVG HP   +N + LP++ G+ 
Sbjct  325  VGVGVHVKTNSGRGGFIRNVTVSQVTLDGARYGLRIAGDVGGHPGASYNASLLPVIDGVA  384

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++VWG+ V Q G IRG + S F++ICLSN+ L G  S    PW+C  V G+A+ V P P
Sbjct  385  VRNVWGRNVRQAGLIRGIRDSVFSNICLSNVKLYGIGSDSIGPWRCRAVSGSALDVQPSP  444

Query  164  CSELAXNHRYGACS  123
            C+ELA     G C+
Sbjct  445  CAELASTSGTGFCT  458



>ref|XP_002455965.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
 gb|EES01085.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
Length=447

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I +RR+TGSSPF+G +VGSET GG+ +VLAEH+N ++
Sbjct  253  DDAIAIKSGWDEYGIAYGRPSSDITVRRITGSSPFAGFAVGSETSGGVENVLAEHLNFFS  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TVS+V ++N R G++I GDVG+HPD R+N +ALPIV  + 
Sbjct  313  SGFGIHIKTNTGRGGFIRNVTVSDVTLDNVRYGLRIVGDVGNHPDERYNRSALPIVDALT  372

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSN+ L G +  +  PWKC  V G A+ V P P
Sbjct  373  IKNVQGQNIKEAGLIKGIANSAFSRICLSNVKLTGGAPVQ--PWKCEAVSGGALDVQPSP  430

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  431  CTELTSTSGTSFCTNSL  447



>gb|AIU50440.1| pectin lyase-like superfamily protein, partial [Sorghum bicolor]
Length=406

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 138/187 (74%), Gaps = 5/187 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRV GSSPFSGI++GSE  GG+ DVL E  ++++
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSIFD  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN+GRGG IRN+TV NV M   R+G++IAGDVGDHPD  F+  A+P+V  ++
Sbjct  283  SGYGIHIKTNVGRGGYIRNVTVDNVRMSGVRSGVRIAGDVGDHPDAHFSQLAVPLVDAVR  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V  PG + G + SPFT ICLSN+ L G ++     W+C DV GAA+ V P P
Sbjct  343  ISNVWGVNVQHPGSLEGIRSSPFTRICLSNVKLFGDAA-----WRCRDVRGAALGVQPSP  397

Query  164  CSELAXN  144
            C+ELA +
Sbjct  398  CAELATS  404



>ref|NP_001056466.1| Os05g0587000 [Oryza sativa Japonica Group]
 dbj|BAF18380.1| Os05g0587000 [Oryza sativa Japonica Group]
 gb|EAZ10399.1| hypothetical protein OsJ_00232 [Oryza sativa Japonica Group]
Length=448

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGIA+GRP  GI IRR+TGS PF+G +VGSET GG+ +V  EH+N + 
Sbjct  256  DDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNFFG  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTN GRGG IRNITVS V +  AR G++IAGDVG HPD  ++P+ LP+V G+ 
Sbjct  316  MGVGIHVKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYDPSKLPVVDGVT  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG+ + Q G +RG + S F+ ICLSN+ L G  S    PWKC  V G A+ V P P
Sbjct  376  IKNVWGQNIRQAGLVRGIRDSVFSRICLSNVKLYGGDSVG--PWKCRAVSGGALDVQPSP  433

Query  164  CSELAXNHRYGACS  123
            C+EL        C+
Sbjct  434  CAELTSTSEMSFCT  447



>gb|EAY99223.1| hypothetical protein OsI_21181 [Oryza sativa Indica Group]
Length=448

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGIA+GRP  GI IRR+TGS PF+G +VGSET GG+ +V  EH+N + 
Sbjct  256  DDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNFFG  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTN GRGG IRNITVS V +  AR G++IAGDVG HPD  ++P+ LP+V G+ 
Sbjct  316  MGVGIHVKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYDPSKLPVVDGVT  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG+ + Q G +RG + S F+ ICLSN+ L G  S    PWKC  V G A+ V P P
Sbjct  376  IKNVWGQNIRQAGLVRGIRDSVFSRICLSNVKLYGGDSV--GPWKCRAVSGGALDVQPSP  433

Query  164  CSELAXNHRYGACS  123
            C+EL        C+
Sbjct  434  CAELTSTSEMSFCT  447



>gb|AAT44156.1| putative polygalacturonase [Oryza sativa Japonica Group]
Length=474

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGIA+GRP  GI IRR+TGS PF+G +VGSET GG+ +V  EH+N + 
Sbjct  282  DDLISIKSGWDEYGIAFGRPSSGITIRRITGSGPFAGFAVGSETSGGVENVHVEHLNFFG  341

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTN GRGG IRNITVS V +  AR G++IAGDVG HPD  ++P+ LP+V G+ 
Sbjct  342  MGVGIHVKTNSGRGGFIRNITVSEVTLNGARYGLRIAGDVGGHPDASYDPSKLPVVDGVT  401

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++VWG+ + Q G +RG + S F+ ICLSN+ L G  S    PWKC  V G A+ V P P
Sbjct  402  IKNVWGQNIRQAGLVRGIRDSVFSRICLSNVKLYGGDSV--GPWKCRAVSGGALDVQPSP  459

Query  164  CSELAXNHRYGACS  123
            C+EL        C+
Sbjct  460  CAELTSTSEMSFCT  473



>gb|ACN36471.1| unknown [Zea mays]
Length=347

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  G+ +RRV GSSPFSGI++GSE  GG+ DVL E   +++
Sbjct  154  DDLVAIKSGWDEYGIAYGRPSAGVTVRRVRGSSPFSGIAIGSEASGGVRDVLVEDCAIFD  213

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN+GRGG IRN+TV  V +   R+G++IAGDVGDHPD  F+  A+P V  ++
Sbjct  214  SGYGIHIKTNVGRGGYIRNVTVDGVRLTGVRSGVRIAGDVGDHPDAHFSQLAVPTVDAVR  273

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V QPG + G + SPFT ICLSN+ L G  S  +  WKC DV GAA+ V P P
Sbjct  274  ISNVWGVNVQQPGSLEGIRASPFTRICLSNVKLFGWRS--DAAWKCRDVRGAALGVQPSP  331

Query  164  CSELAXN  144
            C+ELA +
Sbjct  332  CAELATS  338



>gb|AIU50436.1| pectin lyase-like superfamily protein, partial [Dioscorea oppositifolia]
Length=406

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 140/185 (76%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGI +GRP   I IRR+ GSSP++GI++GSE  GG+ +VL +++N++N
Sbjct  223  DDLVAVKSGWDEYGITFGRPSSDITIRRLRGSSPYAGIAIGSEASGGVQNVLVDNVNIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRNIT+SNV M   R GI+IAG+VGDHPD++++ +ALP+V G+ 
Sbjct  283  SGFGIHIKTNTGRGGFIRNITISNVIMNKVRKGIRIAGNVGDHPDDKYDQSALPVVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G  + QPG I+G K SPFT ICLSN+ L         PWKC DV GAA++V P P
Sbjct  343  IKNVQGFNIEQPGTIQGIKDSPFTRICLSNVKLWSEV-----PWKCDDVTGAALEVQPSP  397

Query  164  CSELA  150
            C+ELA
Sbjct  398  CTELA  402



>ref|NP_001141464.1| uncharacterized protein LOC100273574 precursor [Zea mays]
 ref|XP_008654580.1| PREDICTED: uncharacterized protein LOC100273574 isoform X1 [Zea 
mays]
 gb|ACF86427.1| unknown [Zea mays]
 gb|ACN28939.1| unknown [Zea mays]
 gb|AFW83292.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
 gb|AFW83293.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
Length=446

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGR   GI +RR+TGSSPF+G +VGSET GG+ +VLAEH+N +N
Sbjct  252  DDSIAIKSGWDEYGIAYGRASSGITVRRITGSSPFAGFAVGSETSGGVENVLAEHLNFFN  311

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIH+KTN GRGG IRNITVS+V ++N R G++I GDVG+HPD+ +N +ALPIV  + 
Sbjct  312  SGFGIHVKTNTGRGGFIRNITVSDVTLDNVRYGLRIVGDVGNHPDDSYNRSALPIVDALT  371

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++V G+ V + G I+G   S F+ ICLSN+   G +  R  PWKC  V G A+ V P P
Sbjct  372  VKNVQGQNVREAGLIKGIPNSAFSRICLSNVKFTGGAPVR--PWKCEAVSGGALDVQPSP  429

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  430  CTELTSTSGTSFCTNSL  446



>ref|XP_006646109.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=444

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG+AYGRP   I +RR+TGSSPF+G +VGSET GG+  +LAEH+N  +
Sbjct  250  DDLIAIKSGWDEYGMAYGRPSSHITVRRITGSSPFAGFAVGSETSGGVEHILAEHLNFVS  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN GRGG IRN+TVS+V ++  R G++IAGDVG HPD+R++ NALP+V G+ 
Sbjct  310  SGFGIHIKTNTGRGGFIRNVTVSDVTLDTVRYGLRIAGDVGGHPDDRYDRNALPVVDGLT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSN+  NG +  R  PWKC  V GAA+ V P P
Sbjct  370  IKNVQGQNIREAGSIKGIATSAFSRICLSNVKFNGGTPVR--PWKCEAVSGAALDVQPSP  427

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  428  CTELTSTSGMSFCTNSL  444



>ref|XP_003569374.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=448

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP   I +RR+TGSSPF+G +VGSET GG+ +VLAEH+N ++
Sbjct  254  DDLVAIKSGWDEYGIAYGRPSSDITVRRITGSSPFAGFAVGSETSGGVENVLAEHLNFFS  313

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G G+HIKTN GRGG IRN+TVS+V ++N R G++IAGDVGDHPD  +N NALP V  + 
Sbjct  314  SGFGVHIKTNSGRGGFIRNVTVSDVTLDNVRYGLRIAGDVGDHPDEHYNHNALPKVDSLT  373

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I++V G+ + + G I+G   S F+ ICLSNI L+G+   R  PWKC  V G A+ + P P
Sbjct  374  IKNVQGQNIKEAGSIKGIASSAFSRICLSNIKLHGSVPVR--PWKCESVSGGALDLQPSP  431

Query  164  CSELAXNHRYGACSATL  114
            C+EL        C+ +L
Sbjct  432  CTELTSTSGTSFCTNSL  448



>ref|NP_001170283.1| uncharacterized protein LOC100384246 precursor [Zea mays]
 gb|ACN33336.1| unknown [Zea mays]
 gb|AFW65883.1| hypothetical protein ZEAMMB73_311601 [Zea mays]
Length=451

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 136/187 (73%), Gaps = 2/187 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  G+ +RRV GSSPFSGI++GSE  GG+ DVL E   +++
Sbjct  258  DDLVAIKSGWDEYGIAYGRPSAGVTVRRVRGSSPFSGIAIGSEASGGVRDVLVEDCAIFD  317

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN+GRGG IRN+TV  V +   R+G++IAGDVGDHPD  F+  A+P V  ++
Sbjct  318  SGYGIHIKTNVGRGGYIRNVTVDGVRLTGVRSGVRIAGDVGDHPDAHFSQLAVPTVDAVR  377

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V QPG + G + SPFT ICLSN+ L G  S  +  WKC DV GAA+ V P P
Sbjct  378  ISNVWGVNVQQPGSLEGIRASPFTRICLSNVKLFGWRS--DAAWKCRDVRGAALGVQPSP  435

Query  164  CSELAXN  144
            C+ELA +
Sbjct  436  CAELATS  442



>ref|XP_006837459.1| hypothetical protein AMTR_s00107p00122980 [Amborella trichopoda]
 gb|ERN00313.1| hypothetical protein AMTR_s00107p00122980 [Amborella trichopoda]
Length=447

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 137/195 (70%), Gaps = 3/195 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSS-PFSGISVGSETXGGIVDVLAEHINLY  528
            DD V++KSGWDEYGIAY RP   I IRR++GSS  F+GI+ GSET GGI D++ E+I L 
Sbjct  250  DDLVAIKSGWDEYGIAYARPSSFITIRRISGSSLAFTGIAFGSETSGGISDIVVENITLV  309

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N    I +KTN GRGG IRNITV  V++EN    IK AGDVGDHPD++++P ALP+V G+
Sbjct  310  NTATAIFLKTNAGRGGYIRNITVRGVHLENVTKAIKFAGDVGDHPDDKYDPRALPVVEGV  369

