BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF026K03

Length=723
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFU48609.1|  catalase 1                                              392   1e-131   Nicotiana benthamiana
gb|ACL27272.1|  catalase                                                392   1e-131   Nicotiana benthamiana
emb|CCP37650.1|  catalase-1                                             392   2e-131   Nicotiana tabacum [American tobacco]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      392   2e-131   Nicotiana tomentosiformis
gb|AAB62892.1|  catalase-1                                              392   2e-131   Nicotiana glutinosa
gb|AAB71764.1|  catalase 1                                              392   3e-131   Nicotiana tabacum [American tobacco]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      390   1e-130   Nicotiana sylvestris
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               389   2e-130   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAR14052.2|  catalase                                                388   4e-130   Solanum tuberosum [potatoes]
gb|AAM97541.1|  catalase 2                                              387   1e-129   Capsicum annuum
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      387   2e-129   Solanum tuberosum [potatoes]
gb|KJB14249.1|  hypothetical protein B456_002G115900                    376   3e-127   Gossypium raimondii
emb|CDP01803.1|  unnamed protein product                                381   3e-127   Coffea canephora [robusta coffee]
ref|NP_001234186.1|  catalase isozyme 2                                 380   8e-127   
emb|CAI43948.1|  catalase                                               379   3e-126   Populus deltoides
gb|AJE26131.1|  catalase                                                379   3e-126   Salix matsudana [tortured willow]
ref|XP_002301920.1|  catalase family protein                            379   3e-126   Populus trichocarpa [western balsam poplar]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 379   4e-126   Populus euphratica
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      377   1e-125   Vitis vinifera
gb|KJB14250.1|  hypothetical protein B456_002G115900                    377   2e-125   Gossypium raimondii
gb|ACJ11733.1|  catalase                                                376   4e-125   Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      376   4e-125   Gossypium arboreum [tree cotton]
ref|XP_007046520.1|  Catalase 2                                         375   5e-125   Theobroma cacao [chocolate]
emb|CDY40645.1|  BnaA03g53180D                                          375   6e-125   Brassica napus [oilseed rape]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         375   8e-125   Camelina sativa [gold-of-pleasure]
ref|XP_009138342.1|  PREDICTED: catalase-2                              375   8e-125   Brassica rapa
gb|ACV92695.1|  catalase                                                375   9e-125   Brassica oleracea
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      375   1e-124   Nicotiana tomentosiformis
gb|AAF71742.1|AF248491_1  catalase                                      375   1e-124   Raphanus sativus
gb|AAB86582.2|  catalase                                                375   1e-124   Raphanus sativus
emb|CDP07287.1|  unnamed protein product                                375   1e-124   Coffea canephora [robusta coffee]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               375   1e-124   Gossypium hirsutum [American cotton]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    375   1e-124   Gossypium raimondii
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      374   2e-124   Nelumbo nucifera [Indian lotus]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               374   2e-124   Gossypium hirsutum [American cotton]
ref|XP_009106100.1|  PREDICTED: catalase-2                              374   2e-124   Brassica rapa
emb|CDX72514.1|  BnaC07g45360D                                          374   2e-124   
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         374   2e-124   Camelina sativa [gold-of-pleasure]
gb|KHG25152.1|  Catalase isozyme 1                                      374   2e-124   Gossypium arboreum [tree cotton]
ref|XP_010437527.1|  PREDICTED: catalase-2                              374   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010094556.1|  Catalase isozyme 1                                 374   2e-124   Morus notabilis
gb|AFU90823.1|  catalase                                                372   2e-124   Populus x beijingensis
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      374   2e-124   Citrus sinensis [apfelsine]
ref|XP_007018034.1|  Catalase 2                                         374   2e-124   
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             374   2e-124   Citrus clementina [clementine]
emb|CDP01802.1|  unnamed protein product                                373   3e-124   Coffea canephora [robusta coffee]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      374   5e-124   
gb|AFU90822.1|  catalase                                                373   5e-124   Populus tomentosa [Chinese white poplar]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      373   5e-124   
gb|AIA61608.1|  catalase                                                373   7e-124   Gynostemma pentaphyllum [jiaogulan]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             373   7e-124   
ref|XP_011022275.1|  PREDICTED: catalase-like                           372   7e-124   Populus euphratica
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      373   8e-124   Populus euphratica
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      372   8e-124   Nicotiana sylvestris
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             372   9e-124   Eutrema salsugineum [saltwater cress]
dbj|BAJ33995.1|  unnamed protein product                                372   9e-124   Eutrema halophilum
gb|KJB17473.1|  hypothetical protein B456_003G002800                    372   1e-123   Gossypium raimondii
ref|XP_010530333.1|  PREDICTED: catalase-2                              372   1e-123   Tarenaya hassleriana [spider flower]
ref|NP_001289779.1|  catalase isozyme 1                                 372   1e-123   Nelumbo nucifera [Indian lotus]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             372   1e-123   Populus trichocarpa [western balsam poplar]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              372   1e-123   Populus euphratica
gb|AIS20825.1|  CAT                                                     372   2e-123   Pyrus x bretschneideri [bai li]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      372   2e-123   Prunus mume [ume]
gb|AAD17936.1|  catalase                                                371   2e-123   Brassica juncea [brown mustard]
emb|CDX76313.1|  BnaA08g10870D                                          371   3e-123   
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             371   3e-123   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              372   3e-123   Populus euphratica
gb|ADU56199.1|  catalase                                                371   3e-123   Hevea brasiliensis [jebe]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         371   4e-123   Tarenaya hassleriana [spider flower]
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 370   5e-123   Elaeis guineensis
gb|AAB88173.1|  catalase                                                364   6e-123   Glycine max [soybeans]
gb|AAD17935.1|  catalase                                                370   6e-123   Brassica juncea [brown mustard]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             370   6e-123   Capsella rubella
gb|AET97564.1|  catalase                                                370   7e-123   Ziziphus jujuba [Chinese jujube]
emb|CAD42908.1|  catalase                                               370   8e-123   Prunus persica
dbj|BAQ21275.1|  catalase                                               369   9e-123   Citrus tamurana
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             370   1e-122   Prunus persica
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       370   1e-122   Cucumis sativus [cucumbers]
emb|CDY17510.1|  BnaC03g65530D                                          369   1e-122   Brassica napus [oilseed rape]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      370   1e-122   Cucumis melo [Oriental melon]
emb|CAA64220.1|  catalase                                               369   1e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CAA45564.1|  catalase                                               369   2e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      369   2e-122   Phoenix dactylifera
prf||1906388A  catalase                                                 369   2e-122
gb|AAK96854.1|  catalase                                                369   2e-122   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195235.1|  catalase 2                                            369   2e-122   Arabidopsis thaliana [mouse-ear cress]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          369   3e-122   Soldanella alpina
gb|AHF27428.1|  catalase                                                363   3e-122   Cucurbita moschata [ayote]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      367   9e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 367   9e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002306976.2|  catalase family protein                            367   1e-121   
prf||2104177A  catalase                                                 367   1e-121
emb|CDX69111.1|  BnaC01g03420D                                          367   1e-121   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      367   1e-121   
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          367   1e-121   Helianthus annuus
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         367   2e-121   Jatropha curcas
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      367   2e-121   
ref|XP_002521709.1|  catalase, putative                                 367   2e-121   Ricinus communis
gb|AAR84578.1|  catalase 1a                                             366   2e-121   Lotus japonicus
emb|CAC04509.1|  catalase                                               357   4e-121   Digitalis lanata [Grecian foxglove]
gb|KFK30147.1|  catalase                                                365   4e-121   Arabis alpina [alpine rockcress]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      365   6e-121   Elaeis guineensis
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 365   7e-121   Nicotiana tomentosiformis
gb|AAO17721.1|  catalase                                                365   1e-120   Hypericum perforatum
ref|NP_001240021.1|  catalase                                           364   1e-120   Glycine max [soybeans]
gb|AAD17933.1|  catalase                                                365   1e-120   Brassica juncea [brown mustard]
gb|AAK67359.2|AF390210_1  catalase                                      364   2e-120   Suaeda salsa
gb|AFN81243.1|  catalase 1                                              364   2e-120   Brassica rapa subsp. pekinensis [bai cai]
ref|NP_001237571.1|  catalase-4                                         364   2e-120   Glycine max [soybeans]
emb|CAB56850.1|  catalase                                               362   2e-120   Prunus persica
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               364   2e-120   Cucurbita pepo
gb|AAC19397.1|  leaf catalase                                           364   2e-120   Mesembryanthemum crystallinum
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         363   3e-120   Tarenaya hassleriana [spider flower]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 363   4e-120   Nicotiana sylvestris
gb|AIP93616.1|  CAT1                                                    363   4e-120   Bassia scoparia [burning bush]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              363   4e-120   
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                363   5e-120   Erythranthe guttata [common monkey flower]
ref|XP_010692546.1|  PREDICTED: catalase                                362   7e-120   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV54297.1|  peroxisomal catalase                                    362   1e-119   Phaseolus vulgaris [French bean]
gb|ADC95629.1|  catalase                                                362   1e-119   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      362   1e-119   Elaeis guineensis
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             362   2e-119   Phaseolus vulgaris [French bean]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 361   2e-119   Prunus mume [ume]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    361   2e-119   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               361   3e-119   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AAM97542.1|  catalase 3                                              360   5e-119   Capsicum annuum
ref|NP_001291326.1|  catalase isozyme 1                                 360   5e-119   Sesamum indicum [beniseed]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          360   6e-119   Amborella trichopoda
ref|NP_564121.1|  catalase 1                                            360   9e-119   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268098.1|  catalase                                           360   9e-119   Vitis vinifera
ref|XP_003558892.1|  PREDICTED: catalase-1                              360   9e-119   Brachypodium distachyon [annual false brome]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 360   9e-119   Vitis vinifera
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      360   1e-118   Solanum lycopersicum
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             360   1e-118   Prunus persica
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       356   2e-118   Cucumis sativus [cucumbers]
gb|ACA50528.1|  putative catalase 2                                     359   2e-118   Brassica napus [oilseed rape]
emb|CAD42909.1|  catalase                                               359   2e-118   Prunus persica
ref|NP_001237556.1|  catalase-1/2                                       359   2e-118   Glycine max [soybeans]
dbj|BAA34205.1|  catalase                                               358   3e-118   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048861.1|  Os03g0131200                                       358   3e-118   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             359   3e-118   Eutrema salsugineum [saltwater cress]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 358   3e-118   Cucumis melo [Oriental melon]
gb|AGE15298.2|  catalase 1                                              358   4e-118   Eriobotrya japonica [loquat]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           358   4e-118   
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              358   5e-118   
gb|AHB72694.1|  catalase                                                358   5e-118   Beta vulgaris subsp. maritima [sea beet]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 358   6e-118   Solanum tuberosum [potatoes]
ref|NP_001235974.1|  catalase-3                                         357   7e-118   Glycine max [soybeans]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         357   9e-118   Oryza brachyantha
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              357   1e-117   Cicer arietinum [garbanzo]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           357   1e-117   Sesamum indicum [beniseed]
gb|AAC17731.1|  catalase 1                                              356   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061175.1|  PREDICTED: catalase-like                           356   2e-117   Eucalyptus grandis [rose gum]
gb|AHA50082.1|  catalase                                                356   3e-117   Eleutherococcus senticosus
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       355   5e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             355   5e-117   Phaseolus vulgaris [French bean]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      355   6e-117   Fragaria vesca subsp. vesca
gb|ACN36234.1|  unknown                                                 349   8e-117   Zea mays [maize]
gb|AIX10947.1|  putative catalase                                       354   1e-116   Gardenia jasminoides
gb|EMT05040.1|  Catalase-1                                              355   1e-116   
gb|AGC65520.1|  catalase                                                354   1e-116   Eriobotrya japonica [loquat]
dbj|BAJ90861.1|  predicted protein                                      354   1e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24453.1|  unknown                                                 354   2e-116   Picea sitchensis
emb|CDP07288.1|  unnamed protein product                                353   2e-116   Coffea canephora [robusta coffee]
gb|ACB11496.1|  catalase                                                353   2e-116   Pinus sylvestris [Scotch pine]
gb|AAF19965.1|AF207906_1  catalase 1                                    353   2e-116   Zantedeschia aethiopica [arum-lily]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          353   3e-116   Vigna radiata var. radiata [golden gram]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     356   4e-116   Eucalyptus grandis [rose gum]
gb|ADZ45555.1|  catalase                                                353   4e-116   Vigna radiata [mung bean]
gb|ABQ44283.1|  catalase                                                347   5e-116   Saccharum hybrid cultivar NCo 376
gb|ABM47415.1|  catalase                                                353   5e-116   Prunus avium [gean]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 353   5e-116   Phoenix dactylifera
dbj|BAJ88747.1|  predicted protein                                      354   6e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIZ77475.1|  catalase                                                352   8e-116   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 352   1e-115   Oryza brachyantha
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    352   2e-115   Oryza sativa Indica Group [Indian rice]
gb|ACL35349.1|  catalase                                                351   2e-115   Picea glauca
gb|AAY59707.1|  catalase                                                351   2e-115   Oryza sativa Indica Group [Indian rice]
gb|ADZ45556.1|  catalase                                                351   2e-115   Vigna radiata [mung bean]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 364   2e-115   
gb|KEH36312.1|  catalase heme-binding enzyme                            351   3e-115   Medicago truncatula
gb|EPS69543.1|  catalase                                                350   3e-115   Genlisea aurea
dbj|BAA34204.1|  catalase                                               350   4e-115   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA05494.1|  catalase                                               350   5e-115   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       350   6e-115   
dbj|BAJ87148.1|  predicted protein                                      343   6e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA43177.1|  TPA: catalase2                                         349   1e-114   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             349   1e-114   Eutrema salsugineum [saltwater cress]
gb|AAF61732.1|AF243517_1  catalase 2                                    349   1e-114   Helianthus annuus
gb|ACH63223.1|  catalase                                                349   2e-114   Rheum australe [Himalayan rhubarb]
gb|AFW69584.1|  catalase1                                               344   2e-114   
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 348   2e-114   Eucalyptus grandis [rose gum]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         348   3e-114   Setaria italica
gb|AAD37788.1|AF149283_1  catalase 1                                    346   3e-114   Phaseolus vulgaris [French bean]
emb|CAG23920.1|  catalase                                               348   3e-114   Festuca arundinacea [tall fescue]
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               348   3e-114   Zea mays [maize]
prf||1803522A  catalase                                                 347   7e-114
gb|AIU99480.1|  catalase                                                347   7e-114   Saccharum spontaneum [fodder cane]
gb|AIU99481.1|  catalase                                                347   8e-114   Saccharum spontaneum [fodder cane]
emb|CDY31877.1|  BnaC07g15270D                                          347   8e-114   Brassica napus [oilseed rape]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    347   8e-114   Arabis alpina [alpine rockcress]
ref|NP_001105310.1|  catalase isozyme 2                                 347   9e-114   
gb|AIU99479.1|  catalase                                                347   9e-114   Saccharum arundinaceum
ref|XP_009103333.1|  PREDICTED: catalase-1                              347   1e-113   Brassica rapa
gb|AAC17729.1|  catalase 1                                              343   1e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY01363.1|  BnaA07g11360D                                          347   1e-113   
gb|AIM43584.1|  catalase                                                347   1e-113   Saccharum hybrid cultivar Yacheng05-179
gb|AAB07026.1|  catalase 1                                              347   1e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AIU99485.1|  catalase                                                346   1e-113   Saccharum spontaneum [fodder cane]
gb|AIU99484.1|  catalase                                                346   2e-113   Saccharum arundinaceum
ref|XP_010105996.1|  Catalase isozyme 1                                 342   2e-113   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          346   2e-113   Amborella trichopoda
gb|ABR15776.1|  catalase                                                339   2e-113   Litchi
gb|AAF79625.1|AC027665_26  F5M15.5                                      360   2e-113   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA43178.1|  TPA: catalase2                                         347   2e-113   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               346   2e-113   Ricinus communis
gb|KHG21219.1|  Catalase isozyme 1                                      344   2e-113   Gossypium arboreum [tree cotton]
gb|ABY21704.1|  catalase-1 precursor                                    345   4e-113   Panax ginseng [Asiatic ginseng]
emb|CAA42720.1|  catalase-1                                             345   4e-113   Zea mays [maize]
ref|NP_001241808.1|  catalase isozyme B                                 345   5e-113   Zea mays [maize]
gb|AIU99482.1|  catalase                                                344   9e-113   Saccharum hybrid cultivar ROC22
gb|AAG43363.1|AF151368_1  catalase                                      344   1e-112   Hevea brasiliensis [jebe]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          344   1e-112   
gb|AIU99488.1|  catalase                                                344   1e-112   Saccharum hybrid cultivar ROC22
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               344   1e-112   Hordeum vulgare [barley]
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         344   1e-112   Camelina sativa [gold-of-pleasure]
gb|AIU99486.1|  catalase                                                343   2e-112   Saccharum spontaneum [fodder cane]
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 345   2e-112   
ref|XP_010477308.1|  PREDICTED: catalase-1                              343   2e-112   Camelina sativa [gold-of-pleasure]
ref|XP_002890395.1|  F5M15.5                                            356   2e-112   
gb|ABY19573.1|  catalase                                                335   3e-112   Manihot esculenta [manioc]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                343   3e-112   Citrus sinensis [apfelsine]
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         343   3e-112   Camelina sativa [gold-of-pleasure]
gb|AIU99487.1|  catalase                                                343   3e-112   Saccharum hybrid cultivar ROC22
gb|ACJ22771.1|  catalase 1                                              342   5e-112   Jatropha curcas
gb|AAX84671.1|  catalase CAT2                                           335   5e-112   Manihot esculenta [manioc]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             342   6e-112   Citrus clementina [clementine]
gb|ADN94253.1|  catalase                                                342   6e-112   Puccinellia chinampoensis
emb|CDY52649.1|  BnaAnng11640D                                          341   6e-112   Brassica napus [oilseed rape]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      342   7e-112   Eucalyptus grandis [rose gum]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     343   8e-112   Sesamum indicum [beniseed]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                342   8e-112   Erythranthe guttata [common monkey flower]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      342   9e-112   Brachypodium distachyon [annual false brome]
gb|AIU99483.1|  catalase                                                341   2e-111   Saccharum hybrid cultivar ROC22
ref|NP_001105415.1|  catalase isozyme 1                                 341   2e-111   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         339   9e-111   Triticum aestivum [Canadian hard winter wheat]
gb|ACJ76836.3|  catalase                                                339   1e-110   Dimocarpus longan [longan]
emb|CDY31490.1|  BnaC05g15990D                                          339   1e-110   Brassica napus [oilseed rape]
emb|CDY29518.1|  BnaA06g14520D                                          339   1e-110   Brassica napus [oilseed rape]
ref|XP_009149540.1|  PREDICTED: catalase-1                              338   2e-110   Brassica rapa
gb|AEQ30070.1|  catalase                                                338   2e-110   Litchi chinensis [litchi]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             339   2e-110   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              337   3e-110   
ref|NP_001031791.1|  catalase 2                                         337   6e-110   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19523.1|  AT4G35090                                              337   6e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AAA57551.1|  catalase                                                333   9e-110   Nicotiana sylvestris
gb|AAD50974.1|AF170272_1  catalase CAT1                                 337   1e-109   Manihot esculenta [manioc]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             336   2e-109   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          336   2e-109   Avicennia marina
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               335   3e-109   Ricinus communis
dbj|BAC79443.1|  catalase                                               335   4e-109   Acacia ampliceps
dbj|BAH37035.1|  catalase 1                                             335   6e-109   Pisum sativum [garden pea]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 334   7e-109   Tarenaya hassleriana [spider flower]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    334   8e-109   Nicotiana tabacum [American tobacco]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      334   8e-109   Nicotiana tomentosiformis
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      334   9e-109   Nicotiana sylvestris
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             334   1e-108   Selaginella moellendorffii
ref|NP_001031072.3|  catalase 3                                         330   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         333   2e-108   Tarenaya hassleriana [spider flower]
ref|XP_010498496.1|  PREDICTED: catalase-3                              333   2e-108   Camelina sativa [gold-of-pleasure]
gb|AAF61734.1|AF243519_1  catalase 4                                    333   2e-108   Helianthus annuus
emb|CAE82295.1|  catalase                                               333   2e-108   Homogyne alpina
ref|XP_009110221.1|  PREDICTED: catalase-3                              333   2e-108   Brassica rapa
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               333   3e-108   Zea mays [maize]
dbj|BAF91369.1|  catalase                                               332   4e-108   Capsicum annuum
ref|XP_002510677.1|  catalase, putative                                 345   4e-108   
gb|AFD29285.1|  catalase                                                332   4e-108   Vicia faba [broad bean]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         332   5e-108   Brassica rapa
emb|CDY31488.1|  BnaC05g15970D                                          332   6e-108   Brassica napus [oilseed rape]
emb|CDY29519.1|  BnaA06g14510D                                          332   6e-108   
dbj|BAH20307.1|  AT1G20620                                              331   6e-108   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               332   7e-108   
ref|XP_009149539.1|  PREDICTED: catalase-3                              333   8e-108   
emb|CDY33636.1|  BnaC08g19360D                                          332   8e-108   
gb|AAM65021.1|  unknown                                                 331   1e-107   
ref|NP_564120.1|  catalase 3                                            331   1e-107   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    331   2e-107   
gb|AHF21552.1|  catalase                                                331   2e-107   
emb|CDY01364.1|  BnaA07g11370D                                          333   2e-107   
emb|CDY31878.1|  BnaC07g15280D                                          330   3e-107   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    330   3e-107   
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             329   6e-107   
gb|AAF61733.1|AF243518_1  catalase 3                                    329   6e-107   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          329   6e-107   
gb|AAC48918.1|  salicylic acid binding catalase                         329   7e-107   
gb|AAD30292.1|AF139539_1  catalase 3                                    329   1e-106   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            328   2e-106   
gb|AAD30291.2|AF139538_1  catalase 2                                    328   3e-106   
gb|AHF27430.1|  catalase                                                327   4e-106   
gb|AHF27433.1|  catalase                                                327   4e-106   
gb|AFR53082.1|  CAT                                                     327   9e-106   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             326   1e-105   
gb|ACJ73905.1|  CAT1                                                    315   1e-105   
gb|AGI65617.1|  catalase                                                325   1e-105   
gb|ADM96039.1|  catalase                                                326   1e-105   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 325   2e-105   
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 326   2e-105   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      326   2e-105   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      325   2e-105   
gb|AAC49807.1|  catalase 3                                              325   2e-105   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               325   2e-105   
gb|ABV55108.1|  catalase 2                                              325   3e-105   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      325   3e-105   
gb|ADU56198.1|  catalase                                                325   5e-105   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      324   7e-105   
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          324   8e-105   
gb|ADB03784.1|  catalase                                                324   8e-105   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      323   1e-104   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          324   1e-104
gb|ADK25939.1|  catalase                                                314   2e-104   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      322   2e-104   
gb|AAL00886.1|  catalase                                                315   5e-104   
gb|AHF27429.1|  catalase                                                321   6e-104   
gb|AHF27432.1|  catalase                                                321   6e-104   
ref|XP_001752315.1|  predicted protein                                  321   2e-103   
gb|AAR97905.1|  catalase                                                320   2e-103   
ref|NP_001234827.1|  catalase isozyme 1                                 320   2e-103   
emb|CAA85470.1|  catalase                                               320   2e-103   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               320   2e-103   
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               320   3e-103   
gb|AAG61140.2|AF332973_1  catalase 2                                    320   3e-103   
gb|AII23739.1|  catalase                                                319   4e-103   
gb|ACJ73906.1|  CAT2                                                    313   4e-103   
gb|ABC01913.1|  catalase isozyme 1-like protein                         319   7e-103   
ref|NP_001274863.1|  catalase isozyme 1                                 318   1e-102   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               318   2e-102   
ref|XP_001784759.1|  predicted protein                                  315   2e-101   
ref|XP_010692544.1|  PREDICTED: catalase-like                           315   3e-101   
gb|AJF34884.1|  catalase                                                314   6e-101   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      313   1e-100   
gb|EMS61345.1|  Catalase isozyme 1                                      316   3e-100   
ref|NP_001031073.1|  catalase 3                                         311   5e-100   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     311   6e-100   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   313   2e-99    
gb|ACL81498.1|  catalase                                                308   1e-98    
gb|ADQ28492.1|  catalase                                                308   2e-98    
gb|AAC17730.1|  catalase 2                                              305   2e-98    
gb|ABB72796.1|  catalase isozyme 1-like protein                         306   5e-98    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          306   5e-98    
gb|ADY02963.1|  catalase                                                306   7e-98    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 305   9e-98    
gb|AGT16203.1|  catalase                                                305   1e-97    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               305   1e-97    
gb|KIY96954.1|  catalase                                                298   7e-97    
gb|EMS51034.1|  Catalase isozyme 2                                      304   7e-97    
emb|CAH61266.1|  catalase                                               303   9e-97    
gb|AAZ29552.1|  catalase-C                                              303   1e-96    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      303   1e-96    
ref|NP_001045673.1|  Os02g0115700                                       302   2e-96    
dbj|BAJ92414.1|  predicted protein                                      302   3e-96    
gb|ABN71233.2|  catalase                                                302   3e-96    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          302   3e-96    
ref|XP_005645077.1|  catalase                                           301   4e-96    
gb|ABK24449.1|  unknown                                                 301   6e-96    
gb|AAX88799.1|  catalase                                                300   2e-95    
gb|AAC19398.1|  root catalase                                           300   3e-95    
gb|EMT06167.1|  Catalase isozyme 2                                      305   3e-95    
gb|ABK41476.1|  catalase                                                299   3e-95    
gb|AGT16188.1|  catalase                                                299   3e-95    
gb|AGT16054.1|  catalase                                                299   3e-95    
gb|AGT15888.1|  catalase                                                299   3e-95    
gb|AGT16310.1|  catalase                                                299   4e-95    
gb|AHZ13843.1|  catalase                                                298   9e-95    
dbj|BAH56915.1|  AT1G20620                                              298   9e-95    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    296   6e-94    
gb|ABR16304.1|  unknown                                                 294   2e-93    
ref|XP_002950455.1|  catalase                                           295   2e-93    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      295   2e-93    
gb|ABK24543.1|  unknown                                                 294   4e-93    
gb|EMS35721.1|  Catalase isozyme 1                                      287   4e-93    
ref|XP_001696763.1|  catalase/peroxidase                                293   6e-93    
ref|XP_001779509.1|  predicted protein                                  293   8e-93    
emb|CAA43814.1|  catalase                                               293   1e-92    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           292   2e-92 
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          291   5e-92    
gb|AAB70006.1|  catalase                                                290   1e-91    
gb|AFW66787.1|  catalase3                                               290   2e-91    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               290   2e-91    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              288   7e-91    
dbj|BAA34714.1|  catalase                                               286   4e-90    
emb|CAA73663.1|  catalase                                               286   4e-90    
gb|AFY26882.1|  catalase                                                274   2e-89    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    282   2e-89    
gb|AFW66785.1|  catalase3 isoform 1                                     290   3e-89    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    282   6e-89    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             282   6e-89    
gb|AEY70510.1|  catalase                                                276   1e-88    
gb|AAR84577.1|  catalase 1b                                             280   5e-88    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              280   1e-87    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      279   4e-87    
ref|XP_011396830.1|  Catalase isozyme 2                                 273   4e-85    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            270   1e-83 
gb|AFW66789.1|  catalase3                                               263   1e-83    
gb|ACV30589.1|  catalase                                                258   3e-83    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        268   6e-83    
ref|NP_001105416.1|  catalase isozyme 3                                 268   6e-83    
ref|XP_005708279.1|  catalase                                           266   3e-82    
gb|ABB88582.1|  catalase                                                264   1e-81    
gb|AFW66788.1|  catalase3                                               263   3e-81    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      251   3e-76    
gb|KDD77132.1|  catalase                                                247   7e-75    
gb|AFH53187.1|  catalase                                                238   2e-74    
gb|AFH53190.1|  catalase                                                237   3e-74    
gb|AFH53189.1|  catalase                                                237   4e-74    
gb|AFR42410.1|  catalase                                                233   4e-74    
dbj|BAH20283.1|  AT1G20620                                              233   6e-74    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      241   3e-73    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             239   1e-72    
gb|AFR42412.1|  catalase                                                228   6e-72    
ref|XP_005536240.1|  catalase                                           239   9e-72    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 235   9e-71    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 234   1e-70    
gb|ACU23083.1|  unknown                                                 226   2e-70    
gb|AID50071.1|  catalase                                                221   3e-69    
gb|AAP57673.1|  catalase                                                223   7e-69    
gb|KEH36313.1|  catalase heme-binding enzyme                            226   8e-68    
dbj|BAD07937.1|  catalase catA-like protein                             217   2e-67    
gb|AGS17821.1|  catalase 2                                              224   2e-67    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             222   4e-66    
emb|CAA10286.1|  catalase                                               212   5e-66    
gb|AAO16182.1|  catalase-1                                              210   3e-65    
gb|ABB51561.1|  truncated catalase 2                                    215   2e-63    
gb|ABY68160.1|  catalase                                                205   2e-63    
gb|AFA36510.1|  catalase                                                209   4e-63    
gb|ABY68162.1|  catalase                                                204   4e-63    
gb|ABY68158.1|  catalase                                                204   9e-63    
gb|ABY68159.1|  catalase                                                204   1e-62    
gb|AFI48101.1|  catalase isozyme B                                      203   1e-62    
gb|AFI48054.1|  catalase isozyme B                                      202   4e-62    
gb|AFI48111.1|  catalase isozyme B                                      202   5e-62    
gb|ABY68161.1|  catalase                                                202   5e-62    
emb|CBI29556.3|  unnamed protein product                                201   9e-62    
ref|NP_973873.1|  catalase 3                                            211   1e-61    
gb|AFI48130.1|  catalase isozyme B                                      200   2e-61    
gb|AFI48068.1|  catalase isozyme B                                      200   3e-61    
gb|AFI48131.1|  catalase isozyme B                                      200   3e-61    
gb|ABY68164.1|  catalase                                                200   3e-61    
gb|AFI48098.1|  catalase isozyme B                                      199   7e-61    
dbj|BAD94702.1|  catalase                                               197   3e-60    
gb|ABS89000.1|  catalase                                                197   9e-60    
gb|AFK46618.1|  unknown                                                 194   4e-59    
gb|AEA86295.1|  putative catalase                                       193   3e-58    
emb|CDP22058.1|  unnamed protein product                                190   7e-57    
gb|ACJ71245.1|  catalase 2                                              196   3e-56    
ref|XP_005712277.1|  unnamed protein product                            197   6e-56    
gb|ACJ71244.1|  catalase 2                                              194   8e-56    
gb|AAZ03546.1|  Catalase                                                187   3e-55    
gb|ADR01107.1|  catalase 3                                              192   3e-55    
gb|ABY68163.1|  catalase                                                183   8e-55    
gb|AAY22485.1|  catalase                                                183   2e-53    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     184   9e-53    
gb|AAT68776.1|  catalase                                                182   2e-52    
gb|AAR25790.1|  catalase                                                174   2e-51    
gb|ACY30463.1|  catalase                                                180   6e-51    
gb|AFV96158.1|  catalase                                                175   9e-51    
gb|ABN79860.2|  catalase                                                176   2e-50    
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     179   6e-50    
ref|XP_005642928.1|  catalase                                           181   9e-50    
emb|CAC16850.1|  catalase                                               171   1e-49    
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             178   2e-49    
emb|CAC17121.1|  catalase                                               169   5e-49    
ref|XP_005644653.1|  catalase-domain-containing protein                 178   2e-48    
gb|KJE89728.1|  catalase isozyme 2                                      177   4e-48    
ref|XP_004366029.2|  catalase isozyme 2                                 177   4e-48    
gb|AAG23803.1|  catalase                                                163   2e-46    
ref|XP_005647994.1|  catalase-domain-containing protein                 171   3e-46    
ref|WP_035160169.1|  catalase                                           167   2e-44    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             156   1e-43    
ref|WP_032122311.1|  catalase                                           164   2e-43    
gb|KGS11078.1|  catalase                                                159   2e-43    
gb|AHB35639.1|  catalase                                                155   3e-43    
gb|EGH29791.1|  catalase                                                157   4e-43    
ref|WP_032664185.1|  catalase                                           162   4e-43    
ref|WP_032632526.1|  catalase                                           162   5e-43    
gb|AII80275.1|  catalase                                                159   5e-43    
ref|WP_029198005.1|  catalase                                           162   5e-43    
gb|KIQ35234.1|  catalase                                                162   6e-43    
ref|WP_043304355.1|  catalase                                           162   6e-43    
ref|WP_004887231.1|  catalase                                           161   1e-42    
ref|WP_031421259.1|  catalase                                           161   1e-42    
ref|WP_001069151.1|  catalase                                           161   2e-42    
gb|AIM05078.1|  catalase                                                157   2e-42    
ref|WP_038401366.1|  catalase                                           160   2e-42    
ref|WP_032632922.1|  catalase                                           160   3e-42    
ref|WP_015881004.1|  catalase                                           160   3e-42    
gb|AHG41775.1|  catalase                                                160   3e-42    
ref|WP_043193175.1|  catalase                                           160   3e-42    
ref|WP_003342200.1|  catalase                                           160   4e-42    
ref|WP_031412803.1|  catalase                                           160   4e-42    
gb|AFC35182.1|  catalase dismutase                                      155   5e-42    