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             I DVWG  V QPG ++G   +PF  ICLSN++L G        WKC+D+ G A+ V PW
Sbjct  370  SISDVWGVGVMQPGSMKGINGAPFKGICLSNVNLYGWVP--GAQWKCTDISGVALGVRPW  427

Query  167  PCSELAXNHRYGACS  123
            PC+ELA  H  GACS
Sbjct  428  PCAELAATHGTGACS  442



>gb|AIU50449.1| pectin lyase-like superfamily protein, partial [Zea mays]
Length=406

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 136/187 (73%), Gaps = 5/187 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  G+ +RRV GSSPFSGI++GSE  GG+ DVL E   +++
Sbjct  223  DDLVAIKSGWDEYGIAYGRPSAGVTVRRVRGSSPFSGIAIGSEASGGVRDVLVEDCAIFD  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GIHIKTN+GRGG IRN+TV  V +   R+G++IAGDVGDHPD  F+  A+P V  ++
Sbjct  283  SGYGIHIKTNVGRGGYIRNVTVDGVRLTGVRSGVRIAGDVGDHPDAHFSQLAVPTVDAVR  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V QPG + G + SPFT ICLSN+ L G ++     WKC DV GAA+ V P P
Sbjct  343  ISNVWGVNVQQPGSLEGIRASPFTRICLSNVKLFGDAA-----WKCRDVRGAALGVQPSP  397

Query  164  CSELAXN  144
            C+ELA +
Sbjct  398  CAELATS  404



>gb|AIU50451.1| pectin lyase-like superfamily protein, partial [Cabomba caroliniana]
Length=406

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 134/185 (72%), Gaps = 5/185 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIA+GRP   I +RR+TG+S F+GI+ GSET GGI ++L E+INLYN
Sbjct  223  DDLVAIKSGWDEYGIAFGRPSSNITVRRITGTSSFAGIAFGSETSGGIENILVENINLYN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KTN GRGG IRNITV ++YMEN +  IK AG+VGDHPDN +NPNALP+V G+ 
Sbjct  283  TATGIFLKTNAGRGGVIRNITVRDIYMENVKNAIKFAGNVGDHPDNNYNPNALPVVDGVA  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I +VWG  V  PG + G + +PF  ICLSNI+L G+      PWKC  V G A+ V P P
Sbjct  343  IVNVWGDSVLHPGSLVGVQGAPFQRICLSNINLRGSL-----PWKCDGVEGFALGVHPGP  397

Query  164  CSELA  150
            C+ L 
Sbjct  398  CASLV  402



>ref|XP_002451891.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
 gb|EES04867.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
Length=448

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 137/188 (73%), Gaps = 2/188 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWDEYGIAYGRP  GI IRRV GSSPFSGI++GSE  GG+ DVL E  ++++
Sbjct  253  DDLVAIKSGWDEYGIAYGRPSSGITIRRVRGSSPFSGIAIGSEASGGVRDVLVEDCSIFD  312

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENAR-TGIKIAGDVGDHPDNRFNPNALPIVSGI  348
             G GIHIKTN+GRGG IRN+TV NV M   R +G++IAGDVGDHPD  F+  A+P+V  +
Sbjct  313  SGYGIHIKTNVGRGGYIRNVTVDNVRMSGVRISGVRIAGDVGDHPDAHFSQLAVPLVDAV  372

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
            +I +VWG  V  PG + G + SPFT ICLSN+ L G     +  W+C DV GAA+ V P 
Sbjct  373  RISNVWGVNVQHPGSLEGIRSSPFTRICLSNVKLFGWRK-NDAAWRCRDVRGAALGVQPS  431

Query  167  PCSELAXN  144
            PC+ELA +
Sbjct  432  PCAELATS  439



>gb|AIU50447.1| pectin lyase-like superfamily protein, partial [Ginkgo biloba]
Length=401

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 136/184 (74%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I IRRVTG++ FSGI+ GSET GGI D+L E+++++N
Sbjct  223  DDMIAIKSGWDEYGIAYGRPSSNIIIRRVTGTTGFSGIAFGSETSGGIRDILVENVSIFN  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GI +KTN GRGG I+NIT+S++Y+EN R  IK  GD GDHPD+++NP ALPIV+ I 
Sbjct  283  SGTGIRLKTNAGRGGIIQNITISDIYLENVRIAIKFTGDTGDHPDSQYNPQALPIVTKIA  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +++V GK +   G + G ++SPF  ICL+NI+L G  S     W+CS V GA++ V P P
Sbjct  343  VKNVRGKNIHSVGSMDGLERSPFLDICLANINLQGTDS-----WQCSAVEGASVGVYPQP  397

Query  164  CSEL  153
            C +L
Sbjct  398  CPQL  401



>gb|AIU50417.1| pectin lyase-like superfamily protein, partial [Iris japonica]
Length=406

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 5/184 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGI+YGRP   I I+R+T SSPFS I++GSE  GGI  +L  +IN+++
Sbjct  223  DDAIAIKSGWDEYGISYGRPSTFITIQRITASSPFSAIAIGSEASGGIQHILIHNINIHS  282

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              + IHIKTN GRGG I N+T+S+V+M     G++I GDVGDHPD  FNP AL  V G+ 
Sbjct  283  TAIAIHIKTNAGRGGFITNVTISDVHMSRVTEGVRIVGDVGDHPDGNFNPGALTRVDGVT  342

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DVWG  V +PG I G K SPFT ICLSN+ L G        W+C++V G A+ V PWP
Sbjct  343  IRDVWGVGVREPGSIEGIKDSPFTRICLSNVRLWGMEK-----WRCAEVSGVAVGVEPWP  397

Query  164  CSEL  153
            C+EL
Sbjct  398  CAEL  401



>gb|EMT32528.1| Putative polygalacturonase [Aegilops tauschii]
Length=443

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIA GRP  GI IRR+TGSSPF+G SVGSET GG+ +VLAEH+N Y+
Sbjct  241  DDLIAIKSGWDEYGIACGRPSSGITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNFYS  300

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G G+HIKTN GRGG IRNITVS+V ++N R G++IAGDVG HPD R+N +ALPIV  + 
Sbjct  301  SGFGVHIKTNSGRGGFIRNITVSDVVLDNVRYGLRIAGDVGGHPDERYNHSALPIVDSLT  360

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVH  195
            I++V G+ + + G I+G   S F+ ICLSNI L+G++  R  PWKC+  H
Sbjct  361  IKNVQGQNIKEAGLIKGIPNSAFSRICLSNIKLHGSAPVR--PWKCAAGH  408



>gb|AIU50428.1| pectin lyase-like superfamily protein, partial [Persea americana]
Length=190

 Score =   199 bits (507),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+VKSGWDEYGIAYGRP  GI IRR+TGSSPFSGI++GSE  GG+++V AE+I L+N
Sbjct  49   DDLVAVKSGWDEYGIAYGRPSNGITIRRLTGSSPFSGIAIGSEASGGVLNVFAENITLFN  108

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +GVGIH+KTNIGRGG I+NITV +V+M   R GIKIAGDVGDHPD++F+P ALP+VS I 
Sbjct  109  MGVGIHVKTNIGRGGIIKNITVRDVHMHTVRKGIKIAGDVGDHPDDKFDPKALPVVS-IT  167

Query  344  IQDVWGKKVSQPGFIRGXKKSPF  276
            +++V G KV QPG ++G K  PF
Sbjct  168  VKNVRGLKVLQPGLLQGLKDLPF  190



>gb|AIU50419.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
demersum]
Length=368

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V++KSGWD+YGIAYGRP  GI IRR+TGS+PF+GI++GSE  GG+ +VLAE + +YN
Sbjct  218  DDLVAIKSGWDQYGIAYGRPSSGITIRRLTGSTPFAGIAIGSEMSGGVENVLAEDVTIYN  277

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
             G GI++KT IGRGG I+NITVS +Y+ N R  I+IAG+VGDHPD+ F+P+A+PIV+GI 
Sbjct  278  SGFGINLKTTIGRGGIIKNITVSGLYVANVRKAIRIAGNVGDHPDDGFDPDAVPIVNGIT  337

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNI  252
            I+DV G  V QPG I G K SPFT ICLSNI
Sbjct  338  IKDVRGVDVLQPGSIEGIKSSPFTQICLSNI  368



>gb|KHN38363.1| Putative polygalacturonase [Glycine soja]
Length=327

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD V+ KSGWDEYGI YGRP   I IRRVTGSSPF+GI++GSET GG+ +VL+EHINLYN
Sbjct  150  DDLVAEKSGWDEYGIVYGRPSSDITIRRVTGSSPFAGIAIGSETSGGVENVLSEHINLYN  209

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
            +G+GIHIKTN GR G I+NIT+S+VYME AR GI+I+GDVGDHPD++++PNALP+V G+ 
Sbjct  210  MGIGIHIKTNTGRAGYIKNITMSHVYMEEARKGIRISGDVGDHPDDKYDPNALPLVKGVT  269

Query  344  IQDVWGKK  321
            I++VWG K
Sbjct  270  IKNVWGVK  277



>gb|EYU46764.1| hypothetical protein MIMGU_mgv1a0060621mg, partial [Erythranthe 
guttata]
Length=318

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 118/184 (64%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+Y +    + IR+V   SS  S I+ GSE  GGI  +LAE+I +++
Sbjct  111  DAVVLKSGWDEYGISYNKSTSHVHIRKVHLQSSSGSAIAFGSEMSGGISTILAENIYIHD  170

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG +RNI VS VYMEN + GI + G    HPD++F+P ALPIVS I 
Sbjct  171  SLTGIELKTAKGRGGYLRNILVSQVYMENVQQGINVTGQSTSHPDDKFDPQALPIVSDIS  230

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
              D+ G  ++  G   G ++SPFT  CLSN+  +  S P N  W CSDV G+++ VSP P
Sbjct  231  FHDIIGLNITTAGIFSGIEESPFTSFCLSNVSFSVTSDPSN-SWVCSDVVGSSVNVSPEP  289

Query  164  CSEL  153
            C EL
Sbjct  290  CPEL  293



>ref|XP_007223360.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
 gb|EMJ24559.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
Length=452

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 117/184 (64%), Gaps = 3/184 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +++KSGWDEYGIAYGRP   + IRRV   SS  S ++ GSE  GGI DV  E +++YN
Sbjct  250  DAIALKSGWDEYGIAYGRPTTNVHIRRVYLQSSSGSSLAFGSEMSGGISDVFVEQVHIYN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG IR I +S+V MEN       +G  G HPD++F+PNALP +  I 
Sbjct  310  SFSGIQFRTTKGRGGYIREIIISDVEMENIHMAFGASGQFGSHPDDKFDPNALPDLDHIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +QDV G  ++  G   G ++SPFT  CLSNI L+  S   +P W+CS+V G++  V P P
Sbjct  370  LQDVIGTNITIAGSFTGIQESPFTSFCLSNISLSANSG--SPTWECSNVSGSSDSVFPQP  427

Query  164  CSEL  153
            CSE 
Sbjct  428  CSEF  431



>ref|XP_008223260.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=452

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +++KSGWDEYGIAYGRP   + IRRV   SS  S ++ GSE  GGI DV  E ++LYN
Sbjct  250  DAIALKSGWDEYGIAYGRPTTNVHIRRVYLQSSSGSSLAFGSEMSGGISDVFVEQVHLYN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG IR I +S+V MEN       +G  G HPD++F+PNALP +  I 
Sbjct  310  SFSGIQFRTTKGRGGYIREIIISDVEMENIHMAFGASGQFGSHPDDKFDPNALPDLDHIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +QDV G  ++  G   G ++SPFT  CLSNI L+  S    P W CS+V G++  V P P
Sbjct  370  LQDVIGTNITIAGSFTGIQESPFTSFCLSNISLSANSG--FPTWVCSNVSGSSYSVFPQP  427

Query  164  CSEL  153
            CSE 
Sbjct  428  CSEF  431



>ref|XP_011079616.1| PREDICTED: probable polygalacturonase isoform X2 [Sesamum indicum]
Length=451

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D + +KSGWDEYGIAYG+P   + IRRV   SS  SG++ GSE  GGI  VLAE++++++
Sbjct  245  DAIVLKSGWDEYGIAYGKPTSHVHIRRVRLQSSSGSGLAFGSEMSGGISSVLAENLHVHD  304

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              +G+ +KT  GRG  I++I VSNV+MEN + GIK+ G    HPD+ ++P+ALP+VS I 
Sbjct  305  TLIGVELKTARGRGSYIQDIFVSNVHMENVQQGIKVTGQCTSHPDDGYDPHALPVVSDIT  364

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
              D+ G  ++  G   G  +SPFT +CLSN+  N  + P    W C++V G+++ VSP P
Sbjct  365  FMDIVGVNITTAGIFSGIDESPFTSLCLSNLSFNVTADPST-SWVCANVLGSSVNVSPEP  423

Query  164  CSEL  153
            C EL
Sbjct  424  CPEL  427



>ref|XP_011079615.1| PREDICTED: probable polygalacturonase isoform X1 [Sesamum indicum]
Length=451

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D + +KSGWDEYGIAYG+P   + IRRV   SS  SG++ GSE  GGI  VLAE++++++
Sbjct  245  DAIVLKSGWDEYGIAYGKPTSHVHIRRVRLQSSSGSGLAFGSEMSGGISSVLAENLHVHD  304

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              +G+ +KT  GRG  I++I VSNV+MEN + GIK+ G    HPD+ ++P+ALP+VS I 
Sbjct  305  TLIGVELKTARGRGSYIQDIFVSNVHMENVQQGIKVTGQCTSHPDDGYDPHALPVVSDIT  364

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
              D+ G  ++  G   G  +SPFT +CLSN+  N  + P    W C++V G+++ VSP P
Sbjct  365  FMDIVGVNITTAGIFSGIDESPFTSLCLSNLSFNVTADPST-SWVCANVLGSSVNVSPEP  423

Query  164  CSEL  153
            C EL
Sbjct  424  CPEL  427



>ref|XP_009793676.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=462

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 120/184 (65%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+YG+P   + IR V   SS  S ++ GSE  GGI +VL EHI+L++
Sbjct  256  DAVVLKSGWDEYGISYGKPTSNVHIRGVRLQSSAGSAVAFGSEMSGGISNVLVEHISLHD  315

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG I++I + NV MEN + GIK  G    HPD +++P++LP+VSGI 
Sbjct  316  SLFGIDLKTARGRGGYIKDILIMNVVMENVQVGIKATGYYDSHPDEKYDPSSLPVVSGIT  375

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  +S  G   G  +SPFT ICLSNI  + +S P   PW CSDV G++  V P P
Sbjct  376  FKDIVGTNISIAGNFTGLSESPFTSICLSNISFSISSDPST-PWLCSDVSGSSENVFPEP  434

Query  164  CSEL  153
            C EL
Sbjct  435  CPEL  438



>ref|XP_009784607.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana sylvestris]
Length=455

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+YG+P   + +R V   S   +G++ GSE  GGI +VL EH+ L++
Sbjct  250  DAVVLKSGWDEYGISYGKPTTNVHVRGVRLQSCAGAGLAFGSEMSGGISNVLVEHVYLHD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VSGI 
Sbjct  310  SLFGIELKTARGRGGYIKDIIVTDVVMANVQVGIEATGHCDSHPDEKFDPSALPVVSGIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  +S  G   G  +SPFT ICLSN+  + +S+P   PW CS+++G++  VSP P
Sbjct  370  FEDIVGTNISTAGNFSGLSESPFTSICLSNVTFSVSSNPT--PWLCSNIYGSSQNVSPEP  427

Query  164  CSEL  153
            C EL
Sbjct  428  CPEL  431



>ref|XP_009784614.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana sylvestris]
Length=439

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+YG+P   + +R V   S   +G++ GSE  GGI +VL EH+ L++
Sbjct  234  DAVVLKSGWDEYGISYGKPTTNVHVRGVRLQSCAGAGLAFGSEMSGGISNVLVEHVYLHD  293

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VSGI 
Sbjct  294  SLFGIELKTARGRGGYIKDIIVTDVVMANVQVGIEATGHCDSHPDEKFDPSALPVVSGIT  353

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  +S  G   G  +SPFT ICLSN+  + +S+P   PW CS+++G++  VSP P
Sbjct  354  FEDIVGTNISTAGNFSGLSESPFTSICLSNVTFSVSSNPT--PWLCSNIYGSSQNVSPEP  411

Query  164  CSEL  153
            C EL
Sbjct  412  CPEL  415



>ref|XP_006576263.1| PREDICTED: uncharacterized protein LOC100817309 isoform X2 [Glycine 
max]
Length=463

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 117/194 (60%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I I R+ G +  SGI++GSE  GG+ +V AE I  Y+
Sbjct  251  DDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQFYD  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
                I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  I 
Sbjct  311  SYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEKIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ +   G I G +   F +ICLSNI LN  S   N PW CS V G +  V P  
Sbjct  371  IKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQPEA  427

Query  164  CSELAXNHRYGACS  123
            C  L      G CS
Sbjct  428  CEPLKERIFPGHCS  441



>ref|NP_001241086.1| uncharacterized protein LOC100817309 precursor [Glycine max]
 gb|ACU18828.1| unknown [Glycine max]
Length=467

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 117/194 (60%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I I R+ G +  SGI++GSE  GG+ +V AE I  Y+
Sbjct  251  DDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQFYD  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
                I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  I 
Sbjct  311  SYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEKIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ +   G I G +   F +ICLSNI LN  S   N PW CS V G +  V P  
Sbjct  371  IKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQPEA  427

Query  164  CSELAXNHRYGACS  123
            C  L      G CS
Sbjct  428  CEPLKERIFPGHCS  441



>ref|XP_009624281.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=455

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 125/201 (62%), Gaps = 5/201 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+YG+P   + +R V   S   +G++ GSE  GGI +VL EH+ L++
Sbjct  250  DAVVLKSGWDEYGISYGKPTTSVHVRGVRLQSCAGAGLAFGSEMSGGISNVLVEHVYLHD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG I++I V++V M N + GI   G    HPD +F+P+ALP+VSGI 
Sbjct  310  SLFGIELKTARGRGGYIKDIIVTDVVMANVQVGIDATGHCDSHPDEKFDPSALPVVSGIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  +   G   G  +SPFT ICLSN+  + +S+P   PW CSD+ G++  VSP P
Sbjct  370  FEDIVGTDIFTAGNFSGLSESPFTSICLSNVTFSVSSNPI--PWLCSDISGSSQNVSPEP  427

Query  164  CSELAXNHR--YGACSATL*P  108
            C EL  +       CSA L P
Sbjct  428  CPELQNSFSGTTSTCSALLYP  448



>ref|XP_006576262.1| PREDICTED: uncharacterized protein LOC100817309 isoform X1 [Glycine 
max]
Length=468

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 117/194 (60%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I I R+ G +  SGI++GSE  GG+ +V AE I  Y+
Sbjct  251  DDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQFYD  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
                I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  I 
Sbjct  311  SYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEKIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ +   G I G +   F +ICLSNI LN  S   N PW CS V G +  V P  
Sbjct  371  IKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQPEA  427

Query  164  CSELAXNHRYGACS  123
            C  L      G CS
Sbjct  428  CEPLKERIFPGHCS  441



>ref|XP_003626072.1| Polygalacturonase [Medicago truncatula]
 gb|AES82290.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 120/185 (65%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFS-GISVGSETXGGIVDVLAEHINLY  528
            DD +++KSGWDEYGIA+GRP   I I R+ G +  S GI++GSE  GG+ DV AE I+ Y
Sbjct  251  DDLIAIKSGWDEYGIAFGRPSTNIVIHRLVGKTHTSAGIAIGSEMSGGVSDVRAEDIHFY  310

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            +    I IKT+ GRGG +RNI V+N+ + N    I+  G  GDHPD+ ++PNALP++  I
Sbjct  311  DSYTAIRIKTSPGRGGYVRNIYVTNMTLANVDIAIRFTGSYGDHPDDAYDPNALPVIEKI  370

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             I+DV G+ +++ G I G +   F +ICLSNI LN +S   N PW CS++ G +  V P 
Sbjct  371  TIEDVIGENITKAGLIEGIEGDNFVNICLSNITLNVSS---NYPWNCSNIRGYSDMVFPE  427

Query  167  PCSEL  153
             C  L
Sbjct  428  ACEPL  432



>gb|KHN14175.1| Putative polygalacturonase [Glycine soja]
Length=489

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 117/194 (60%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I I R+ G +  SGI++GSE  GG+ +V AE I  Y+
Sbjct  273  DDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGRTQTSGIAIGSEMSGGVSEVHAEDIQFYD  332

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
                I IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ +NPNALP++  I 
Sbjct  333  SYNAIRIKTSPGRGGYVRNIYVSNVTLANVDIAITFTGLYGEHPDDAYNPNALPVIEKIT  392

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ +   G I G +   F +ICLSNI LN  S   N PW CS V G +  V P  
Sbjct  393  IKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQPEA  449

Query  164  CSELAXNHRYGACS  123
            C  L      G CS
Sbjct  450  CEPLKERIFPGHCS  463



>ref|XP_010649560.1| PREDICTED: probable polygalacturonase, partial [Vitis vinifera]
Length=285

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 115/181 (64%), Gaps = 2/181 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVT-GSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +++KSGWDEYGIAYGRP   + IRRV   SS  S ++ GSE  GGI +V  E ++LYN
Sbjct  78   DAIALKSGWDEYGIAYGRPTTNVHIRRVNLQSSSGSSLAFGSEMSGGISNVCVEQVHLYN  137

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG I+ I +S+V MEN  T     G +G HPD+ F+PNALP++  I 
Sbjct  138  SFSGIEFRTTKGRGGYIQEIIISDVAMENIHTAFSATGQIGSHPDDHFDPNALPVLDHIT  197

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +Q+V G  ++  G   G ++SPFT ICLSNI L+  + P +  W CS+V G +  V P P
Sbjct  198  LQNVIGTNITIAGSFTGIQESPFTSICLSNISLS-TTPPASISWVCSNVSGFSQWVFPEP  256

Query  164  C  162
            C
Sbjct  257  C  257



>gb|KEH24447.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 120/185 (65%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFS-GISVGSETXGGIVDVLAEHINLY  528
            DD +++KSGWDEYGIA+GRP   I I R+ G +  S GI++GSE  GG+ DV AE I+ Y
Sbjct  251  DDLIAIKSGWDEYGIAFGRPSTNIVIHRLVGKTHTSAGIAIGSEMSGGVSDVRAEDIHFY  310

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            +    I IKT+ GRGG +RNI V+N+ + N    I+  G  GDHPD+ ++PNALP++  I
Sbjct  311  DSYTAIRIKTSPGRGGYVRNIYVTNMTLANVDIAIRFTGSYGDHPDDAYDPNALPVIEKI  370

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             I+DV G+ +++ G I G +   F +ICLSNI LN +S   N PW CS++ G +  V P 
Sbjct  371  TIEDVIGENITKAGLIEGIEGDNFVNICLSNITLNVSS---NYPWNCSNIRGYSDMVFPE  427

Query  167  PCSEL  153
             C  L
Sbjct  428  ACEPL  432



>gb|KJB34666.1| hypothetical protein B456_006G077400 [Gossypium raimondii]
Length=312

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 121/193 (63%), Gaps = 3/193 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D ++ KSGWDEYGIAYGRP     +RRV   SS  S ++ GSE  GGI D+L E ++LY+
Sbjct  108  DAIAFKSGWDEYGIAYGRPTTIAHVRRVDLRSSTGSSLAFGSEMSGGISDILVEEVHLYD  167

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T IGRGG I+ I +S+V + N  T     GD G HPD++F+P+A P++  I 
Sbjct  168  SLTGIEFRTTIGRGGYIKEIMISDVDLLNVNTSFAAIGDYGSHPDDKFDPDAFPVLEKIT  227

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +Q++ G  ++  G  +G ++SPFT ICLSNI L+  S+  + PW+CS V G +  V P P
Sbjct  228  LQNIIGTNITIAGNFKGIEESPFTFICLSNISLSINSTSLS-PWQCSYVSGFSESVFPEP  286

Query  164  CSELAXNHRYGAC  126
            C EL  N    +C
Sbjct  287  CPELM-NSSTSSC  298