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   392 bits (1008),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  292  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  351

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  352  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  411

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWISYWS
Sbjct  412  CTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWS  471

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  472  QADKSLGQKLASRLNVRPSI  491



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   392 bits (1008),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWISYWS
Sbjct  413  CTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   392 bits (1008),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWISYWS
Sbjct  413  CTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNF QPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWISYWS
Sbjct  413  CTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRIT+EIRSIWISYWS
Sbjct  413  CTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   392 bits (1006),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 195/200 (98%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPG+RYRSF+PDRQERFI RWV+ALSDPRITYEIR+IWISYWS
Sbjct  413  CTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   390 bits (1002),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 194/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQ G+RYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWISYWS
Sbjct  413  CTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNF NENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  286  WPEDILPLQPVGRLVLNKNIDNFSNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  345

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE+YP P+ +
Sbjct  346  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTM  405

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPRITYEIRSIWISYWS
Sbjct  406  CTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWS  465

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  466  QADKSLGQKLASRLNVRPSI  485



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   388 bits (997),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  276  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  335

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP P+ V
Sbjct  336  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTV  395

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSIWISYWS
Sbjct  396  CSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWS  455

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  456  QADKSLGQKLASRLNVRPSI  475



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   387 bits (994),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQP+GRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  285  WPEDIFPLQPLGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  344

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAE YP P  V
Sbjct  345  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIPTTV  404

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNF+QPGERYRSFS DRQERFI RWV+ALSDPRITYEIRSIWISYWS
Sbjct  405  CSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWISYWS  464

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  465  QADKSLGQKLASRLNVRPSI  484



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   387 bits (993),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/200 (89%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP P+ V
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYR+F+PDRQERFI RWV+ALSDPRITYEIRSIWI+YWS
Sbjct  413  CSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   376 bits (966),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  145  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQ  204

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P AV
Sbjct  205  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAV  264

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  265  CTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWS  324

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKS+GQK+ASRLN+RP++
Sbjct  325  QADKSVGQKLASRLNVRPSI  344



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+DYFPSRYDPVRHAE +P P+AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+TYEIRSIWISYWS
Sbjct  413  LTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNIRPSI  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   380 bits (977),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNF   NEQLAFCPSIVVPG+YYSDDK+LQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFLYMNEQLAFCPSIVVPGVYYSDDKMLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNHYDGSMNFMHRDEEIDYFPSRYD VRHAE YP P+ V
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYRSF+PDRQERFI RWV+ALSDPRITYEIRSIWI+YWS
Sbjct  413  CSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  CSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   379 bits (973),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR T+EIRSIWISYWS
Sbjct  413  CSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   379 bits (972),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  CSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   379 bits (972),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  CSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REKC+I KENNFKQPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSIWISYWS
Sbjct  413  LTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   377 bits (967),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKS+GQK+ASRLN+RP++
Sbjct  473  QADKSVGQKLASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   376 bits (965),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+ALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   376 bits (965),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P+ V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSIWISYWS
Sbjct  413  LSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIASRLN+RP++
Sbjct  473  QADKSLGQKIASRLNVRPSI  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   375 bits (964),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCPSI+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPSIIVPGLYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAE+YP P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNF+QPGERYRSF+PDRQERFI RWVDALSDPR+TYEIRSIWISYWS
Sbjct  413  CSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            +ADKSLGQK+ASRL++RP++
Sbjct  473  KADKSLGQKLASRLSVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   375 bits (963),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  286  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  345

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  346  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  405

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  406  CSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  465

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RPN+
Sbjct  466  QADKSLGQKLASRLNVRPNI  485



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   375 bits (963),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YP P AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G RE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   375 bits (963),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RPN+
Sbjct  473  QADKSLGQKLASRLNVRPNI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   375 bits (963),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR+KC++ KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIASRLN+RP M
Sbjct  473  QADKSLGQKIASRLNIRPTM  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  292  WPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  351

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  352  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  411

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  412  CSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  471

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  472  QADKSLGQKLASRLNVRPSI  491



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P  V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR+KCVI KENNFKQPGERYRS++PDRQERFICRWVDALSD R+T+EIRSIWISYWS
Sbjct  413  LSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIA+RLN+RP M
Sbjct  473  QADKSLGQKIATRLNVRPTM  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQP+GR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P+ V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSDPR+T+EIRSIWISYWS
Sbjct  413  LSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIASRLN+RP++
Sbjct  473  QADKSLGQKIASRLNVRPSI  492



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTR+FSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRVFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDP RHAER+P P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPPAL  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDA+SDPR+T+EIRSIWI+YWS
Sbjct  413  CTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGVVVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER+P P  +
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRSF PDRQERFI RW DALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN++P+M
Sbjct  473  QADKSLGQKLATRLNVKPSM  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKS+GQK+AS LN+RP++
Sbjct  473  QADKSVGQKLASLLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPE+L+PLQPVGR+VLNKNIDNF  ENEQLAFCP+I+VPGIYYSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEELLPLQPVGRMVLNKNIDNFLAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP N+PKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RPN+
Sbjct  473  QADKSLGQKLASRLNVRPNI  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  281  WPEDLLPLQPVGRMVLNKNIDNFFTENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  340

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MN MHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  341  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  400

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  401  CSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  460

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  461  QADKSLGQKLASRLNVRPSI  480



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+YP P AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   374 bits (961),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAE +P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+REKC+I KENNFKQPGERYRS++ DRQERFICRWV+A SDPR+T+EIRSIWISYWS
Sbjct  413  CTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYD VRHAE+YP P AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF P+RQERFICRW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERYP P+A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRLN+RP++
Sbjct  473  QADRSLGQKLASRLNVRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   372 bits (956),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  251  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQ  310

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P AV
Sbjct  311  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAV  370

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  371  CSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWS  430