>ref|XP_004487815.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=454

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 122/186 (66%), Gaps = 6/186 (3%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYG+ YGRP   + IRRV   + FSG  +S GSE  GGI +VL EH+ ++
Sbjct  246  DAISLKSGWDEYGLTYGRPTEKVHIRRVHLHA-FSGSALSFGSEMSGGISNVLVEHVKIF  304

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG I+ I +SN+ MEN  T I   GD G HPD++F+P A P+++ I
Sbjct  305  NSNSGIEFRTTKGRGGYIKEIAISNIEMENVYTAIGAKGDCGSHPDDKFDPKAFPLLNHI  364

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++D+ GK ++  G   G K+SPFT+ICLSN+ L+  + SP    W+CS+V G +  V P
Sbjct  365  TLKDIIGKNITIAGSFEGIKESPFTNICLSNVTLSTNNVSPIT--WECSNVSGFSDSVLP  422

Query  170  WPCSEL  153
             PC EL
Sbjct  423  EPCQEL  428



>gb|KEH37171.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=387

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 123/185 (66%), Gaps = 4/185 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWD+YGI YGRP   + IRRV   + F+G  IS G+E  GGI  VL EH+N++
Sbjct  181  DAISLKSGWDQYGINYGRPSEKVHIRRVHLRA-FTGSAISFGTEMSGGISKVLIEHVNIF  239

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG I+ I +S++ MEN  T I   G+ G HPD++F+P ALP++  I
Sbjct  240  NSNSGIEFRTTKGRGGYIKEIALSHIEMENVHTAISAKGNSGSHPDDKFDPKALPLLDHI  299

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             ++D+ GK ++  G + G ++SPFT+ICLSNI L+  +S  +  W+CS+V G +  V P 
Sbjct  300  TLKDITGKNITIAGSLSGIEESPFTNICLSNITLS-TNSVSSSKWECSNVSGFSDSVLPK  358

Query  167  PCSEL  153
            PC EL
Sbjct  359  PCQEL  363



>ref|XP_009624502.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=603

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+YG+P   + IR V   SS  S ++ GSE  GGI +VL EHI+L++
Sbjct  397  DAVVLKSGWDEYGISYGKPTSNVHIRGVRLQSSAGSAVAFGSEMSGGISNVLVEHISLHD  456

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG IR+I + NV MEN + GI+  G    HPD +++P++LP+VSGI 
Sbjct  457  SLFGIDLKTARGRGGYIRDILIMNVVMENVQVGIRATGYYDSHPDEKYDPSSLPVVSGIT  516

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  +S  G   G  +SPFT ICLSNI  + +S P + PW CSDV G++  V P P
Sbjct  517  FKDIVGTNISIAGNFTGLSESPFTSICLSNISFSISSDP-STPWLCSDVSGSSENVFPEP  575

Query  164  CSEL  153
            C EL
Sbjct  576  CPEL  579



>ref|XP_011040145.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=469

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 117/184 (64%), Gaps = 3/184 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG++YGRP   I IRR+ G +  +GI++GSE  GG+ +V AE++  YN
Sbjct  251  DDIIAIKSGWDEYGMSYGRPSKNITIRRLVGQTTSAGIAIGSEMSGGVSEVHAENLRFYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT+ GRGG +RNI +SN+ + + +T I+  G  G+HPD  ++P ALP++  I 
Sbjct  311  STTGIRIKTSPGRGGYVRNIYISNMSLTDVKTAIRFTGQYGEHPDESYDPKALPLIERIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I DV G+ V   G + G +   F  ICLSNI+L+  S     PW CS + G +  VSP  
Sbjct  371  IDDVTGQNVKYAGLLEGLEGDTFLDICLSNINLSVTS---KSPWNCSYIQGYSEAVSPEI  427

Query  164  CSEL  153
            C  L
Sbjct  428  CEPL  431



>emb|CDP17099.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +++KSGWDEYGIAYG+P   + IR +   S   SG++ GSE  GGI ++L EH++++N
Sbjct  257  DAITLKSGWDEYGIAYGKPTTNVHIRGIRLQSGTGSGVAFGSEMSGGISNILVEHLDIHN  316

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              VGI +KT+IGRGG I+ I +S+V MEN + G+K  G    HPD++F+P ALP +S I 
Sbjct  317  SFVGIELKTSIGRGGYIKYILISDVIMENVQIGLKATGQCDSHPDDKFDPLALPTISAIT  376

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  ++  G   G  +SPFT +CLSNI  +  S P +  W CS V G++  VSP P
Sbjct  377  FEDIRGTNITVAGSFTGINESPFTSLCLSNISFSVTSDP-SASWICSSVSGSSDNVSPEP  435

Query  164  CSEL  153
            C +L
Sbjct  436  CPDL  439



>gb|KJB34667.1| hypothetical protein B456_006G077400 [Gossypium raimondii]
Length=320

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 121/193 (63%), Gaps = 3/193 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D ++ KSGWDEYGIAYGRP     +RRV   SS  S ++ GSE  GGI D+L E ++LY+
Sbjct  116  DAIAFKSGWDEYGIAYGRPTTIAHVRRVDLRSSTGSSLAFGSEMSGGISDILVEEVHLYD  175

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T IGRGG I+ I +S+V + N  T     GD G HPD++F+P+A P++  I 
Sbjct  176  SLTGIEFRTTIGRGGYIKEIMISDVDLLNVNTSFAAIGDYGSHPDDKFDPDAFPVLEKIT  235

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +Q++ G  ++  G  +G ++SPFT ICLSNI L+  S+  + PW+CS V G +  V P P
Sbjct  236  LQNIIGTNITIAGNFKGIEESPFTFICLSNISLSINSTSLS-PWQCSYVSGFSESVFPEP  294

Query  164  CSELAXNHRYGAC  126
            C EL  N    +C
Sbjct  295  CPELM-NSSTSSC  306



>ref|XP_010094123.1| putative polygalacturonase [Morus notabilis]
 gb|EXC39742.1| putative polygalacturonase [Morus notabilis]
Length=476

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 122/189 (65%), Gaps = 4/189 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +S+KSGWDEYGI YGRP   I IRRV   +S  + I+ GSE  GGI +VL EH++LYN
Sbjct  270  DSISLKSGWDEYGIDYGRPTKNIHIRRVDLRASSGASIAFGSEMSGGISNVLVEHVHLYN  329

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               G+  +T  GRGG I NI +S+V M+N    +   G  G HPD++F+P+ALP++  I 
Sbjct  330  SHSGVEFRTTKGRGGYIENILISDVVMKNVYKALGACGQCGSHPDDKFDPSALPVLDHIT  389

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLN-GASSPRNPPWKCSDVHGAAIQVSPW  168
            IQ+V+G  ++  G   G K+SPFT ICL  I L+  + SP   PW+CSDV G++  V P 
Sbjct  390  IQNVFGTNITIAGSFVGIKESPFTSICLFKISLSINSGSPT--PWECSDVSGSSESVLPE  447

Query  167  PCSELAXNH  141
            PC EL  ++
Sbjct  448  PCPELKNSY  456



>ref|XP_006584015.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=394

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +S+KSGWDEYGIAYGRP   + IRRV   +S  S I+ GS+  GGI ++L E+++LYN
Sbjct  193  DAISLKSGWDEYGIAYGRPTENVHIRRVHLQASSGSTIAFGSDMSGGISNILVENVHLYN  252

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG ++ I +S++ MEN  T I   G  G HPD++F+PNALP++  I 
Sbjct  253  SKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAIAATGYCGSHPDDKFDPNALPLLDHII  312

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +QD+ G  ++  G   G ++SPFT+ICLSNI L+  +S  + PW+CS+V G +  V P P
Sbjct  313  LQDMIGTNITIAGSFAGLQESPFTNICLSNITLS-TNSVSSIPWECSNVSGFSDYVLPKP  371

Query  164  CSEL  153
            C +L
Sbjct  372  CPDL  375



>ref|XP_006355845.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=457

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 121/184 (66%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+YG+P   + +R V   S   +G++ GSE  GGI +VL EH+ L++
Sbjct  250  DAVVLKSGWDEYGISYGKPTSNVHVRGVRLQSFAGAGMAFGSEMSGGISNVLVEHVYLHD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              +GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VS I 
Sbjct  310  SLLGIELKTARGRGGYIKDIQVTDVVMANVQVGIEATGHCDSHPDEKFDPSALPVVSDIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  VS  G   G  +SPFT ICLSNI  + +S+P   PW CSD+ G++  VSP P
Sbjct  370  FEDIVGTNVSIAGNFTGLSESPFTSICLSNITFSISSNPFT-PWLCSDISGSSQNVSPEP  428

Query  164  CSEL  153
            C EL
Sbjct  429  CPEL  432



>gb|KHN14635.1| Putative polygalacturonase [Glycine soja]
Length=366

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + FSG  ++ GS+  GGI +VL EH +L+
Sbjct  160  DAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAHLF  218

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP +  I
Sbjct  219  NSKSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLDHI  278

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++DV G  +S  G I G ++SPFT+ICLSNI L+  S SP    W+CS+V G +  V P
Sbjct  279  TLKDVTGTNISIAGNIAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFSDSVLP  336

Query  170  WPCSELAXNHRYGACSATL  114
             PC EL  N  Y + S+  
Sbjct  337  EPCPELG-NPSYDSSSSCF  354



>ref|XP_006604763.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=468

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I I R+ G +  SGI++GSE  GG+ +V AE I  Y+
Sbjct  251  DDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGKTQTSGIAIGSEMSGGVSEVHAEDIQFYD  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ ++PNALP++  + 
Sbjct  311  SYNGIRIKTSPGRGGYVRNIYVSNVSLANVDIAIWFTGSYGEHPDDAYDPNALPVIEKVT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ +   G I G +   F +ICLSNI LN  S   N PW CS V G +  V P  
Sbjct  371  IKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQPEA  427

Query  164  CSEL  153
            C  L
Sbjct  428  CEPL  431



>ref|XP_003554577.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=467

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 115/184 (63%), Gaps = 3/184 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I I R+ G +  SGI++GSE  GG+ +V AE I  Y+
Sbjct  251  DDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGKTQTSGIAIGSEMSGGVSEVHAEDIQFYD  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ ++PNALP++  + 
Sbjct  311  SYNGIRIKTSPGRGGYVRNIYVSNVSLANVDIAIWFTGSYGEHPDDAYDPNALPVIEKVT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ +   G I G +   F +ICLSNI LN  S   N PW CS V G +  V P  
Sbjct  371  IKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQPEA  427

Query  164  CSEL  153
            C  L
Sbjct  428  CEPL  431



>gb|KEH37170.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=452

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 123/185 (66%), Gaps = 4/185 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWD+YGI YGRP   + IRRV   + F+G  IS G+E  GGI  VL EH+N++
Sbjct  246  DAISLKSGWDQYGINYGRPSEKVHIRRVHLRA-FTGSAISFGTEMSGGISKVLIEHVNIF  304

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG I+ I +S++ MEN  T I   G+ G HPD++F+P ALP++  I
Sbjct  305  NSNSGIEFRTTKGRGGYIKEIALSHIEMENVHTAISAKGNSGSHPDDKFDPKALPLLDHI  364

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             ++D+ GK ++  G + G ++SPFT+ICLSNI L+  +S  +  W+CS+V G +  V P 
Sbjct  365  TLKDITGKNITIAGSLSGIEESPFTNICLSNITLS-TNSVSSSKWECSNVSGFSDSVLPK  423

Query  167  PCSEL  153
            PC EL
Sbjct  424  PCQEL  428



>ref|XP_011005969.1| PREDICTED: probable polygalacturonase [Populus euphratica]
 ref|XP_011005971.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=465

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 117/184 (64%), Gaps = 3/184 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG++YGRP   I IRR+ G +  +GI++GSE  GG+ +V AE++  YN
Sbjct  251  DDIIAIKSGWDEYGMSYGRPSKNITIRRLVGQTTSAGIAIGSEMSGGVSEVHAENLRFYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT+ GRGG +RNI +SN+ + + +T I   G  G+HPD  ++P ALP++  I 
Sbjct  311  STTGIRIKTSPGRGGYVRNIYISNMSLTDVKTAISFTGRYGEHPDEYYDPTALPLIERIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ V   G + G +   F  ICLSNI+L+  S     PW CS + G +  VSP  
Sbjct  371  IEDVAGQNVKYAGLLEGIEGDTFLDICLSNINLSVTS---KSPWNCSYIQGYSDTVSPEI  427