Query  181  QADKSLGQKIASRLNM  134
            QADKSLGQK+ASRLN+
Sbjct  431  QADKSLGQKLASRLNV  446



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP  +
Sbjct  353  RHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWISYWS
Sbjct  413  CGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QA KSLGQK+ASRLN+RPN+
Sbjct  473  QACKSLGQKLASRLNVRPNI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAER+P P AV
Sbjct  353  RHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWI+YWS
Sbjct  413  CSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QA KSLGQK+ASRLN++PN+
Sbjct  473  QACKSLGQKLASRLNVKPNI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   374 bits (960),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP  +
Sbjct  353  RHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWISYWS
Sbjct  413  CGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QA KSLGQK+ASRLN+RPN+
Sbjct  473  QACKSLGQKLASRLNVRPNI  492



>emb|CDP01802.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   373 bits (958),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 193/207 (93%), Gaps = 7/207 (3%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFFNENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  263  WPEDILPLQPVGRLVLNRNIDNFFNENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQ  322

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEE-------IDYFPSRYDPVRHAER  383
            R+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE       +DYFPSRYDPVRHAE 
Sbjct  323  RHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEHCTFCPCVDYFPSRYDPVRHAEM  382

Query  382  YPTPAAVCTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRS  203
            +P P+AV TG+REK +I KENNFKQPGERYRSF+PDRQERFICRWVDALSDPR+TYEIRS
Sbjct  383  HPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRS  442

Query  202  IWISYWSQADKSLGQKIASRLNMRPNM  122
            IWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  443  IWISYWSQADKSLGQKLASRLNIRPSI  469



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   374 bits (960),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+DTQ
Sbjct  313  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQ  372

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP  +
Sbjct  373  RHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEI  432

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G+REKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIR IWISYWS
Sbjct  433  CGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWS  492

Query  181  QADKSLGQKIASRLNMRPNM  122
            QA KSLGQK+ASRLN+RPN+
Sbjct  493  QACKSLGQKLASRLNVRPNI  512



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   373 bits (958),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  292  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQ  351

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P AV
Sbjct  352  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAV  411

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  412  CSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWS  471

Query  181  QADKSLGQKIASRLNM  134
            QADKSLGQK+ASRLN+
Sbjct  472  QADKSLGQKLASRLNV  487



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   373 bits (958),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE +P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSIWISYWS
Sbjct  413  CTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S GQK+ASRLN+RP++
Sbjct  473  QADRSFGQKLASRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   373 bits (957),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P AV
Sbjct  353  RHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKRE+CVI KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S+GQK+AS LNMRP++
Sbjct  473  QADRSVGQKLASHLNMRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   373 bits (957),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  291  WPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  350

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  351  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVI  410

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWISYWS
Sbjct  411  HTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWS  470

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LNMRP++
Sbjct  471  QADKSLGQKLASHLNMRPSI  490



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   372 bits (955),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  277  WPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  336

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  337  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVI  396

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWISYWS
Sbjct  397  HTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWS  456

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LNMRP +
Sbjct  457  QADKSLGQKLASHLNMRPGI  476



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   373 bits (957),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+P P+AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALS+PR+T+E+RSIWISYWS
Sbjct  413  CSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LN+RP++
Sbjct  473  QADKSLGQKLASHLNVRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   372 bits (956),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE++P P  V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADK+LGQKIASRLN+RP M
Sbjct  473  QADKTLGQKIASRLNVRPTM  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   372 bits (956),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   372 bits (956),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCPS++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P+ V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKC+IGKENNFKQPGERYRSFS DRQERFI RW+DALSD R+T+EIRSIWISYWS
Sbjct  413  YSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIASRLN+RP++
Sbjct  473  QADKSLGQKIASRLNVRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P  +
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+RE+C+I KENNFKQPGERYRSF+PDRQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRLN+RP++
Sbjct  473  QADQSLGQKLASRLNVRPSI  492



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH++G MNF+HR+EE++YFPSRYDPVRHAERYP P  +
Sbjct  353  RHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN++P+M
Sbjct  473  QADKSLGQKLASRLNVKPSM  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   372 bits (956),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWISYWS
Sbjct  413  HTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LNMRP++
Sbjct  473  QADKSLGQKLASHLNMRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWISYWS
Sbjct  413  HTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LNMRP +
Sbjct  473  QADKSLGQKLASHLNMRPGI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+TYEIRSIWISYWS
Sbjct  413  CTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S GQK+ASRLN+RP++
Sbjct  473  QADRSFGQKLASRLNVRPSI  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVR+AER+P P  +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP A+
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN+RP++
Sbjct  473  QADKSLGQKLANRLNVRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  278  WPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  337

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  338  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  397

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  398  CSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWS  457

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADK+LGQK+ASRLN+RP++
Sbjct  458  QADKTLGQKLASRLNVRPSI  477



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   372 bits (954),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  312  WPEDILPLMPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  371

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  372  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVI  431

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKC+I KENNFKQPGERYRSFSPDR+ERF+ RWV+ALSDPR+TYEIRSIWISYWS
Sbjct  432  HTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWS  491

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LNMRP +
Sbjct  492  QADKSLGQKLASHLNMRPGI  511



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YP P+A+
Sbjct  353  RYRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPSAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G  EKCVI KENNFKQPGERYRSFS DR+ERFI RWV+A+SDPR+TYEIRSIWISYW 
Sbjct  413  LSGNCEKCVIPKENNFKQPGERYRSFSSDRKERFIRRWVEAMSDPRVTYEIRSIWISYWY  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIAS LNMRP M
Sbjct  473  QADKSLGQKIASHLNMRPTM  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   371 bits (952),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLNKNID+FF ENEQLAFCP I+VPGI+YSDDKLLQTR+FSYSDTQ
Sbjct  293  WPEDIVPLQPVGRLVLNKNIDSFFAENEQLAFCPGIIVPGIHYSDDKLLQTRVFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P+ V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+RE+C+I KENNFKQPGERYRSF+PDR+ERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASR+N+RPN+
Sbjct  473  QADQSLGQKLASRMNVRPNI  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   370 bits (951),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P  +
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REKCVI KENNFKQPGERYRS++PDRQERFICRWV+ALSDPR+TYEIR+IWISYWS
Sbjct  413  LTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D+SLGQKIA+RLN++P+M
Sbjct  473  QCDRSLGQKIATRLNVKPSM  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   364 bits (934),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  109  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQ  168

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +P P A+
Sbjct  169  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAI  228

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WISYWS
Sbjct  229  CSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWS  288

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIASRL+MRPN+
Sbjct  289  QADRSLGQKIASRLSMRPNI  308



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   370 bits (951),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADK+LGQK+ASRLN+RP++
Sbjct  473  QADKTLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   370 bits (951),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   370 bits (950),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P+A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKREKC+I KENNFKQPGERYRS++PDRQERFI RW+DALSDPR+T+EIRSIWISYWS
Sbjct  413  FNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   370 bits (950),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+P P  +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  LSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   369 bits (948),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYS+DKLLQTRIFSY+DTQ
Sbjct  277  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSNDKLLQTRIFSYADTQ  336

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDPVRHAE +PTP  +
Sbjct  337  RHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEI  396

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G+REKC+I KENNFKQPGERYRS++PDRQERF+CRWVDALSDPR+T+EIR IWISYWS
Sbjct  397  CGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISYWS  456

Query  181  QADKSLGQKIASRLNMRPNM  122
            QA KSLGQK+ +RLN+RP++
Sbjct  457  QACKSLGQKLTARLNVRPSI  476



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDPVRHAER+P P  +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKC+I KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  LSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI+YWS
Sbjct  413  CTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S+GQK+AS LN+RP++
Sbjct  473  QADRSVGQKLASHLNVRPSI  492



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  278  WPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  337

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  338  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  397

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  398  CSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWS  457

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADK+LGQK+AS LN+RP++
Sbjct  458  QADKTLGQKLASHLNVRPSI  477



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   370 bits (949),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  CTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S+GQK+AS LN+RP++
Sbjct  473  QADRSVGQKLASHLNVRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   369 bits (948),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR++LNKNIDNFF+ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRMILNKNIDNFFSENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE +P P+ V
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REKCVI KENNFKQPGERYRS++PDRQ RFICRWV+ALSDPR+TYEIRSIWISYWS
Sbjct  413  LTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D+SLGQKIA+RLN++P+M
Sbjct  473  QCDRSLGQKIATRLNVKPSM  492



>prf||1906388A catalase
Length=492

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   369 bits (947),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYR+F+P+RQERFI RW+DALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   369 bits (947),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLNKNIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLMPVGRLVLNKNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P  V
Sbjct  353  RHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR++C+I KENNFKQPGERYR+F+PDRQERF+CRWVDALSDPR+T+EIRSIWISYW+
Sbjct  413  LTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNVRPTM  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  145  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQ  204

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP P AV
Sbjct  205  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAV  264

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSIWISYWS
Sbjct  265  CSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWS  324

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+AS LN+RP++
Sbjct  325  QADRSLGQKLASHLNVRPSI  344



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLNKNIDNFF ENEQLAFCP++VVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRMVLNKNIDNFFGENEQLAFCPALVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKC+I KENNFKQPGERYRSFSPDRQERFI RWV+ALSDP++T+EIRSIWISYWS
Sbjct  413  LTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSL QK+A+RL+++P+M
Sbjct  473  QCDKSLSQKLATRLSVKPSM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   367 bits (943),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLNKNIDNFFNENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRMVLNKNIDNFFNENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P++V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK +I KENNFKQPGERYRS++PDRQERF+ RWVDALSDPR+T+EIR IWISYWS
Sbjct  413  VTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQKIA+RLN++P M
Sbjct  473  QCDKSLGQKIATRLNVKPTM  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAER+P P+AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWVDALS+PR+T+E+RSIWISYWS
Sbjct  413  CSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LN+RP++
Sbjct  473  QADKSLGQKLASHLNVRPSV  492



>prf||2104177A catalase
Length=492

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+YP P   
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVR  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSIW+SYWS
Sbjct  413  LSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPN  125
            QADKSLGQKIASRLN++PN
Sbjct  473  QADKSLGQKIASRLNVKPN  491



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPEDL+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  281  WPEDLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  340

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRY+PVRHAE+YPTP AV
Sbjct  341  RHRLGPNYLQLPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTPPAV  400

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C GKRE+CVI KENNFK+PGERYR F P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  401  CAGKRERCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWISYWS  460

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LN+RPN+
Sbjct  461  QADKSLGQKLASHLNVRPNI  480



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSIWISYWS
Sbjct  413  CTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S GQK+ASRLN+RP++
Sbjct  473  QADRSFGQKLASRLNVRPSI  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNHYDG MNFMHRDEEIDYFPSRYDP RHAE+YP P   
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVR  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR+KCVI KENNFKQPGERYRSFSPDRQERFI R V  LSDPR+T+E+RSIW+SYWS
Sbjct  413  LSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPN  125
            QADKSLGQKIASRLN++PN
Sbjct  473  QADKSLGQKIASRLNVKPN  491



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRMVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK VI KENNFKQPGERYRSF+PDR++RFI RWV+ALSDPR+TYEIRSIWISYWS
Sbjct  413  LTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIAS LNMRP M
Sbjct  473  QADKSLGQKIASHLNMRPTM  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRYDP RHAE +P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREKCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+T+EIRSIWISYWS
Sbjct  413  CTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S GQK+ASRLN+RP++
Sbjct  473  QADRSFGQKLASRLNVRPSI  492



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   367 bits (941),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MN MHRDEE++YFPSRYDP RHAE++P P  +
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNIMHRDEEVNYFPSRYDPARHAEQHPIPPRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKC+I KENNFKQPGERYRSF+PDR+ERFI RWV+AL+D RITYEIRSIWISYWS
Sbjct  413  LSGKREKCIILKENNFKQPGERYRSFTPDRKERFIRRWVEALTDTRITYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LNMRP M
Sbjct  473  QADKSLGQKLASHLNMRPTM  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI YSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGISYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG RE+C I KENNFKQPGERYRSF+PDRQ+RF+ RWVDALSDPR+T+EIRS WISYWS
Sbjct  413  CTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LN+RP++
Sbjct  473  QADRSLGQKIASHLNLRPSI  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   357 bits (917),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  66   WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  125

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAER+P P   
Sbjct  126  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVA  185

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKR++  I KENNFKQPGE+YRSF PDRQERFI RWVDALSDPR+T+EIRSIW+SYW+
Sbjct  186  LNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWT  245

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  246  QADKSLGQKLASRLNIRPTM  265



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYD VRHAE+YP P AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF P+RQERFI RW++ALSDPRIT+EIRSIWISYWS
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   365 bits (938),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDIVPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKCVIGKENNFKQPGERYRSF P RQERF+ RWV+ALSD R+T+EIR IWI+YWS
Sbjct  413  LTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQK+A+RLNMRP+M
Sbjct  473  QCDKSLGQKLATRLNMRPSM  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   365 bits (937),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P  +
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EI +IWISYWS
Sbjct  413  LTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG+KIASRLN+RP M
Sbjct  473  QADKSLGEKIASRLNVRPTM  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REKC+I KENNFKQPGERYRSFSPDRQERF+ RW+ +LSDPR+T+EIR+IW++YW 
Sbjct  413  LNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWY  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RPNM
Sbjct  473  QADKSLGQKLASRLNVRPNM  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAE +P P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  CSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIASRL+MRPN+
Sbjct  473  QADRSLGQKIASRLSMRPNI  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   365 bits (936),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 193/204 (95%), Gaps = 4/204 (2%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYEIRSIWI  194
            C+GKRE+CVI KENNFK+PGERYRSF+P+    RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSIWI  472

Query  193  SYWSQADKSLGQKIASRLNMRPNM  122
            SYWSQADK+LGQK+ASRLN+RP++
Sbjct  473  SYWSQADKTLGQKLASRLNVRPSI  496



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVHYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAERYP P+ V
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERYPIPSNV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G REK  I KENNFKQPGERYRS  P RQERFICR VDALSDPR+T+EIRSIWISYWS
Sbjct  413  LNGCREKQCIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG K+ASRLN+RP M
Sbjct  473  QADKSLGMKVASRLNVRPTM  492



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+CVI KENNFK+PGERYRSF+P+RQERFI RW++AL DPRIT+EIRSIWI YWS
Sbjct  413  CSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADK+ GQK+ASRLN+RP++
Sbjct  473  QADKTFGQKLASRLNVRPSI  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYDPVRHAER+P P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC I KENNFKQPGERYRS++PDRQ+RF  RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  CSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS L+ RPN+
Sbjct  473  QADRSLGQKIASHLSTRPNI  492



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+YSDTQ
Sbjct  224  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQ  283

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  284  RHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNI  343

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRS+WISYWS
Sbjct  344  LSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWS  403

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  404  QADKSLGQKLASRLNVRPSI  423



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAERYP P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNFK+PGERYRS++PDRQERF+ RWVDALSD R+T+EIRSIWISYWS
Sbjct  413  CSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+AS LN+RP++
Sbjct  473  QADRSLGQKLASHLNVRPSI  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   364 bits (934),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRD+E+DYFPSRYDPVRHAERYP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G R++ +I KENNFKQPGERYRS+ P RQERFICRWVDALSDPRIT+EIR+IWISYWS
Sbjct  413  LNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKS+G K+ASRLN+RP M
Sbjct  473  QADKSVGMKLASRLNVRPTM  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQ+AFCP++VVPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQVAFCPALVVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC  HNNH+DG MNFMHRDEE++YFPSR+DPVRHAER+P+P A+
Sbjct  353  RHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC+I KENNFKQPGERYRS++PDRQERF+ RWV+ALSD R T+EIRSIWISYWS
Sbjct  413  CSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP+ 
Sbjct  473  QADKSLGQKLASRLNVRPSF  492



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFM+RDEE++YFPSR+DP RHAE+YP P  +
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR++C+I KENNFKQPGERYRS+SPDRQERFICRW++ALSDPR+T+EIR IWISYWS
Sbjct  413  LTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG+KIASRLN+RP M
Sbjct  473  QADKSLGEKIASRLNVRPTM  492



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNHYDG MNFMHR EE+DYFPSRYDPVRHAE++P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRGEEVDYFPSRYDPVRHAEKFPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+RE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSIWISYW+
Sbjct  413  CTGRRERQIIPKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG K+ASRLN++  M
Sbjct  473  QADKSLGMKVASRLNVKATM  492



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   363 bits (932),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 192/204 (94%), Gaps = 4/204 (2%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPE+L+PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPENLLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPD----RQERFICRWVDALSDPRITYEIRSIWI  194
            C+GKRE+CVI KENNFK+PG RYRSF+PD    RQERFI RW++ALSDPRIT+EIRSIWI
Sbjct  413  CSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSIWI  472

Query  193  SYWSQADKSLGQKIASRLNMRPNM  122
            SYWSQADK+LGQK+ASRLN+RP++
Sbjct  473  SYWSQADKTLGQKLASRLNVRPSI  496



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   363 bits (932),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP +VVPG++YSDDK+LQTRIFSYSD+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGLVVPGVHYSDDKMLQTRIFSYSDSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAE++P P  V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR++C I KENNFKQPGERYR+FSPDRQERFI RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNVRPTM  492



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   362 bits (930),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P P+ V
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPIPSNV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDALSDPRIT+EIRSIW+SYWS
Sbjct  413  INGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALSDPRITHEIRSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG K+ASRLN+RP M
Sbjct  473  QADKSLGMKVASRLNVRPTM  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +P P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  CSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LNMRPN+
Sbjct  473  QADRSLGQKIASHLNMRPNI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++Y PSR+DPVRHAER+P P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+REKC+I KENNFKQPGERYRS++PDRQERF  RWV+ALSDPR+T+EI SIWISYW+
Sbjct  413  CTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DK LGQK+A+RLN+RP++
Sbjct  473  QCDKFLGQKLATRLNVRPSI  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+IVVPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER+P P+ +
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REKCVI KENNFKQPGERYRS+ P+RQERFI RWV+ALSDPR+T+EI+SIWISYWS
Sbjct  413  LTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQKIA+RLN++P M
Sbjct  473  QCDKSLGQKIATRLNVKPCM  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSRYD VRHAE +P P A+
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REKC I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  CSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LNMRPN+
Sbjct  473  QADRSLGQKIASHLNMRPNI  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYSDDK+LQTRIF+YSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGVYYSDDKMLQTRIFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSRYDPVRHAERYP P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  473  QADKSLGQKLASRLNVRPSI  492



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 187/200 (94%), Gaps = 2/200 (1%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLN+NIDNFF ENEQLAFCPSIVVPG++YSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLMPVGRLVLNRNIDNFFAENEQLAFCPSIVVPGVFYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+YFPSRYDPVRHAERYP P A+
Sbjct  353  RHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERYPIPTAM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREK +I KENNFKQPGERYRS++PDRQERFICRWVDALSD   T+EIRS+WISYWS
Sbjct  413  LTGKREKTIIEKENNFKQPGERYRSWTPDRQERFICRWVDALSD--XTHEIRSVWISYWS  470

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP++
Sbjct  471  QADKSLGQKLASRLNVRPSI  490



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   361 bits (926),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+IVVPG+Y SDDKLLQTRIFSYSD Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFWPAIVVPGVYCSDDKLLQTRIFSYSDAQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR+KC+I KENNFKQPGERYRS++PDRQERFICRWVDALSDPR+T+EIRSIW SYWS
Sbjct  413  LTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADK+LGQKIASRLN+RP M
Sbjct  473  QADKTLGQKIASRLNVRPTM  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   360 bits (925),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFVENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKR++C+I KENNFKQPGERYRS++PDRQERFICRWVDALS+PR+T+EIR+IW+SYWS
Sbjct  413  LNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN++P M
Sbjct  473  QADKSLGQKLASRLNVKPTM  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   360 bits (925),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RH+E YP P  V
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREK  I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T+EIRSIWISYWS
Sbjct  413  LSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNVRPTM  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL  VGR+VLN+NIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLLLVGRMVLNRNIDNFFTENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAE++P P  +
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKC+I KENNFKQPGERYRSF+ DRQERFI RWVDALSDPR+T+EI SIWISYWS
Sbjct  413  CSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQK+A+ LN++PNM
Sbjct  473  QCDKSLGQKLATHLNLKPNM  492



>ref|NP_564121.1| catalase 1 [Arabidopsis thaliana]
 sp|Q96528.3|CATA1_ARATH RecName: Full=Catalase-1 [Arabidopsis thaliana]
 gb|AAM97090.1| expressed protein [Arabidopsis thaliana]
 gb|AAQ56816.1| At1g20630 [Arabidopsis thaliana]
 dbj|BAE99222.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29998.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   360 bits (923),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT   V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWISYWS
Sbjct  413  CSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN+RPN 
Sbjct  473  QADKSLGQKLATRLNVRPNF  492



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   360 bits (923),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF+YSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSIWISYWS
Sbjct  413  CHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRP  128
            QAD+SLGQK+ASRLN++P
Sbjct  473  QADRSLGQKLASRLNVKP  490



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   360 bits (923),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIIPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDG+MNFMHRDEE+DYFPSR+DP +HA RYP P++ 
Sbjct  353  RHRLGPNYLLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSST  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI+SIW+SYWS
Sbjct  413  CNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  473  QADRSLGQKLASRLSAKPSM  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   360 bits (923),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENE LAF P++VVPGIYY++DK+LQ RIF+YSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEMLAFNPALVVPGIYYTNDKMLQGRIFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DGSMNFMHRDEE+DYFPSR+DPVRHAE +P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C GKREK VI KENNFKQPGERYRSF+PDRQERFI RWV+ LSDPR+TYEIRSIWISYWS
Sbjct  413  CHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRP  128
            QAD+SLGQK+ASRLN++P
Sbjct  473  QADRSLGQKLASRLNVKP  490



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++Y PSR DP RHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREK +I KENNFKQPGE YRS++PDRQERF+CRWVDALSDPR T+EIRSIWISYWS
Sbjct  413  LTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNIRPTM  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+YSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKMLQTRIFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ SRLN+RP++
Sbjct  473  QADKSLGQKLLSRLNVRPSI  492



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  206  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  265

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERYP P+AV
Sbjct  266  RYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAV  325

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWISYWS
Sbjct  326  YTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWS  385

Query  181  QADKSLGQKIASRLNMRPN  125
            QADKSLG K+AS  N++ N
Sbjct  386  QADKSLGHKLASHFNLKIN  404



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKRE+C+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWISYW+
Sbjct  413  CSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRP  128
            QADKSLGQK+ASRLN+RP
Sbjct  473  QADKSLGQKLASRLNVRP  490



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDK+LQTRIF+YSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAHVVPGIYYSDDKVLQTRIFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC  HNNH++G MNFMHRDEE++YFPSR+DPVRHAERYP P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKREKCVI KENNFKQPGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ SRLN+RP++
Sbjct  473  QADKSLGQKLLSRLNVRPSI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   359 bits (921),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+ P P  +
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LN++P++
Sbjct  473  QADRSLGQKIASHLNLKPSI  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   358 bits (920),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP P+A 
Sbjct  353  RHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSAT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSIW+SYWS
Sbjct  413  LTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  473  QADRSLGQKLASRLSAKPSM  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   358 bits (920),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIVPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP P+A 
Sbjct  353  RHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSAT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK VI KENNFKQPGERYRS+ P RQ+RFI RW+DALSDPR+T+EIRSIW+SYWS
Sbjct  413  LTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  473  QADRSLGQKLASRLSAKPSM  492



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 193/226 (85%), Gaps = 26/226 (12%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAE+YPTP AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAV  412

Query  361  CTGKREK--------------------------CVIGKENNFKQPGERYRSFSPDRQERF  260
            C+GKRE+                          C+I KENNFK+PGERYRSF+P+RQERF
Sbjct  413  CSGKRERVSNQIKPIFFSVSVSYGSESLKFVLQCIIEKENNFKEPGERYRSFAPERQERF  472

Query  259  ICRWVDALSDPRITYEIRSIWISYWSQADKSLGQKIASRLNMRPNM  122
            I RW++ALSDPRIT+EIRSIWISYWSQADKSLGQK+ASRLN+RP++
Sbjct  473  IRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  518



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   358 bits (919),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DP  HAERYP P AV
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWISYWS
Sbjct  413  YTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISYWS  472

Query  181  QADKSLGQKIASRLNMR  131
            QADKSLGQK+ASRLN++
Sbjct  473  QADKSLGQKLASRLNVK  489



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   358 bits (919),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNH++G MNFMHRDEE++YFPSRY P RHAE +P P+++
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+ R+TYEIRSIWISYWS
Sbjct  413  ITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S GQK+A+RLN+RP++
Sbjct  473  QADRSFGQKLATRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   358 bits (919),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSIW+SYWS
Sbjct  413  LSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNVRPAM  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  294  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQ  353

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+PTP A 
Sbjct  354  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAA  413

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSIWISYWS
Sbjct  414  LSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWS  473

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LNMRP++
Sbjct  474  QADRSLGQKIASHLNMRPSI  493



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   358 bits (918),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGR+VLNKNIDNFF ENEQLAFCP+IVVPG+ YSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLLPVGRMVLNKNIDNFFAENEQLAFCPAIVVPGVSYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKCS HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER+P P+ V
Sbjct  353  RHRLGPNYLQLPVNAPKCSHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERHPIPSNV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKRE+ +I KENNFKQPGERYRS  P RQERFICR VDAL DPRIT+EIRSIW+SYW 
Sbjct  413  INGKRERQIIAKENNFKQPGERYRSMDPARQERFICRVVDALFDPRITHEIRSIWVSYWF  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG K+ASRLN+RP M
Sbjct  473  QADKSLGMKVASRLNVRPTM  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   358 bits (918),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP RHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREK +I KENNFKQPGE YRS++P RQERF+CRWVDALSD R T+EIRSIWISYWS
Sbjct  413  LTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNIRPTM  492



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   357 bits (917),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPAN+PKC+ HNNH+DG MNFMHRDEE++YFPSRYDPVRHAER P P   
Sbjct  353  RHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKREKC+I KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LN++P++
Sbjct  473  QADRSLGQKIASHLNLKPSI  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   357 bits (916),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLN+NIDNFF+ENEQLAFCP I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDIIPLQPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP +HA RYP P+  
Sbjct  353  RHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSVN  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK VI KENNFKQPGERYRS+ P RQERFI RW+DALSDPR+T+EIRSIW+SYWS
Sbjct  413  LTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  473  QADRSLGQKLASRLSAKPSM  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAER+PTP A 
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAA  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKRE+C+  KENNFKQPGERYR+++PDRQ+RF  RW++ALSDPR+T+E+RSIWISYWS
Sbjct  413  LSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LNMRP++
Sbjct  473  QADRSLGQKIASHLNMRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   357 bits (916),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR K  I KENNFKQPG+RYRS++PDRQERFI RWV+ALSDPR+T+EIRSIW+SYWS
Sbjct  413  LSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LN+RP M
Sbjct  473  QADKSLGQKLASHLNVRPTM  492