Query  164  CSEL  153
            C  L
Sbjct  428  CEPL  431



>gb|KDP28345.1| hypothetical protein JCGZ_14116 [Jatropha curcas]
Length=466

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 117/185 (63%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFS-GISVGSETXGGIVDVLAEHINLY  528
            DD +++KSGWDEYGI+YGRP   I IRR+ G +  S G+S+GSE  GG+ +V AE++  Y
Sbjct  251  DDLIAIKSGWDEYGISYGRPCRNIIIRRLIGQTRSSAGLSIGSEMSGGVSEVHAENLQFY  310

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG +RNI VSN+ + + +  I+  G  G+HPD  ++P ALPIV  I
Sbjct  311  NSSTGIRIKTSPGRGGYVRNIHVSNITLIDVKIAIRFTGLYGEHPDEHYDPAALPIVERI  370

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             I+DV G+ +   G + G +   F  ICLSNI LN  S   N PW CS V G +  VSP 
Sbjct  371  TIEDVTGENIEYAGILDGIQADAFLDICLSNITLNVTS---NSPWNCSYVQGYSDSVSPE  427

Query  167  PCSEL  153
             C  L
Sbjct  428  TCEPL  432



>ref|XP_004240577.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=457

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 119/184 (65%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D V +KSGWDEYGI+YG+P   + +R V   S   +G++ GSE  GGI +VL EH+ LY+
Sbjct  250  DAVVLKSGWDEYGISYGKPTSNVHVRGVRLQSFAGAGMAFGSEMSGGISNVLIEHVYLYD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              +GI +KT  GRGG I++I V++V M N + GI+  G    HPD +F+P+ALP+VSGI 
Sbjct  310  SLLGIELKTARGRGGYIKDILVTDVVMANVQVGIEATGHYDSHPDEKFDPSALPVVSGIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  VS  G   G  +SPFT ICLSNI  + + +P    W CSDV G +  VSP P
Sbjct  370  FEDIVGTNVSIAGNFTGLSESPFTSICLSNITFSISYNPFT-SWLCSDVSGFSQNVSPEP  428

Query  164  CSEL  153
            C EL
Sbjct  429  CPEL  432



>ref|XP_003528627.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=449

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +S+KSGWDEYGIAYGRP   + IRRV   +S  S I+ GS+  GGI ++L E+++LYN
Sbjct  248  DAISLKSGWDEYGIAYGRPTENVHIRRVHLQASSGSTIAFGSDMSGGISNILVENVHLYN  307

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG ++ I +S++ MEN  T I   G  G HPD++F+PNALP++  I 
Sbjct  308  SKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAIAATGYCGSHPDDKFDPNALPLLDHII  367

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +QD+ G  ++  G   G ++SPFT+ICLSNI L+  +S  + PW+CS+V G +  V P P
Sbjct  368  LQDMIGTNITIAGSFAGLQESPFTNICLSNITLS-TNSVSSIPWECSNVSGFSDYVLPKP  426

Query  164  CSEL  153
            C +L
Sbjct  427  CPDL  430



>gb|KHN02933.1| Putative polygalacturonase [Glycine soja]
Length=449

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 123/184 (67%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +S+KSGWDEYGIAYGRP   + IRRV   +S  S I+ GS+  GGI ++L E+++LYN
Sbjct  248  DAISLKSGWDEYGIAYGRPTENVHIRRVHLQASSGSTIAFGSDMSGGISNILVENVHLYN  307

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG ++ I +S++ MEN  T I   G  G HPD++F+PNALP++  I 
Sbjct  308  SKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAIAATGYCGSHPDDKFDPNALPLLDHII  367

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +QD+ G  ++  G   G ++SPFT+ICLSNI L+  +S  + PW+CS+V G +  V P P
Sbjct  368  LQDMIGTNITIAGSFAGLQESPFTNICLSNITLS-TNSVSSIPWECSNVSGFSDYVLPKP  426

Query  164  CSEL  153
            C +L
Sbjct  427  CPDL  430



>ref|XP_007138953.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
 gb|ESW10947.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
Length=452

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 123/186 (66%), Gaps = 6/186 (3%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + FSG  ++ GS+  GGI +VL EH +L 
Sbjct  246  DAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAHLL  304

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
                GI  +T  GRGG +++I +S++ MEN  T I   G+ G HPD++F+PNALP++  I
Sbjct  305  KSNSGIEFRTTRGRGGYMKDIVISDIQMENVHTAIAATGNCGSHPDDKFDPNALPLLDHI  364

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++DV GK ++  G   G ++SPFT+ICLSNI L+  S SP    W+CS+V G A  V P
Sbjct  365  TLRDVTGKNITIAGNFAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFADSVLP  422

Query  170  WPCSEL  153
             PC EL
Sbjct  423  EPCPEL  428



>gb|KHN43408.1| Putative polygalacturonase [Glycine soja]
Length=563

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 117/194 (60%), Gaps = 3/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGIAYGRP   I I R+ G +  SGI++GSE  GG+ +V AE I  Y+
Sbjct  349  DDLIAIKSGWDEYGIAYGRPSTNIIIHRLVGKTQTSGIAIGSEMSGGVSEVHAEDIQFYD  408

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT+ GRGG +RNI VSNV + N    I   G  G+HPD+ ++PNALP++  + 
Sbjct  409  SYNGIRIKTSPGRGGYVRNIYVSNVSLANVDIAIWFTGSYGEHPDDAYDPNALPVIEKVT  468

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I+DV G+ +   G I G +   F +ICLSNI LN  S   N PW CS V G +  V P  
Sbjct  469  IKDVVGENIKTAGLIEGIEGDNFVNICLSNIILNVTS---NYPWNCSYVKGYSDLVQPEA  525

Query  164  CSELAXNHRYGACS  123
            C  L        CS
Sbjct  526  CEPLKERIFPDHCS  539



>ref|XP_006597720.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=452

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + FSG  ++ GS+  GGI +VL EH +L+
Sbjct  246  DAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAHLF  304

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP +  I
Sbjct  305  NSKSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLDHI  364

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++DV G  +S  G I G ++SPFT+ICLSNI L+  S SP    W+CS+V G +  V P
Sbjct  365  TLKDVTGTNISIAGNIAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFSDSVLP  422

Query  170  WPCSELAXNHRYGACSATL  114
             PC EL  N  Y + S+  
Sbjct  423  EPCPELG-NPSYDSSSSCF  440



>ref|XP_010909275.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
 ref|XP_010909282.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=438

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 121/185 (65%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLY  528
            DD ++VKSGWDEYGI++  P   I IRR+TG +   +GI+ GSE  GG+ +V AE I+L+
Sbjct  221  DDLIAVKSGWDEYGISFAHPSSNISIRRITGETKLGAGIAFGSEMSGGVSEVWAEDIHLF  280

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG IRNI +S+V M+N    I+I G  G+HPD +++PNALPI++ I
Sbjct  281  NSKHGIRIKTSPGRGGYIRNIYISDVIMKNVDIAIRIQGQYGEHPDEKYDPNALPIINRI  340

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             I++V G  +   G + G     F++ICLSNI LN  +SP   PW CS V G +  VSP 
Sbjct  341  TIKNVAGANIRLAGLLEGIHGDNFSNICLSNIILN-VTSPH--PWNCSYVEGYSNMVSPE  397

Query  167  PCSEL  153
             C  L
Sbjct  398  SCEPL  402



>ref|XP_006597719.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=471

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 128/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + FSG  ++ GS+  GGI +VL EH +L+
Sbjct  265  DAISLKSGWDEYGIAYGRPTENVHIRRVHLHA-FSGSALAFGSDMSGGISNVLVEHAHLF  323

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP +  I
Sbjct  324  NSKSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLDHI  383

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++DV G  +S  G I G ++SPFT+ICLSNI L+  S SP    W+CS+V G +  V P
Sbjct  384  TLKDVTGTNISIAGNIAGIEESPFTNICLSNITLSTNSVSPIT--WECSNVSGFSDSVLP  441

Query  170  WPCSELAXNHRYGACSATL  114
             PC EL  N  Y + S+  
Sbjct  442  EPCPELG-NPSYDSSSSCF  459



>ref|XP_008780530.1| PREDICTED: probable polygalacturonase, partial [Phoenix dactylifera]
Length=213

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 119/185 (64%), Gaps = 1/185 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG-ISVGSETXGGIVDVLAEHINLY  528
            DD +++KSGWDEYGIA+  P   + IRR+T  SPFS  I++GSE  GGI DV AE+I   
Sbjct  24   DDCIAIKSGWDEYGIAFNMPTQHVNIRRLTCISPFSATIALGSEMSGGIQDVRAENITAI  83

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   G+ IKT +GRGG +++I V  + +   +    ++G+ G HPD++++PNA+P+V  I
Sbjct  84   NTESGVRIKTAVGRGGFVKDIFVRGMTLNTMKYVFWMSGNYGQHPDDKYDPNAIPVVRNI  143

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
            +  +V  + V+  G + G   +PFT ICLSN+ ++ A S +   W C+++ G A  V+P 
Sbjct  144  RYSNVVAENVTIAGHLEGIPGAPFTGICLSNVTIDVAHSKKKLKWNCTEIEGVASAVTPT  203

Query  167  PCSEL  153
            PC+ L
Sbjct  204  PCALL  208



>ref|XP_010909269.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=467

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 121/185 (65%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLY  528
            DD ++VKSGWDEYGI++  P   I IRR+TG +   +GI+ GSE  GG+ +V AE I+L+
Sbjct  250  DDLIAVKSGWDEYGISFAHPSSNISIRRITGETKLGAGIAFGSEMSGGVSEVWAEDIHLF  309

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG IRNI +S+V M+N    I+I G  G+HPD +++PNALPI++ I
Sbjct  310  NSKHGIRIKTSPGRGGYIRNIYISDVIMKNVDIAIRIQGQYGEHPDEKYDPNALPIINRI  369

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             I++V G  +   G + G     F++ICLSNI LN  +SP   PW CS V G +  VSP 
Sbjct  370  TIKNVAGANIRLAGLLEGIHGDNFSNICLSNIILN-VTSPH--PWNCSYVEGYSNMVSPE  426

Query  167  PCSEL  153
             C  L
Sbjct  427  SCEPL  431



>ref|XP_009387922.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 118/194 (61%), Gaps = 4/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLY  528
            DD + +KSGWDEYGI+Y  P   I IRR+ G +   +GI+ GSE  GGI DV AE I+L+
Sbjct  251  DDLIVIKSGWDEYGISYAHPSSNISIRRIVGEAKSGAGIAFGSEMSGGISDVEAEDISLF  310

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG ++ I +SNV + N    I I G  G+HPD  F+PNALPI+  I
Sbjct  311  NSLYGIRIKTSPGRGGYVQYIHISNVVLNNVNIAIGITGQYGEHPDENFDPNALPIIKMI  370

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             ++D+ G  +   G + G +   F+ ICL N+HLN  SS    PW+CS + G++  VSP 
Sbjct  371  TLEDIKGTNIKHAGTLEGIQGDNFSSICLFNVHLNVTSS---SPWQCSYIQGSSNLVSPE  427

Query  167  PCSELAXNHRYGAC  126
             C  L   ++   C
Sbjct  428  SCEPLRNPYQTSVC  441



>ref|XP_010544930.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=261

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 113/179 (63%), Gaps = 2/179 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTG-SSPFSGISVGSETXGGIVDVLAEHINLY  528
            DD VS+KSGWDEYGI+Y RP   I I R+TG ++  SGI++GSE  GG+ ++  E ++LY
Sbjct  43   DDLVSIKSGWDEYGISYARPSTRIKISRLTGQTTSSSGIAIGSEMSGGVSEIHVEDVHLY  102

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG +RN+ VSNV +EN    I+  G  G+HPD +++P A P++  I
Sbjct  103  NSKTGIRIKTSPGRGGYVRNVYVSNVKLENVSIAIRFTGQYGEHPDGKYDPKAFPLIEKI  162

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  171
              ++  G  +   G  +G +   F +ICL N+ L   SS R  PWKCS V G +  VSP
Sbjct  163  TFENFTGDSIGVAGLFQGIEGDEFKNICLVNVSLQVKSS-RKSPWKCSYVRGYSQWVSP  220



>ref|XP_010465709.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=452

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 123/184 (67%), Gaps = 5/184 (3%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLYN  525
            D VS+KSGWD+YGI YGRP   + IR ++  SP  +GIS GSE  GGI DV  EH+N++ 
Sbjct  249  DAVSLKSGWDQYGINYGRPTTAVHIRNLSLKSPTGAGISFGSEMSGGISDVTVEHLNIHG  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              VGI  +T  GRGG IRNIT+S++ + +  T I  +G +G HPD++F+ +ALP+V+ I 
Sbjct  309  SLVGIAFRTTRGRGGYIRNITISSIDLSSVDTAIFASGHIGSHPDDKFDRDALPVVTHIS  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++ G+ +   G I G  ++PFT ICL++IHL      R+  W CS+V G +  V+P P
Sbjct  369  MRNITGQDIGLAGNITGIGEAPFTSICLADIHLQ----TRSDSWVCSNVSGFSDDVTPEP  424

Query  164  CSEL  153
            CSEL
Sbjct  425  CSEL  428



>ref|XP_009412155.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 120/194 (62%), Gaps = 4/194 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTG-SSPFSGISVGSETXGGIVDVLAEHINLY  528
            DD + +KSGWDEYGI++ RP   I IR + G ++  +GI++GSE  GGI +V AE I L+
Sbjct  254  DDLIVIKSGWDEYGISFARPSSNISIRHIVGEANSGAGIALGSEMSGGISNVRAEDICLF  313

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG +R+I +SNV M N +T I I G  G+HPD  ++PNALP++  I
Sbjct  314  NSLYGIRIKTSPGRGGYVRHIHISNVIMTNVKTAIGITGRYGEHPDENYDPNALPVIDMI  373

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             I+DV G  +   G + G K   F  ICLSN+HLN  S     PWKCS + G +  V+P 
Sbjct  374  TIEDVSGTVIKHAGTLEGIKGDNFNSICLSNVHLNVTS---KHPWKCSYIEGFSNLVTPE  430

Query  167  PCSELAXNHRYGAC  126
             C  L   ++   C
Sbjct  431  LCESLRNPYQSSVC  444



>ref|XP_010487555.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=452

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 123/184 (67%), Gaps = 5/184 (3%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLYN  525
            D VS+KSGWD+YGI YGRP   + IR ++  SP  +GIS GSE  GGI DV  EH+N+++
Sbjct  249  DAVSLKSGWDQYGINYGRPTTAVHIRNLSLKSPTGAGISFGSEMSGGISDVTVEHLNIHS  308

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              VGI  +T  GRGG IRNIT+S+V + +  T I  +G +G HPD++F+ +ALP+V+ I 
Sbjct  309  SLVGIAFRTTRGRGGYIRNITISSVDLSSVDTAIFASGHIGSHPDDKFDRDALPVVTHIT  368

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            ++++ G+ +   G I G   +PFT ICL++IHL      R+  W CS+V G +  V+P P
Sbjct  369  MRNITGEDIGLAGNITGIGGAPFTSICLADIHLQ----TRSDSWVCSNVSGFSDDVTPEP  424

Query  164  CSEL  153
            CSEL
Sbjct  425  CSEL  428



>ref|XP_003533248.1| PREDICTED: probable polygalacturonase isoform X1 [Glycine max]
Length=452

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + FSG  ++ GS+  GGI +VL EH +L+
Sbjct  246  DAISLKSGWDEYGIAYGRPTENVHIRRVQLHA-FSGSALAFGSDMSGGISNVLVEHAHLF  304

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP +  I
Sbjct  305  NSNSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLDHI  364

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++DV G  ++  G + G  +SPFT+ICLSNI L+  S SP    W CS+V G +  V P
Sbjct  365  TLKDVIGTNITIAGNLAGIDESPFTNICLSNITLSTNSVSPIT--WACSNVSGFSDSVLP  422

Query  170  WPCSELAXNHRYGACSATL  114
             PC EL  N  Y + S+  
Sbjct  423  EPCPELG-NTSYDSSSSCF  440



>ref|XP_011463918.1| PREDICTED: probable polygalacturonase isoform X2 [Fragaria vesca 
subsp. vesca]
Length=467

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 122/215 (57%), Gaps = 3/215 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG-ISVGSETXGGIVDVLAEHINLY  528
            DD ++VKSGWDEYGIA+G P   + IRR+T  SPFS  I++GSE  GGI DV AE I   
Sbjct  248  DDCIAVKSGWDEYGIAFGMPTKALVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIFAI  307

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N    + IKT +GRGG +++I V  + M   +    IAGD G H DN ++PNALP++  I
Sbjct  308  NTESAVRIKTAVGRGGFVKDIYVRRMTMHTMKYVFWIAGDYGSHADNGYDPNALPVIQNI  367

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
               D+  + V+  G + G    PFT IC+SN+ +  A   +  PW C+DV G +  V P 
Sbjct  368  NYHDMVAENVTMAGKLGGLTGDPFTGICISNVTITMAKKGKKVPWNCTDVAGISSGVVPQ  427

Query  167  PCSELAXN--HRYGACSATL*PAKVDS*TAHLLLY  69
            PC  LA     + GAC+       VD+    L  Y
Sbjct  428  PCELLADQGPEKIGACNFPEESLPVDNMQVQLCTY  462



>gb|ABG34277.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=242

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 110/185 (59%), Gaps = 1/185 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG-ISVGSETXGGIVDVLAEHINLY  528
            DD V+VKSGWDEYGIA+G P   + IRR+T  SP+S  I++GSE  GGI DV AE I   
Sbjct  23   DDCVAVKSGWDEYGIAFGMPTQQLIIRRLTCISPYSATIALGSEMSGGIRDVRAEDIVAI  82

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT +GRG  I++I V  + M   +   K+ GD   HPDN+++PNALP++  I
Sbjct  83   NTESGIRIKTAVGRGAYIKDIYVKKMTMHTMKWAFKMDGDYKSHPDNKYDPNALPVIQNI  142

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
              +D+  + VS      G     FT IC++N+ L   +  +  PW C+DV G    V+P 
Sbjct  143  NYRDMVAENVSVAARFNGIAGDKFTGICMANVTLGMTAKHKKYPWTCTDVQGMTSGVTPP  202

Query  167  PCSEL  153
            PC  L
Sbjct  203  PCDSL  207



>gb|KEH43186.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=406

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 120/184 (65%), Gaps = 3/184 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGI++GRP   I I R+TG +  +GI++GSE  GG+ +V AE I +++
Sbjct  186  DDLISIKSGWDEYGISFGRPSTNISIHRLTGRTTSAGIAIGSEMSGGVSEVYAEDIYIFD  245

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
                I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++ +ALP++  I 
Sbjct  246  SKSAIRIKTSPGRGGYVRNVYISNMTLINVDIAIRFTGLYGEHPDDSYDRDALPVIERIT  305

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            + +V G+ + + G I+G K   F  ICLSNI LN +   +N PW CSDV G +  VSP  
Sbjct  306  VVNVIGENIKRAGLIQGIKGDNFVDICLSNITLNVS---KNNPWNCSDVKGYSELVSPES  362

Query  164  CSEL  153
            C +L
Sbjct  363  CEQL  366



>gb|AFG59706.1| hypothetical protein 0_17434_01, partial [Pinus taeda]
 gb|AFG59708.1| hypothetical protein 0_17434_01, partial [Pinus taeda]
 gb|AFG59709.1| hypothetical protein 0_17434_01, partial [Pinus taeda]
 gb|AFG59710.1| hypothetical protein 0_17434_01, partial [Pinus taeda]
Length=138

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGI++ RP   I +RR+T S+PFSGI++GSET GGI D+L E+I++Y+
Sbjct  9    DDGIAIKSGWDEYGISFNRPSSNIIVRRITISTPFSGIAIGSETSGGIRDILVENISIYS  68

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              VGI +KTN+GRGG IRNIT S++Y++N  TGIK +G+ GDHPD R+NP ALP+V  I 
Sbjct  69   STVGIRVKTNVGRGGIIRNITFSHIYLDNVGTGIKFSGNTGDHPDARYNPMALPVVGDIA  128

Query  344  IQDVWGKKV  318
            + DV G  +
Sbjct  129  VLDVVGSSI  137



>emb|CBI36899.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 123/197 (62%), Gaps = 4/197 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D + +KSGWDEYGIAYG+P   + IRRV   SS  SG++ GSE  GGI D+L EHI+L +
Sbjct  271  DAIVLKSGWDEYGIAYGKPTRNVHIRRVWLQSSSGSGLAFGSEMSGGISDILVEHIHLQD  330

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG I+ I +S+V MEN    I   G    HPD++++P ALP+V GI 
Sbjct  331  SSTGIKLKTTKGRGGYIKGILISDVEMENVGLTIGATGQCRSHPDDKYDPGALPVVDGIT  390

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  VS  G   G  +SPFT ICL NI L+  +S  + PW CS+V G++  VSP P
Sbjct  391  FKDMVGTNVSIAGNFSGIYESPFTSICLFNISLS-ITSNSSKPWLCSNVFGSSECVSPEP  449

Query  164  CSELA--XNHRYGACSA  120
            C  L    ++ +  CS+
Sbjct  450  CPNLQTKTSNSFSTCSS  466



>ref|XP_010652214.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=456

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 123/197 (62%), Gaps = 4/197 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D + +KSGWDEYGIAYG+P   + IRRV   SS  SG++ GSE  GGI D+L EHI+L +
Sbjct  250  DAIVLKSGWDEYGIAYGKPTRNVHIRRVWLQSSSGSGLAFGSEMSGGISDILVEHIHLQD  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI +KT  GRGG I+ I +S+V MEN    I   G    HPD++++P ALP+V GI 
Sbjct  310  SSTGIKLKTTKGRGGYIKGILISDVEMENVGLTIGATGQCRSHPDDKYDPGALPVVDGIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G  VS  G   G  +SPFT ICL NI L+  +S  + PW CS+V G++  VSP P
Sbjct  370  FKDMVGTNVSIAGNFSGIYESPFTSICLFNISLS-ITSNSSKPWLCSNVFGSSECVSPEP  428

Query  164  CSELA--XNHRYGACSA  120
            C  L    ++ +  CS+
Sbjct  429  CPNLQTKTSNSFSTCSS  445



>ref|XP_004298828.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
Length=503

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 122/215 (57%), Gaps = 3/215 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG-ISVGSETXGGIVDVLAEHINLY  528
            DD ++VKSGWDEYGIA+G P   + IRR+T  SPFS  I++GSE  GGI DV AE I   
Sbjct  284  DDCIAVKSGWDEYGIAFGMPTKALVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIFAI  343

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N    + IKT +GRGG +++I V  + M   +    IAGD G H DN ++PNALP++  I
Sbjct  344  NTESAVRIKTAVGRGGFVKDIYVRRMTMHTMKYVFWIAGDYGSHADNGYDPNALPVIQNI  403

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
               D+  + V+  G + G    PFT IC+SN+ +  A   +  PW C+DV G +  V P 
Sbjct  404  NYHDMVAENVTMAGKLGGLTGDPFTGICISNVTITMAKKGKKVPWNCTDVAGISSGVVPQ  463

Query  167  PCSELAXN--HRYGACSATL*PAKVDS*TAHLLLY  69
            PC  LA     + GAC+       VD+    L  Y
Sbjct  464  PCELLADQGPEKIGACNFPEESLPVDNMQVQLCTY  498



>gb|KHN26517.1| Putative polygalacturonase [Glycine soja]
Length=473

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + FSG  ++ GS+  GGI +VL EH +L+
Sbjct  267  DAISLKSGWDEYGIAYGRPTENVHIRRVQLHA-FSGSALAFGSDMSGGISNVLVEHAHLF  325

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP +  I
Sbjct  326  NSNSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLDHI  385

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++DV G  ++  G + G  +SPFT+ICLSNI L+  S SP    W CS+V G +  V P
Sbjct  386  TLKDVIGTNITIAGNLAGIDESPFTNICLSNITLSTNSVSPIT--WACSNVSGFSDSVLP  443