>gb|AAC17731.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT   V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWISYWS
Sbjct  413  CSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN+RPN 
Sbjct  473  QADKSLGQKLATRLNVRPNF  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY+DTQ
Sbjct  293  WPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++P P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSIWISYW+
Sbjct  413  LNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIAS LN+RP+M
Sbjct  473  QADKSLGQKIASCLNVRPSM  492



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P  +
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPLPPPM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+R++C++ KENNFKQPGERYRSFS DRQERFI R VDALSDPR+T+EIRSIWISYW+
Sbjct  413  LTGRRDRCMVQKENNFKQPGERYRSFSTDRQERFISRLVDALSDPRVTHEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QA KSLGQK+ASRLN++P++
Sbjct  473  QACKSLGQKLASRLNVKPSI  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P+  
Sbjct  353  RHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+SYWS
Sbjct  413  LNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRL+ +P+M
Sbjct  473  QADKSLGQKLASRLSSKPSM  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER P P  +
Sbjct  353  RHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSIWISYWS
Sbjct  413  LDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LN++P++
Sbjct  473  QADRSLGQKIASHLNLKPSI  492



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   355 bits (911),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG+YYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSR+DPVRHAE +P P+AV
Sbjct  353  RHRLGPNYLQLPVNAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAESHPIPSAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK +I KENNFKQ GERYRSF+PDRQER+I RWVDALSDPR T+EIRSIWISYWS
Sbjct  413  YTGRREKSIIEKENNFKQAGERYRSFAPDRQERYIRRWVDALSDPRCTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+AS LN+RPN 
Sbjct  473  QADKSLGQKLASHLNVRPNF  492



>gb|ACN36234.1| unknown [Zea mays]
Length=340

 Score =   349 bits (896),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  141  WPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQ  200

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P A 
Sbjct  201  RHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAH  260

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S WS
Sbjct  261  IAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWS  320

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  321  QADRSLGQKLASRLSAKPSM  340



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAF P+ VVPGIYYS+DKLLQ RIF+YSDT 
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFNPAHVVPGIYYSEDKLLQGRIFAYSDTH  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNHYDG MN MHRDEEIDYFPSRYDPVRHAER+P P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+RE+ VI KENNFKQP ERYRS++PDRQERF+ RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  LTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIA RLN+RP M
Sbjct  473  QADKSLGQKIAFRLNVRPTM  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  327  WPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQ  386

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P+  
Sbjct  387  RHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRT  446

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+SYWS
Sbjct  447  LNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWS  506

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRL+ +P+M
Sbjct  507  QADKSLGQKLASRLSSKPSM  526



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPG+YYS+DK+LQTR+F+YSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGVYYSNDKMLQTRLFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRY P RHAE +P P+ +
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKR+KCVI KENNFKQPGERYRS++PDRQERF+ RWVD LS+PR+TYEIRSIWISYWS
Sbjct  413  ITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+S GQK+A+RLN+RP++
Sbjct  473  QADRSFGQKLATRLNVRPSI  492



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP PA  
Sbjct  353  RHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPARA  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+SYWS
Sbjct  413  LNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRL+ +P+M
Sbjct  473  QADKSLGQKLASRLSAKPSM  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P+  
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SIWISYWS
Sbjct  413  HSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q+DKSLGQKIA+RLNM+ NM
Sbjct  473  QSDKSLGQKIAARLNMKANM  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDN+F E EQLAF P+ VVPGIYY++DKLLQTRIF+Y DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNYFAETEQLAFNPAFVVPGIYYTEDKLLQTRIFAYGDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNY+QLP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSR+DPVRHA R+P P+ V
Sbjct  353  RHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKR++CVI KENNFKQ GERYRS++PDRQERFICRWVD LSD R+T+EIRSIWISYWS
Sbjct  413  LRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN+RP M
Sbjct  473  QADKSLGQKMATRLNVRPTM  492



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P ++VPG+YY++DKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFGPGLIVPGVYYTEDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P+  
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREKCVI KENNFKQPGERYRSF+P+RQERF+ RWV ALSDPR+T+EI SIWISYWS
Sbjct  413  HTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQKIA+RLNM+ NM
Sbjct  473  QCDKSLGQKIAARLNMKANM  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAE++P P  +
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G REKC I KENNFKQPGE+YRS++PDRQERFI RW+DALSDPR+T+EIR+IWI+YWS
Sbjct  413  LNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DK LGQK+ASRLN++P +
Sbjct  473  QCDKFLGQKLASRLNIKPTL  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P P AV
Sbjct  353  RHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G+REK  I KENNFKQ GER+RS++PDRQ+RFI RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  FSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LNMRPN+
Sbjct  473  QADRSLGQKIASHLNMRPNI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY+DTQ
Sbjct  385  WPEDIVPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQ  444

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+D VRHAE++P P  V
Sbjct  445  RHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPV  504

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              GKR++C+I KENNFKQPGERYRS++PDRQERFI RWV+ALSDPR+T EIRSIWISYW+
Sbjct  505  LNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWT  564

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIAS LN+RP+M
Sbjct  565  QADKSLGQKIASCLNVRPSM  584



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P P A+
Sbjct  353  RHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  CSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS L+MRPN+
Sbjct  473  QADRSLGQKIASHLSMRPNI  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   347 bits (891),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  140  WPEDVFPLQPVGRMVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQ  199

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDP ++A RYP P   
Sbjct  200  RHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVH  259

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+R+K VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIRSIW+S WS
Sbjct  260  ITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSNWS  319

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  320  QADRSLGQKLASRLSAKPSM  339



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   353 bits (905),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAF P+ VVPGIYYSDDKLLQTRIF+YSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFNPAFVVPGIYYSDDKLLQTRIFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNY+QLP NAPKC  HNNH DG MNFMHRDEE++YFPSRYDPVRHAER+P P+ +
Sbjct  353  RHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKRE+ VI KENNFKQPGERYRS++PDRQERFI R VDALSDPR+++EIRSIWISYWS
Sbjct  413  LTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIA+RLN+RP++
Sbjct  473  QADKSLGQKIATRLNVRPSI  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   353 bits (905),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQ VGR+VLNKNIDNFF ENEQLAFCP+IVVPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQAVGRMVLNKNIDNFFAENEQLAFCPAIVVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH+DG MNF+HRDEE++YFPSRYDPVRHAER P P+ +
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REKCVI KENNFKQPGERYRS+ PDRQ RFI RWV+ALSDPR+T+EI+SIWISYWS
Sbjct  413  LTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLG+KIA+RLN++P+M
Sbjct  473  QCDKSLGRKIATRLNVKPSM  492



>dbj|BAJ88747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  334  WPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQ  393

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP PA  
Sbjct  394  RHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPARA  453

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK  I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+SYWS
Sbjct  454  LNGRREKACIDKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWS  513

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRL+ +P+M
Sbjct  514  QADKSLGQKLASRLSAKPSM  533



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   352 bits (903),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLN+NIDNFF+ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDVVPLQPVGRLVLNRNIDNFFSENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP +HA RYP P+  
Sbjct  353  RHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIPSRT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+SYWS
Sbjct  413  LNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRP  128
            QADKSLGQK+ASRL+ +P
Sbjct  473  QADKSLGQKLASRLSSKP  490



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   352 bits (902),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTR+FSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRVFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG+MNFMHRDEE++YFPSR+D  RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKCVI KENNFKQ GERYRSF P RQ+RFI RWVDALSDPRIT+E+R IWISYWS
Sbjct  413  LTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWISYWS
Sbjct  413  LTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLNKNIDNFF ENEQLAF P++VVPGIYY++DKLLQTRIFSYSDTQ
Sbjct  293  WPEDIFPLQPVGRMVLNKNIDNFFAENEQLAFSPALVVPGIYYTEDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNH++G MNFMHRDEE++YFPSR+DPVRHAER+P P+  
Sbjct  353  RHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G REKCVI KENNFKQPGERYRSF PDRQERF+ RWV ALSDPR+T+EI SIWI YWS
Sbjct  413  HSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIFYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q+DKSLGQKIA+RLNM+ NM
Sbjct  473  QSDKSLGQKIAARLNMKANM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKCVI KENNFKQ GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWISYWS
Sbjct  413  LTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   351 bits (901),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+D Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADPQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPK + HNNH++G MNF+HRDEE++YFPSRYDPVRHAE++P P A+
Sbjct  353  RHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+REK  I KENNFKQ GER+RS++PDRQ+RF  RWVDALSDPR+T+EIRS+WISYWS
Sbjct  413  CSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS L+MRPN+
Sbjct  473  QADRSLGQKIASHLSMRPNI  492



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDP RHAERYP P AV
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKRE+CVI KENNFK+PGERYRS++PDRQERFI RWVDALSDPR+T+EIRSIWI+YWS
Sbjct  413  CTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWS  472

Query  181  QADKSLGQKIASRLN  137
            QAD+S+GQK+AS LN
Sbjct  473  QADRSVGQKLASHLN  487


 Score =   356 bits (913),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  774  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  833

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLP NAPKC+ HNNH+DG MNFM RDEEI+YFPSR DP RHAERYP P+AV
Sbjct  834  RYRLGPNYLQLPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAV  893

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKRE+CVI KENNFKQPGERYRS+  DRQERF+ RWVDALSDPR+T+EIR+IWISYWS
Sbjct  894  YTGKRERCVIEKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWS  953

Query  181  QADKSLGQKIASRLNMRPN  125
            QADKSLG K+AS  N++ N
Sbjct  954  QADKSLGHKLASHFNLKIN  972



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDK+LQTRIFSY+D+Q
Sbjct  293  WPEDIIPLQPVGRLVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKMLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNF+HRDEE++YFPSR+DPVRHAE+ P P A 
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPIPTAN  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +  REKC I K+NNFKQPGERYRS++PDRQ+RF+ RWVDALSDPR+T+EIRSIWISYWS
Sbjct  413  FSACREKCNIPKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQKIAS LNMRP++
Sbjct  473  QADRSLGQKIASHLNMRPSI  492



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDVLPLQPVGRLVLNRNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPK + HNNH++G MNFMHRDEE++YFPSRYDPVRHA++ P P+  
Sbjct  353  RHRLGPNYLQLPVNAPKNAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHADKVPIPSVP  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G+REK  I KENNFKQPGERYRS+ PDRQERFI RWVDALSDPR+T EIRSIWISYW+
Sbjct  413  FSGRREKVSIEKENNFKQPGERYRSWDPDRQERFIRRWVDALSDPRLTQEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNVRPTM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWISYWS
Sbjct  413  LTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWISYWS
Sbjct  413  LTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   350 bits (898),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DGSMNFMHRDEE++YFPSR+D  RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKCVI KENNF+Q GERYRSF P RQ+RF+ RWVDALSDPRIT+E+R IWISYWS
Sbjct  413  LTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   343 bits (880),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  103  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQ  162

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP P  V
Sbjct  163  RHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRV  222

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+SYWS
Sbjct  223  LSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWS  282

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRL ++PNM
Sbjct  283  QCDASLGQKLASRLKIKPNM  302



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  294  WPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQ  353

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P A 
Sbjct  354  RHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAH  413

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S WS
Sbjct  414  IAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWS  473

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  474  QADRSLGQKLASRLSAKPSM  493



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQ+RIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQSRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR +PVRHAE+YPT   V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHREEEVNYFPSRLNPVRHAEKYPTSPIV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWISYWS
Sbjct  413  CSGNREKCIIKKENNFQQPGERYRSWDSDRQERFVKRFVEALAEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN++PN 
Sbjct  473  QADKSLGQKLATRLNVKPNF  492



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH+DG MNFMHRDEE+ YFPSRYDPVRHAE+ P P  +
Sbjct  353  RHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVIYFPSRYDPVRHAEQSPIPPVM  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR KCVI KENNFKQPGER+RS+ PDRQERFI R V ALSDPR+T+E+ +IW+SYWS
Sbjct  413  LSGKRNKCVIEKENNFKQPGERFRSWDPDRQERFIRRIVGALSDPRVTHEVCTIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPN  125
            QADKSLGQKIASRLN++P+
Sbjct  473  QADKSLGQKIASRLNVKPS  491



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGR+VLNKNIDNFF ENEQLAFCP IVVPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLIPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+YP P  V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKYPIPQNV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK +I KENNF++PG RYRSF P RQERFICRW+ ALSDPR+T EIRSIWISYWS
Sbjct  413  LNGRREKQIIAKENNFEEPGVRYRSFDPARQERFICRWIGALSDPRVTPEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG K+A+RLN++P M
Sbjct  473  QADKSLGMKLANRLNVKPTM  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  154  WPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  213

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  214  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRV  273

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWISYWS
Sbjct  274  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWS  333

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D +LGQK+ASRLN++P+M
Sbjct  334  QCDAALGQKLASRLNLKPSM  353