Query  170  WPCSELAXNHRYGACSATL  114
             PC EL  N  Y + S+  
Sbjct  444  EPCPELG-NTSYDSSSSCF  461



>ref|XP_008227776.1| PREDICTED: probable polygalacturonase [Prunus mume]
 ref|XP_008227777.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=467

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 116/185 (63%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFS-GISVGSETXGGIVDVLAEHINLY  528
            DD +++KSGWDEYGI+YGRP   I IRR+TG +  S GI++GSE  GG+ +V AE+++ +
Sbjct  252  DDLIAIKSGWDEYGISYGRPSRNIIIRRITGKTETSAGIAIGSEMSGGVSEVHAENLHFF  311

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG ++NI VSNV ++     I+     G+HPD  ++PNALPI+  I
Sbjct  312  NSKTGIRIKTSPGRGGYVKNIYVSNVTLDGIDIAIRFTSHYGEHPDEFYDPNALPIIEQI  371

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
              +DV GK +   G + G +   F  ICLSNI LN  S     PW CS + G +  VSP 
Sbjct  372  TFKDVVGKNIKTAGLLEGLEGDTFMDICLSNITLNVTS---KSPWICSSIQGYSDLVSPE  428

Query  167  PCSEL  153
             C  L
Sbjct  429  TCEPL  433



>gb|KJB34665.1| hypothetical protein B456_006G077400 [Gossypium raimondii]
Length=452

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 121/193 (63%), Gaps = 3/193 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D ++ KSGWDEYGIAYGRP     +RRV   SS  S ++ GSE  GGI D+L E ++LY+
Sbjct  248  DAIAFKSGWDEYGIAYGRPTTIAHVRRVDLRSSTGSSLAFGSEMSGGISDILVEEVHLYD  307

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T IGRGG I+ I +S+V + N  T     GD G HPD++F+P+A P++  I 
Sbjct  308  SLTGIEFRTTIGRGGYIKEIMISDVDLLNVNTSFAAIGDYGSHPDDKFDPDAFPVLEKIT  367

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +Q++ G  ++  G  +G ++SPFT ICLSNI L+  S+  + PW+CS V G +  V P P
Sbjct  368  LQNIIGTNITIAGNFKGIEESPFTFICLSNISLSINSTSLS-PWQCSYVSGFSESVFPEP  426

Query  164  CSELAXNHRYGAC  126
            C EL  N    +C
Sbjct  427  CPELM-NSSTSSC  438



>gb|ABG34275.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=238

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 113/185 (61%), Gaps = 1/185 (1%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG-ISVGSETXGGIVDVLAEHINLY  528
            DD V+VKSGWDEYGI+YG P   + IRR+T  SP+S  I++GSE  GGI DV AE I   
Sbjct  23   DDCVAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIALGSEMSGGIEDVRAEDITAI  82

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT +GRGG +++I V  + M   +    + G+ G HPD  ++P A PI++GI
Sbjct  83   NTESGIRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNYGSHPDPHYDPKARPIITGI  142

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
              +D+  + V+    ++G   +PFT IC+SN  +  A   +  PW CSD+HG    V+P 
Sbjct  143  NYRDIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESKKEPWTCSDIHGITSGVTPQ  202

Query  167  PCSEL  153
            PC  L
Sbjct  203  PCGML  207



>ref|XP_011467185.1| PREDICTED: probable polygalacturonase isoform X2 [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 121/208 (58%), Gaps = 7/208 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFS-GISVGSETXGGIVDVLAEHINLY  528
            DD +S+KSGWDEYGI+YGRP   I IR +TG S  S GIS+GSE  GG+ +V AE++  +
Sbjct  252  DDLISIKSGWDEYGISYGRPSRNILIRGITGKSQTSAGISIGSEMSGGVSEVHAENLQFF  311

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
                GI IKT+ GRGG +RNI VSN+ ++     I+     G+HPD  ++P+ALPI+  I
Sbjct  312  GSHTGIRIKTSPGRGGYVRNICVSNMTLDGVYIAIRFTSQYGEHPDEFYDPSALPIIEHI  371

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
              +DV G  +   G + G +   F +ICLSNI LN  S     PW CS +HG +  VSP 
Sbjct  372  TFKDVLGDNIKIAGLLEGLEGGSFQNICLSNIFLNVTS---KSPWNCSSIHGYSYLVSPE  428

Query  167  PCSELAXN---HRYGACSATL*PAKVDS  93
             C  L  +    +Y  C     P +  S
Sbjct  429  ICEPLKESISPEKYSDCYHLSDPKRFSS  456



>ref|XP_006841512.1| hypothetical protein AMTR_s00003p00141260 [Amborella trichopoda]
 gb|ERN03187.1| hypothetical protein AMTR_s00003p00141260 [Amborella trichopoda]
Length=471

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 122/189 (65%), Gaps = 4/189 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLY  528
            +D +++KSGWDEYGI+YG    G+  RR+   +P  S +++G+E  GGI D+L EH++++
Sbjct  265  NDAIALKSGWDEYGISYGASTSGVHARRLFLHAPMGSALALGTEMSGGISDILFEHLSIF  324

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   G+ + T  GRGG +R++ VSN+ MEN    ++  G+ G HPD+RFNP A P +S I
Sbjct  325  NSRKGLSVATTKGRGGFVRDVLVSNIEMENVEVALRFDGNCGAHPDDRFNPEAFPAISRI  384

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             ++++ G+K+   G + G +++PFT ICLSN+ L   S+  + PW CS+V G  + V P 
Sbjct  385  TVKNLVGQKIGLAGNLSGIEEAPFTAICLSNVSL---STNSDRPWACSNVVGYTLVVVPE  441

Query  167  PCSELAXNH  141
             C EL   +
Sbjct  442  ACQELETQY  450



>ref|XP_006586911.1| PREDICTED: probable polygalacturonase isoform X2 [Glycine max]
Length=472

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 126/199 (63%), Gaps = 7/199 (4%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + FSG  ++ GS+  GGI +VL EH +L+
Sbjct  266  DAISLKSGWDEYGIAYGRPTENVHIRRVQLHA-FSGSALAFGSDMSGGISNVLVEHAHLF  324

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG ++ I +S++ MEN  T I   G+ G HPD++F+PNALP +  I
Sbjct  325  NSNSGIEFRTTKGRGGYMKEIVMSDIQMENVHTAIAATGNCGSHPDDKFDPNALPHLDHI  384

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGAS-SPRNPPWKCSDVHGAAIQVSP  171
             ++DV G  ++  G + G  +SPFT+ICLSNI L+  S SP    W CS+V G +  V P
Sbjct  385  TLKDVIGTNITIAGNLAGIDESPFTNICLSNITLSTNSVSPIT--WACSNVSGFSDSVLP  442

Query  170  WPCSELAXNHRYGACSATL  114
             PC EL  N  Y + S+  
Sbjct  443  EPCPELG-NTSYDSSSSCF  460



>gb|KHG14610.1| putative polygalacturonase [Gossypium arboreum]
Length=452

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 117/184 (64%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRV-TGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D ++ KSGWDEYGIAYGRP     +RRV   SS  S ++ GSE  GGI D+L E ++LYN
Sbjct  248  DAIAFKSGWDEYGIAYGRPTTIAHVRRVDLRSSTGSSLAFGSEMSGGISDILVEEVHLYN  307

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG I+ I +S+V + N  T     GD G HPD++F+P+A P++  I 
Sbjct  308  SLTGIEFRTTTGRGGYIKEIMISDVDLLNVNTSFAAIGDYGSHPDDKFDPDAFPVLEKIT  367

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +Q++ G  ++  G  +G ++SPFT ICLSNI L+  S+  + PW+CS V G +  V P P
Sbjct  368  LQNIIGTNITIAGNFKGIEESPFTFICLSNISLSINSTSLS-PWQCSYVSGFSESVFPEP  426

Query  164  CSEL  153
            C EL
Sbjct  427  CPEL  430



>gb|KJB72747.1| hypothetical protein B456_011G194200 [Gossypium raimondii]
Length=454

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 126/200 (63%), Gaps = 4/200 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +++KSGWDEYGIAYGRP   + IRRV   S FSG  ++ GS+  GGI DV  + ++LY
Sbjct  250  DAIALKSGWDEYGIAYGRPTANVHIRRVQLQS-FSGSSLAFGSQMSGGISDVQVQQLHLY  308

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            +   GI  +T  GRGG I+ I +S+V M N +T     G  G HPD++F+P+ALP+V+ I
Sbjct  309  DSLTGIEFRTTKGRGGYIKEIAISDVNMLNIKTAFGANGHFGSHPDDKFDPDALPLVAKI  368

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             IQ++ G  +S  G   G ++SPFT ICLSN+ L+  S+  + PW+CS V G +  V P 
Sbjct  369  TIQNIIGTNISMAGNFTGIEESPFTSICLSNVSLSINSA-SSSPWQCSYVSGFSESVFPE  427

Query  167  PCSELAXNHRYGACSATL*P  108
            PCSEL       +C + L P
Sbjct  428  PCSELNNPDASSSCFSLLKP  447



>ref|XP_004288344.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
Length=466

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 121/208 (58%), Gaps = 7/208 (3%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFS-GISVGSETXGGIVDVLAEHINLY  528
            DD +S+KSGWDEYGI+YGRP   I IR +TG S  S GIS+GSE  GG+ +V AE++  +
Sbjct  261  DDLISIKSGWDEYGISYGRPSRNILIRGITGKSQTSAGISIGSEMSGGVSEVHAENLQFF  320

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
                GI IKT+ GRGG +RNI VSN+ ++     I+     G+HPD  ++P+ALPI+  I
Sbjct  321  GSHTGIRIKTSPGRGGYVRNICVSNMTLDGVYIAIRFTSQYGEHPDEFYDPSALPIIEHI  380

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
              +DV G  +   G + G +   F +ICLSNI LN  S     PW CS +HG +  VSP 
Sbjct  381  TFKDVLGDNIKIAGLLEGLEGGSFQNICLSNIFLNVTS---KSPWNCSSIHGYSYLVSPE  437

Query  167  PCSELAXN---HRYGACSATL*PAKVDS  93
             C  L  +    +Y  C     P +  S
Sbjct  438  ICEPLKESISPEKYSDCYHLSDPKRFSS  465



>ref|XP_002320934.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
 gb|EEE99249.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
Length=463

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 113/184 (61%), Gaps = 3/184 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG +Y RP   I IR + G +  +GI++GSE  GG+ +V AE++  YN
Sbjct  251  DDIIAIKSGWDEYGTSYARPSKNITIRGLVGQTTSAGIAIGSEMSGGVSEVHAENLTFYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT  GRGG +RNI +SN+ + + +T I+  G  GDHPD  ++P ALP++  I 
Sbjct  311  STTGIRIKTAPGRGGYVRNIYISNMSLTDVKTAIRFTGQYGDHPDESYDPKALPLIERIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            I DV G+ V   G + G +   F  ICLSNI+L+  S     PW CS + G +  VSP  
Sbjct  371  IDDVTGQNVKYAGLLEGLEGDTFLDICLSNINLSVTS---KSPWNCSYIQGYSEAVSPEI  427

Query  164  CSEL  153
            C  L
Sbjct  428  CEPL  431



>ref|XP_007221479.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
 gb|EMJ22678.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
Length=467

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 115/185 (62%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFS-GISVGSETXGGIVDVLAEHINLY  528
            DD +++KSGWDEYGI+YGRP   I IRR+ G +  S GI++GSE  GG+ +V AE+++ +
Sbjct  252  DDLIAIKSGWDEYGISYGRPSRNIIIRRIAGKTETSAGIAIGSEMSGGVSEVHAENLHFF  311

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT+ GRGG ++NI VSNV ++     I+     G+HPD  ++PNALPI+  I
Sbjct  312  NSKTGIRIKTSPGRGGYVKNIFVSNVTLDGIDIAIRFTSHYGEHPDEFYDPNALPIIEQI  371

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
              +D  GK +   G + G +   F  ICLSNI LN  S     PWKCS + G +  VSP 
Sbjct  372  TFKDFVGKNIKTAGLLEGLEGDTFLDICLSNITLNVTS---KSPWKCSSIQGYSDLVSPE  428

Query  167  PCSEL  153
             C  L
Sbjct  429  TCEPL  433



>ref|XP_011458753.1| PREDICTED: probable polygalacturonase isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458754.1| PREDICTED: probable polygalacturonase isoform X2 [Fragaria vesca 
subsp. vesca]
Length=451

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 117/184 (64%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLYN  525
            D + +KSGWDEYGIAYG+P   + IR V   S   SG++ GSE  GGI+ VL E ++L +
Sbjct  245  DAIVLKSGWDEYGIAYGKPTKSVHIRGVNLQSSLGSGLAFGSEMSGGILSVLVERLHLSD  304

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              +GI +KT  GRGG +++I +SNV MEN  T I++ G  G HPD++F+P+ LP V GI 
Sbjct  305  SFIGIALKTTRGRGGYMKDIVISNVEMENIHTAIQVTGQSGTHPDDKFDPDQLPFVKGIT  364

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
              ++ G  ++  G   G  KSPFT ICLSN+  +  +   +  W C DV G + +VSP P
Sbjct  365  FDNMVGSNITFAGNFSGINKSPFTSICLSNVSFS-MTGNSSSSWFCRDVKGFSQKVSPEP  423

Query  164  CSEL  153
            CS+L
Sbjct  424  CSDL  427



>gb|KHG12205.1| putative polygalacturonase [Gossypium arboreum]
Length=454

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 126/200 (63%), Gaps = 4/200 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +++KSGWDEYGIAYGRP   + IRRV   S FSG  ++ GS+  GGI DV  + ++LY
Sbjct  250  DAIALKSGWDEYGIAYGRPTANVHIRRVQLQS-FSGSSLAFGSQMSGGISDVQVQQLHLY  308

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            +   GI  +T  GRGG I+ I +S+V M N +T     G  G HPD++F+P+ALP+V+ I
Sbjct  309  DSLTGIEFRTTKGRGGYIKEIAISDVDMLNIKTAFCANGHFGSHPDDKFDPDALPLVAKI  368

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             IQ++ G  +S  G   G ++SPFT ICLSN+ L+  S+  + PW+CS V G +  V P 
Sbjct  369  TIQNIIGTNISMAGNFTGIEESPFTSICLSNVSLSINSA-SSSPWQCSYVSGFSESVFPE  427

Query  167  PCSELAXNHRYGACSATL*P  108
            PCSEL       +C + L P
Sbjct  428  PCSELNNPDASSSCFSLLKP  447



>ref|XP_010241442.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=391

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 116/185 (63%), Gaps = 4/185 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSS-PFSGISVGSETXGGIVDVLAEHINLY  528
            DD +S+KSGWDEYGI+Y RP   I IRR+ G +   SGI++GSE  GG+ +V AE +  +
Sbjct  168  DDLISIKSGWDEYGISYARPSTNIIIRRIVGQTLSSSGIAIGSEMSGGVSEVHAEGLQFF  227

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI IKT  GRGG +RNI VS+V + + +  I+  G  G+HPD  ++PNALPI++ +
Sbjct  228  NSKTGIRIKTAPGRGGYVRNIYVSDVKLTDVKMAIRFTGQYGEHPDEFYDPNALPIINNV  287

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
              +D+ G  +S  G + G +   F +ICLSNI LN  S+    PWKCS + G +  V P 
Sbjct  288  TFKDIRGDNISIAGLLEGVEGESFQNICLSNITLNVTST---SPWKCSFIKGYSDLVYPE  344

Query  167  PCSEL  153
             C  L
Sbjct  345  TCEPL  349



>gb|ABG34278.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=307

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 123/217 (57%), Gaps = 13/217 (6%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGI+YGRP   I IRR+ G +  SGI++GSE  GG+ DV AE I  +N
Sbjct  90   DDVIAIKSGWDEYGISYGRPSKNIIIRRLIGETHSSGIAIGSEMSGGVSDVHAEDIVFFN  149

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT+ GRGG +RNI +SNV + N +  I+  G  G+HPD  ++P A+P +  I 
Sbjct  150  STTGIRIKTSPGRGGYVRNIFISNVSLANVKVAIRFTGRYGEHPDESYDPKAMPKIERIT  209

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
             +D+ G+ ++  G + G +   F +ICL NI L+  S     PW CS+V G +  V P  
Sbjct  210  FKDIHGENITVAGLMEGIEGDNFINICLYNITLSVNSI---SPWNCSNVQGFSSLVFPQT  266

Query  164  CSELAXNHRYGACSATL*PAKVDS*TAHLLLYFRFRS  54
            C  L  +     C+             HLL   R R+
Sbjct  267  CELLEESIFPDHCTECY----------HLLQEHRIRN  293



>ref|XP_002273305.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 ref|XP_010649564.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=457

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 115/181 (64%), Gaps = 2/181 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVT-GSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +++KSGWDEYGIAYGRP   + IRRV   SS  S ++ GSE  GGI +V  E ++LYN
Sbjct  250  DAIALKSGWDEYGIAYGRPTTNVHIRRVNLQSSSGSSLAFGSEMSGGISNVCVEQVHLYN  309

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG I+ I +S+V MEN  T     G +G HPD+ F+PNALP++  I 
Sbjct  310  SFSGIEFRTTKGRGGYIQEIIISDVAMENIHTAFSATGQIGSHPDDHFDPNALPVLDHIT  369

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            +Q+V G  ++  G   G ++SPFT ICLSNI L+  + P +  W CS+V G +  V P P
Sbjct  370  LQNVIGTNITIAGSFTGIQESPFTSICLSNISLS-TTPPASISWVCSNVSGFSQWVFPEP  428

Query  164  C  162
            C
Sbjct  429  C  429



>ref|XP_003550546.2| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=449

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 124/185 (67%), Gaps = 4/185 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSG--ISVGSETXGGIVDVLAEHINLY  528
            D +S+KSGWDEYGIAYGRP   + IRRV   + +SG  I+ GS+  GGI ++L E+++LY
Sbjct  248  DAISLKSGWDEYGIAYGRPTENVHIRRVHLQA-YSGSTIAFGSDMSGGISNILVENVHLY  306

Query  527  NIGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGI  348
            N   GI  +T  GRGG ++ I +S++ MEN  T +   G  G HPD++F+PNALP++  I
Sbjct  307  NSKSGIEFRTMRGRGGYMKEIIISDIEMENIYTAMAATGYCGSHPDDKFDPNALPLLDHI  366

Query  347  KIQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPW  168
             +QD+ G  ++  G   G ++SPFT+ICLSN+ L+  +S  + PW+CS+V G +  V P 
Sbjct  367  ILQDMIGTNITIAGSFAGLQESPFTNICLSNVTLS-INSVSSIPWECSNVSGFSDSVLPK  425

Query  167  PCSEL  153
            PC +L
Sbjct  426  PCPDL  430



>ref|XP_006386685.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 ref|XP_002301554.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|ERP64482.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|EEE80827.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
Length=449

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 114/178 (64%), Gaps = 3/178 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYG++YGRP   I IRR+ G +  +GI++GSE  GG+ +V AE++  YN
Sbjct  251  DDIIAIKSGWDEYGMSYGRPSKNITIRRLVGQTTSAGIAIGSEMSGGVSEVHAENLRFYN  310

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI IKT+ GRGG +RNI +SN+ + + +T I   G  G+HPD  ++P ALP++  I 
Sbjct  311  STTGIRIKTSPGRGGYVRNIYISNMSLTDVKTAISFTGRYGEHPDEYYDPTALPLIERIT  370

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSP  171
            ++DV G+ V   G + G +   F  ICL NI+L+  S     PW CS + G +  VSP
Sbjct  371  VEDVAGQNVKYAGLLEGIEGDTFLDICLLNINLSVTS---KSPWNCSYIQGYSDTVSP  425



>gb|AEW08036.1| hypothetical protein 0_17434_01, partial [Pinus radiata]
 gb|AFG59698.1| hypothetical protein 0_17434_01, partial [Pinus taeda]
 gb|AFG59700.1| hypothetical protein 0_17434_01, partial [Pinus taeda]
Length=138

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +++KSGWDEYGI++ RP   I +RR+T S+PFSGI++GSET GGI D+L E+I++Y+
Sbjct  9    DDGIAIKSGWDEYGISFNRPSSNIIVRRITISTPFSGIAIGSETSGGIRDILVENISIYS  68

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              VGI +KTN+GRGG IRNIT S++Y++N  TGIK +G+ GDHPD R+NP ALP+V  I 
Sbjct  69   SSVGIRVKTNVGRGGIIRNITFSHIYLDNVGTGIKFSGNTGDHPDARYNPMALPVVGDIA  128

Query  344  IQDVWGKKV  318
            + +V G  +
Sbjct  129  VLNVVGSSI  137



>gb|AES61557.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=510

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 120/184 (65%), Gaps = 3/184 (2%)
 Frame = -3

Query  704  DDXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            DD +S+KSGWDEYGI++GRP   I I R+TG +  +GI++GSE  GG+ +V AE I +++
Sbjct  290  DDLISIKSGWDEYGISFGRPSTNISIHRLTGRTTSAGIAIGSEMSGGVSEVYAEDIYIFD  349

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
                I IKT+ GRGG +RN+ +SN+ + N    I+  G  G+HPD+ ++ +ALP++  I 
Sbjct  350  SKSAIRIKTSPGRGGYVRNVYISNMTLINVDIAIRFTGLYGEHPDDSYDRDALPVIERIT  409

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
            + +V G+ + + G I+G K   F  ICLSNI LN +   +N PW CSDV G +  VSP  
Sbjct  410  VVNVIGENIKRAGLIQGIKGDNFVDICLSNITLNVS---KNNPWNCSDVKGYSELVSPES  466

Query  164  CSEL  153
            C +L
Sbjct  467  CEQL  470



>ref|XP_008351179.1| PREDICTED: probable polygalacturonase, partial [Malus domestica]
Length=253

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 120/189 (63%), Gaps = 4/189 (2%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVT-GSSPFSGISVGSETXGGIVDVLAEHINLYN  525
            D +++KSGWDEYGIAYGRP   + IR VT  S+  S +++GSE  GGI +V  E + L+N
Sbjct  47   DAIALKSGWDEYGIAYGRPTTNVHIRHVTLQSATGSSLALGSEMSGGISNVHVEQVRLHN  106

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
               GI  +T  GRGG I++I +S+V +EN        G  G HPD++++PNALP++  I 
Sbjct  107  SISGIQFRTTKGRGGYIKDIIISDVEVENIYMAFGAXGQFGSHPDDKYDPNALPVLDHIT  166

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLN-GASSPRNPPWKCSDVHGAAIQVSPW  168
            +QDV G  ++  G   G ++SPFT  CLSNI L+  ++SP    W CS V G++  V P 
Sbjct  167  LQDVVGTNITIAGCFTGIEESPFTSFCLSNISLSLNSASPTT--WDCSYVSGSSESVFPE  224

Query  167  PCSELAXNH  141
            PCS+L  ++
Sbjct  225  PCSDLNTSY  233



>ref|XP_011458751.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458752.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
Length=470

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 117/184 (64%), Gaps = 2/184 (1%)
 Frame = -3

Query  701  DXVSVKSGWDEYGIAYGRPXXGIXIRRVTGSSPF-SGISVGSETXGGIVDVLAEHINLYN  525
            D + +KSGWDEYGIAYG+P   + IR V   S   SG++ GSE  GGI+ VL E ++L +
Sbjct  264  DAIVLKSGWDEYGIAYGKPTKSVHIRGVNLQSSLGSGLAFGSEMSGGILSVLVERLHLSD  323

Query  524  IGVGIHIKTNIGRGGXIRNITVSNVYMENARTGIKIAGDVGDHPDNRFNPNALPIVSGIK  345
              +GI +KT  GRGG +++I +SNV MEN  T I++ G  G HPD++F+P+ LP V GI 
Sbjct  324  SFIGIALKTTRGRGGYMKDIVISNVEMENIHTAIQVTGQSGTHPDDKFDPDQLPFVKGIT  383

Query  344  IQDVWGKKVSQPGFIRGXKKSPFTHICLSNIHLNGASSPRNPPWKCSDVHGAAIQVSPWP  165
              ++ G  ++  G   G  KSPFT ICLSN+  +  +   +  W C DV G + +VSP P
Sbjct  384  FDNMVGSNITFAGNFSGINKSPFTSICLSNVSFS-MTGNSSSSWFCRDVKGFSQKVSPEP  442

Query  164  CSEL  153
            CS+L
Sbjct  443  CSDL  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350