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKN+DNFF ENEQLAF P+ VVPGIYYS+DKLLQ RIF+YSDT 
Sbjct  293  WPEDILPLQPVGRLVLNKNVDNFFAENEQLAFNPAFVVPGIYYSNDKLLQARIFAYSDTH  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLP NAPKC+ HNNH+DG MN MHRDEEI+YFPS++DPVRHAERYP P+ +
Sbjct  353  RYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKREK +I KENNFKQPGERYRS++PDRQERFI RW+ AL++PR+T+E RSIWISYW+
Sbjct  413  VTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRL+ RP+M
Sbjct  473  QADKSLGQKLASRLSARPSM  492



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDVIPLQPVGRMVLNRNIDNFFTENEQLAFCPGVIVPGIYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYD  ++A RYP P+  
Sbjct  353  RHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDAAKNAPRYPIPSVP  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK +I KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EIRSIW+SYWS
Sbjct  413  LTGRREKTMIKKENNFKQPGERYRSMDPARQERFIKRWIDALSDPRLTHEIRSIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D+SLGQK+ASRL+ +P+M
Sbjct  473  QTDRSLGQKLASRLSAKPSM  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  718  PEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQR  539
            PED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I+VPG+YYSDDKLLQTRIFSY+D+QR
Sbjct  235  PEDVLPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGVYYSDDKLLQTRIFSYADSQR  294

Query  538  YRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAVC  359
            +RLGPNYLQ+PANAPKC+ HNNH++G MNFMHRDEE++YFPSRYDPVRHAER P P  + 
Sbjct  295  HRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRIL  354

Query  358  TGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWSQ  179
             GKREKC+I KENNFKQPGERYRS++ DRQERF+ RWVDALS+PR+T+EIRSIWISYWSQ
Sbjct  355  DGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQ  414

Query  178  ADKSLGQKIASRLN  137
            AD+SLGQKIAS LN
Sbjct  415  ADRSLGQKIASHLN  428



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+VPLQPVGRLVLN+NIDNFF ENEQLAFCP I+VPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  293  WPEDVVPLQPVGRLVLNRNIDNFFAENEQLAFCPGIIVPGVYYSDDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKCS HNNHYDG MNFMHRDEE+DYFPSR+DP   A RYP P+  
Sbjct  353  RHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIPSRT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYRS  P RQERFI RW+DALSDPR+T+EI++IW+SYWS
Sbjct  413  LNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+A RL+++P+M
Sbjct  473  QADRSLGQKLAGRLSVKPSM  492



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  292  WPEDTFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQ  351

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P A 
Sbjct  352  RHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAH  411

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S WS
Sbjct  412  IAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWS  471

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  472  QADRSLGQKLASRLSAKPSM  491



>prf||1803522A catalase
Length=491

 Score =   347 bits (891),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  292  WPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQ  351

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P A 
Sbjct  352  RHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAH  411

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S WS
Sbjct  412  IAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWS  471

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  472  QADRSLGQKLASRLSAKPSM  491



>gb|AIU99480.1| catalase [Saccharum spontaneum]
Length=492

 Score =   347 bits (891),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   347 bits (890),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   347 bits (890),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT    
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTTPVF  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWISYW+
Sbjct  413  CSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRP  128
            QADKSLGQK+ASRLN+RP
Sbjct  473  QADKSLGQKLASRLNVRP  490



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   347 bits (890),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++P+QPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQ+RIFSY+D+Q
Sbjct  293  WPEDVLPMQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQSRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHR+EE++YFPSR+DPVR+A++YPT   V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRNEEVNYFPSRFDPVRNAQKYPTTPIV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC+IGKENNFKQPGERYRS+   RQERF+ R+V+AL++PR+T+EIRSIWISYWS
Sbjct  413  CSGNREKCIIGKENNFKQPGERYRSWDSARQERFVKRFVEALAEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN RP+ 
Sbjct  473  QADKSLGQKLASRLNARPSF  492



>ref|NP_001105310.1| catalase isozyme 2 [Zea mays]
 gb|AAA33440.1| catalase [Zea mays]
Length=491

 Score =   347 bits (890),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  292  WPEDRFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQ  351

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P A 
Sbjct  352  RHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAH  411

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S WS
Sbjct  412  IAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWS  471

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P+M
Sbjct  472  QADRSLGQKLASRLSAKPSM  491



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   347 bits (890),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+A CP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQIALCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P+ V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPSRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   347 bits (890),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT    
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTTPVF  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWISYW+
Sbjct  413  CSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRP  128
            QADKSLGQK+ASRLN+RP
Sbjct  473  QADKSLGQKLASRLNVRP  490



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  199  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQ  258

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP P  V
Sbjct  259  RHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRV  318

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+SYWS
Sbjct  319  LSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWS  378

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRL ++PNM
Sbjct  379  QCDASLGQKLASRLKIKPNM  398



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP+IVVPG++YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDVLPLQPVGRLVLNKNIDNFFNENEQIAFCPAIVVPGVHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHA++YPT    
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLNPVRHADKYPTTPVF  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC+I KENNF+QPGERYRS+  DRQERF+ R+V+AL++PR+T+EIRSIWISYW+
Sbjct  413  CSGNREKCMIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRP  128
            QADKSLGQK+ASRLN+RP
Sbjct  473  QADKSLGQKLASRLNVRP  490



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|AAB07026.1| catalase 1 [Arabidopsis thaliana]
Length=492

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVP I+YSDD +LQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPFIHYSDDNVLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT   V
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REKC I KENNFKQPGERYRS+  DRQERF+ R+V+AL +PR+T+EIRSIWISYWS
Sbjct  413  CSGNREKCFIRKENNFKQPGERYRSWDSDRQERFVKRFVEALWEPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN+RPN 
Sbjct  473  QADKSLGQKLATRLNVRPNF  492



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>ref|XP_010105996.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXC51646.1| Catalase isozyme 1 [Morus notabilis]
Length=359

 Score =   342 bits (876),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP IVVPG+YYSDDKLLQTRIFSYSDTQ
Sbjct  165  WPEDILPLQPVGRMVLNKNIDNFFAENEQLAFCPGIVVPGVYYSDDKLLQTRIFSYSDTQ  224

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHR+EE++YFPSRYDPVRHAERYP P+A+
Sbjct  225  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAI  284

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG+RE+ VI KENNFKQPGERYRSFSPDRQERFI RWV+ALSDPR+T+EIRSIWISYWS
Sbjct  285  CTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWS  344

Query  181  QA  176
            Q 
Sbjct  345  QV  346



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQPVGR+VLN+NIDNFFNENEQLAF P IVVPGIYYSDDK LQ R F+Y DTQ
Sbjct  293  WPEDMFPLQPVGRMVLNRNIDNFFNENEQLAFNPGIVVPGIYYSDDKFLQARTFAYGDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNHYDG MNF HRDEE+DYFPSR+DPVRHAER P P  +
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLPPQL  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKRE+CVI KENNFKQPG+RYRSF+PDRQERF+ R VDALSD R+T+EIRSIWISYWS
Sbjct  413  VSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQKIA+RLN++P+M
Sbjct  473  QCDKSLGQKIATRLNIKPHM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFFNENEQLAF P +VVPGIYYSDDK+LQ RIF+Y DTQ
Sbjct  92   WPEDIIPLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQ  151

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC  HNNHYDG MNFMHRDEE+DYFPS++  V +AE++P P  +
Sbjct  152  RHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRI  211

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREK  I KENNFK PG+RYRS++PDRQERFI R VD LSDPR+T+EIRSIW+SYWS
Sbjct  212  CSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWS  271

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIASRLN+RPN+
Sbjct  272  QADKSLGQKIASRLNVRPNI  291



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   360 bits (923),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -3

Query  721   WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
             WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++VVPGI+YSDDKLLQTRIFSY+D+Q
Sbjct  814   WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQ  873

Query  541   RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
             R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT   V
Sbjct  874   RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIV  933

Query  361   CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             C+G REKC IGKENNFKQPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWISYWS
Sbjct  934   CSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWS  993

Query  181   QADKSLGQKIASRLNMRPNM  122
             QADKSLGQK+A+RLN+RPN 
Sbjct  994   QADKSLGQKLATRLNVRPNF  1013


 Score =   330 bits (847),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF+Y DTQ
Sbjct  332  WPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQ  391

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ PTP   
Sbjct  392  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNS  451

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR IWISYWS
Sbjct  452  YTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWS  511

Query  181  QADKSLGQKIASRLNMRPN  125
            QAD+SLGQK+ASRLN+RP+
Sbjct  512  QADRSLGQKLASRLNVRPS  530



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED  PLQPVGRLVLN+NIDNFF ENEQLAFCP ++VPGIYYSDDKLLQTRIFSYSDTQ
Sbjct  294  WPEDAFPLQPVGRLVLNRNIDNFFAENEQLAFCPGLIVPGIYYSDDKLLQTRIFSYSDTQ  353

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LPANAPKC+ HNNHYDGSMNFMHR EE+DYFPSRYD VR+A RYP P A 
Sbjct  354  RHRLGPNYLLLPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAH  413

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
              G+REK VI KENNFKQPGERYR+  P RQERFI RWVDALSDPR+T+EIR+IW+S WS
Sbjct  414  IAGRREKTVISKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWS  473

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRL+ +P++
Sbjct  474  QADRSLGQKLASRLSAKPSI  493



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPG+ YS+DKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGVSYSEDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR DP R+AE +P P+A+
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREKCVI KENNFKQPGERYRS++PDRQERF+ R V  LSDPRIT+E+R+IWISYW 
Sbjct  413  CSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWI  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQK+A+RLN++P++
Sbjct  473  QCDKSLGQKLATRLNVKPSI  492



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 182/200 (91%), Gaps = 6/200 (3%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVV GIYYSDDKLLQTR+FSYSDTQ
Sbjct  239  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVRGIYYSDDKLLQTRVFSYSDTQ  298

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPKC+ HNNH++G MNFMHRDE+I+YFPSRYDP  HAER+P P A+
Sbjct  299  RHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEQINYFPSRYDPSHHAERFPIPPAL  358

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTGKREK      NNFKQPGERYRS++PDRQERFI  WVDALSDPR+T+EI SIWI+YWS
Sbjct  359  CTGKREK------NNFKQPGERYRSWAPDRQERFINSWVDALSDPRVTHEICSIWITYWS  412

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A RLN+RP++
Sbjct  413  QADKSLGQKLACRLNVRPSI  432



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   345 bits (886),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP+IVVPG+YYSDDKLLQ+RIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQSRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLPANAPK + HNNH++G MNFMHRDEE++YFPSR+D VRH+E++P P  V
Sbjct  353  RHRLGPNYLQLPANAPKSAHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHSEKHPLPPPV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+  + +I KENNFKQPGERYRSF PDRQERFI R VDALSDPR+T+EIRSIWISYWS
Sbjct  413  LTGRCTRAMIEKENNFKQPGERYRSFPPDRQERFIRRVVDALSDPRVTHEIRSIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLG+KIASRLN+RP++
Sbjct  473  QADKSLGEKIASRLNVRPSI  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D +LGQK+ASRLN++P+M
Sbjct  473  QCDAALGQKLASRLNLKPSM  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   345 bits (885),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D +LGQK+ASRLN++P+M
Sbjct  473  QCDAALGQKLASRLNLKPSM  492



>gb|AIU99482.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   344 bits (883),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  QTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENEQLAFCP IVVPGI YS+DKLLQTRIFSYSDTQ
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFAENEQLAFCPGIVVPGISYSEDKLLQTRIFSYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLG NYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRH+ER+P P+ +
Sbjct  353  RHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G+R+KCVI KENNF+QPGERYRS++PDRQERF+ R V  LSDPRIT+E+RSIWISYW+
Sbjct  413  CSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D+SLGQK+A RLN+RP++
Sbjct  473  QCDRSLGQKLAFRLNVRPSI  492



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P+ V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPIPSRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GER+RSF P RQ+RFI RWVDALSDPR+T+E  +IWI+YWS
Sbjct  413  LTGCREKCIIEKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWINYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWV ALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>sp|P55307.1|CATA1_HORVU RecName: Full=Catalase isozyme 1 [Hordeum vulgare]
 gb|AAA96947.1| catalase [Hordeum vulgare subsp. vulgare]
 dbj|BAJ84783.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08157.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97380.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR+DP RHAE+YP P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+SYWS
Sbjct  413  LSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRL ++PNM
Sbjct  473  QCDASLGQKLASRLKIKPNM  492



>ref|XP_010459749.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT    
Sbjct  353  RYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPTTPIT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REK +IGKENNFKQPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+SYW+
Sbjct  413  CSGNREKSIIGKENNFKQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVSYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+ LN++ N+
Sbjct  473  QADKSLGQKLATCLNVKANI  492



>gb|AIU99486.1| catalase [Saccharum spontaneum]
Length=492

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG  EKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCGEKCIIQKENNFKQAGERYRSFDPARQDRFIRRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>ref|XP_004966515.1| PREDICTED: catalase isozyme 1-like [Setaria italica]
Length=547

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  348  WPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  407

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  408  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRV  467

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI R VDALSDPR+T+E RSIWISYWS
Sbjct  468  LTGCREKCIIHKENNFKQAGERYRSFDPARQDRFIQRVVDALSDPRVTHEHRSIWISYWS  527

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  528  QCDASLGQKLASRLNLKPNM  547



>ref|XP_010477308.1| PREDICTED: catalase-1 [Camelina sativa]
Length=492

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT    
Sbjct  353  RYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPTTPIT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REK +IGKENNF+QPGERYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+SYW+
Sbjct  413  CSGNREKSIIGKENNFQQPGERYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVSYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+ LN++ N+
Sbjct  473  QADKSLGQKLATCLNVKANI  492



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNE EQ+AFCP++VVPGI+YSDDKLLQTRIFSY+D+Q
Sbjct  782  WPEDILPLQPVGRLVLNKNIDNFFNEYEQIAFCPALVVPGIHYSDDKLLQTRIFSYADSQ  841

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT   V
Sbjct  842  RHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIV  901

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            CTG REKC IGKENNF+QPGERYRS+  DRQERF+ R+V+ALS+PR+T+EIRSIWISYWS
Sbjct  902  CTGNREKCFIGKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWS  961

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+RLN+RPN 
Sbjct  962  QADKSLGQKLATRLNVRPNF  981


 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+ IDNFFNE EQLAF P +VVPGIYYSDDKLLQ RIF+Y DTQ
Sbjct  300  WPEDILPLQPVGRLVLNRTIDNFFNETEQLAFNPGLVVPGIYYSDDKLLQCRIFAYGDTQ  359

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEEI+Y+PS++DPVR AE+ P P   
Sbjct  360  RHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPTNS  419

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG R KCVI KENNFKQ G+RYRS++PDRQ+RF+ RWV+ LS+PR+T+EIR IWISYWS
Sbjct  420  YTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWS  479

Query  181  QADKSLGQKIASRLNMRPN  125
            QAD+SLGQK+ASRLN+RP+
Sbjct  480  QADRSLGQKLASRLNVRPS  498



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   335 bits (859),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F+Y+DTQ
Sbjct  62   WPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQ  121

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER P P A+
Sbjct  122  RHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAI  181

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSIW+SYWS
Sbjct  182  ISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWS  241

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQK+ASRLN+RPN 
Sbjct  242  QCDKSLGQKLASRLNVRPNF  261



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF+Y DTQ
Sbjct  278  WPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQ  337

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERYP P+ V
Sbjct  338  RHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDV  397

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSIW+SYWS
Sbjct  398  ITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWS  457

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRLN+RP++
Sbjct  458  QADRSLGQKLASRLNVRPSI  477



>ref|XP_010498497.1| PREDICTED: catalase-1-like [Camelina sativa]
Length=492

 Score =   343 bits (880),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQ+AFCP++ VPGI+YSDDKLLQTRIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQIAFCPALAVPGIHYSDDKLLQTRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLP NAPK + HNNH+DG MNFMHRDEE++YFPSR DPVRHAE+YPT    
Sbjct  353  RYRLGPNYLQLPVNAPKSAHHNNHHDGIMNFMHRDEEVNYFPSRMDPVRHAEKYPTTPIT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+G REK +IGKENNFKQPG+RYRS+  DRQERF+ R+++ALS+PR+T+EIRSIW+SYW+
Sbjct  413  CSGNREKSIIGKENNFKQPGDRYRSWDSDRQERFVKRFLEALSEPRVTHEIRSIWVSYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+A+ LN++ N+
Sbjct  473  QADKSLGQKLATCLNVKANI  492



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHA + P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAGKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSDPR+T+E  +IW+SYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWMSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRLN++PNM
Sbjct  473  QCDASLGQKLASRLNLKPNM  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   342 bits (878),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQP+GRLVLN+NIDN+F ENE LAF P+ VVPGI+YS+DKL Q R F+YSDTQ
Sbjct  293  WPEDIFPLQPIGRLVLNRNIDNWFAENEMLAFNPAHVVPGIHYSNDKLFQLRTFAYSDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNY+QLP NAPKC  HNNHYDG MNFMHRDEEIDYF SRYDPVRHAERYP P A+
Sbjct  353  RHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIPNAI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G+REKCVI KENNFKQPGERYRS++PDRQERF+CR V+ALSDPRIT+EIR IW+SYWS
Sbjct  413  ISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D+SLGQK+ASRLN+RPN+
Sbjct  473  QCDQSLGQKLASRLNVRPNI  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   335 bits (858),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED+ PLQ +GRLVLN+NIDN+F ENE LAF P  VVPGI+YS+DKL Q R F+Y+DTQ
Sbjct  71   WPEDMFPLQQLGRLVLNRNIDNWFAENEMLAFDPGHVVPGIHYSNDKLFQLRTFAYADTQ  130

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNY  LP NAPKC+ HNNHYDG MNFMHRDEE+DYFPSRYDPVRHAER P P A+
Sbjct  131  RHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAI  190

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G+REKCVI KENNFKQPG+RYRS++PDRQERF+CR V+ALSDPRIT+EIRSIW+SYWS
Sbjct  191  ISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWS  250

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q DKSLGQK+ASRLN+RPN 
Sbjct  251  QCDKSLGQKLASRLNVRPNF  270



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   342 bits (878),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFF ENE LAF P IVVPGIYYS+DK+LQ RIF+Y DTQ
Sbjct  294  WPEDIIPLQPVGRLVLNKNIDNFFAENEMLAFNPGIVVPGIYYSNDKMLQCRIFAYGDTQ  353

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC   NNHYDG MNFMHRDEE+DYFPSRYDP RHAERYP P+ V
Sbjct  354  RHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDV  413

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG+REK  I KENNFKQPGERYRS++PDRQERF+ RW+ AL DPR+T+E+RSIW+SYWS
Sbjct  414  ITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWS  473

Query  181  QADKSLGQKIASRLNMRPNM  122
            QAD+SLGQK+ASRLN+RP++
Sbjct  474  QADRSLGQKLASRLNVRPSI  493



>gb|ADN94253.1| catalase [Puccinellia chinampoensis]
Length=492

 Score =   342 bits (878),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP+I VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAITVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DPVRHAE+YP P+  
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPSRT  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GER+RSF P  Q+RFI  WVDAL+D R+T+EI+ IWISYWS
Sbjct  413  LTGCREKCIIEKENNFKQAGERFRSFDPAGQDRFIQWWVDALTDTRVTHEIQGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRL M+PNM
Sbjct  473  QCDASLGQKLASRLKMKPNM  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   341 bits (874),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 175/183 (96%), Gaps = 0/183 (0%)
 Frame = -3

Query  670  KNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQRYRLGPNYLQLPANAPK  491
            +NIDNFF ENEQLAFCP+I+VPGIYYSDDKLLQTR+FSY+DTQR+RLGPNYLQLP N+PK
Sbjct  267  RNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPK  326

Query  490  CSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAVCTGKREKCVIGKENNFK  311
            CS HNNH++G MNFMHRDEE++YFPSRYDPVRHAE+YPTP AVC+GKRE+CVI KENNFK
Sbjct  327  CSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFK  386

Query  310  QPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWSQADKSLGQKIASRLNMR  131
            +PGERYRSF+P+R ERFI RW+DALSDPRIT+EIRSIWISYWSQADKSLGQK+ASRLN+R
Sbjct  387  EPGERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKLASRLNVR  446

Query  130  PNM  122
            PN+
Sbjct  447  PNI  449



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   342 bits (877),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+N+DNFF ENEQLAF P+ VVPGIY+S+DKLLQ RIF+YSDT 
Sbjct  293  WPEDILPLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTH  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            RYRLGPNYLQLP NAPKC+ HNNH+DG MNFMHRDEEI+YFPS++DPVRHAERYP P+ +
Sbjct  353  RYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TGKRE+ +I KENNFKQ GERYRS++PDRQERFI RW+ ALS+PR+T+E RSIWISYW+
Sbjct  413  VTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKS+GQK+AS L+ RP+M
Sbjct  473  QADKSIGQKLASSLSARPSM  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   343 bits (879),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PL PVGRLVLN+N+DNFF ENE LAF PS++VPGIY+S+DK+LQTRIF+Y+DTQ
Sbjct  314  WPEDILPLMPVGRLVLNRNVDNFFAENEMLAFSPSMIVPGIYFSNDKMLQTRIFAYADTQ  373

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+R+GPNYLQLP NAPKC  HNNH+DG+MNFMHRDEE++YFPSRYDP RHAE++P P  V
Sbjct  374  RHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVV  433

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G+R K VI KENNFKQPG+RYRS++PDRQERFI RW+DALSDPR+T EIRSIW+SYW+
Sbjct  434  LSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSYWT  493

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  494  QADKSLGQKLASRLNVRPAM  513



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFF ENEQLAFCP+++VPG++YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDILPLQPVGRLVLNRNIDNFFAENEQLAFCPALIVPGVHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPK   HNNH++G MNFMHRDEE++YFPSRYDP RHAER+P P  V
Sbjct  353  RHRLGPNYLQLPVNAPKNGHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERHPIPPVV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +GKR++  I KENNFK+PG R+RS++ DRQERFI RWVDALSDPR+T+EIR IWISYW+
Sbjct  413  LSGKRDRICIEKENNFKEPGVRFRSWATDRQERFIRRWVDALSDPRLTHEIRGIWISYWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQK+ASRLN+RP M
Sbjct  473  QADKSLGQKLASRLNVRPTM  492



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   342 bits (876),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR++LNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMILNKNIDNFFAENEQIAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH++G MNF+HRDEE++YFPSR+DP RHA++YP P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDALSD R+T+EI+ IWISYWS
Sbjct  413  LTGCREKCIIEKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ SRL  +PNM
Sbjct  473  QCDTSLGQKLGSRLKAKPNM  492



>gb|AIU99483.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQ+AFCP+I+VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQVAFCPAIIVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP +APKC+ HNNH++G MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVDAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P  Q+RFI RWVDALSDPR+T+E  +IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPAGQDRFIQRWVDALSDPRVTHEHHTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQ++ASRLN++PNM
Sbjct  473  QCDASLGQELASRLNLKPNM  492



>ref|NP_001105415.1| catalase isozyme 1 [Zea mays]
 emb|CAA31056.1| unnamed protein product [Zea mays]
Length=492

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKN+DNFF ENEQ+AFCP+I VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNVDNFFAENEQIAFCPAISVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNFMHRDEE++YFPSR+DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             TG REKC+I KENNFKQ GERYRSF P RQ+RFI RWVDAL+DPR+T+E R+IWISYWS
Sbjct  413  LTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D +LGQK+ SRLN++P+M
Sbjct  473  QCDAALGQKLPSRLNLKPSM  492



>sp|P55313.1|CATA2_WHEAT RecName: Full=Catalase [Triticum aestivum]
 emb|CAA64077.1| catalase [Triticum aestivum]
Length=492

 Score =   339 bits (870),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGR+VLNKNIDNFF ENEQLAFCP++ VPGI+YSDDKLLQTRIFSY+DTQ
Sbjct  293  WPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAVTVPGIHYSDDKLLQTRIFSYADTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC+ HNNH+DG MNF+HRDEE++YFPSR DP RHAE+ P P  V
Sbjct  353  RHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRVDPTRHAEKDPMPPRV  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
             +G REKC+I KENNFKQ GERYRSF P RQ+RF+ RWVDAL+D R+T+EI+SIW+SYWS
Sbjct  413  LSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            Q D SLGQK+ASRL ++PNM
Sbjct  473  QCDASLGQKLASRLKIKPNM  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLN+NIDNFFNENEQLAF P +VVPGIYYSDDK+LQ RIF+Y DTQ
Sbjct  293  WPEDIIPLQPVGRLVLNRNIDNFFNENEQLAFNPGLVVPGIYYSDDKMLQCRIFAYGDTQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYL LP NAPKC  HNNHYDG MNFMHRDEE+DYFPS++  V +AE++P P+ +
Sbjct  353  RHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPSRI  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C+GKREK  I KENNFK PG+RYRS++PDRQERFI R VD LSDPR+T+E+RSIW+SYWS
Sbjct  413  CSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVSYWS  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            QADKSLGQKIASRLN+RPN+
Sbjct  473  QADKSLGQKIASRLNVRPNI  492



>emb|CDY31490.1| BnaC05g15990D [Brassica napus]
Length=492

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+YP     
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQNPIA  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSIWIS W+
Sbjct  413  CAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWISNWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            +AD+SLGQK+A+RLN+ PN 
Sbjct  473  KADESLGQKLATRLNVSPNF  492



>emb|CDY29518.1| BnaA06g14520D [Brassica napus]
Length=492

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+YP     
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQNPIA  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSIWIS W+
Sbjct  413  CAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWISNWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            +AD+SLGQK+A+RLN+ PN 
Sbjct  473  KADESLGQKLATRLNVSPNF  492



>ref|XP_009149540.1| PREDICTED: catalase-1 [Brassica rapa]
 ref|XP_009149541.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  721  WPEDLVPLQPVGRLVLNKNIDNFFNENEQLAFCPSIVVPGIYYSDDKLLQTRIFSYSDTQ  542
            WPED++PLQPVGRLVLNKNIDNFFNENEQLAFCP+IVVPG +YSDDKLLQ+RIFSY+D+Q
Sbjct  293  WPEDILPLQPVGRLVLNKNIDNFFNENEQLAFCPAIVVPGFHYSDDKLLQSRIFSYADSQ  352

Query  541  RYRLGPNYLQLPANAPKCSMHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAERYPTPAAV  362
            R+RLGPNYLQLP NAPKC+ HNNH++G MNFMHRDEE++YFPSR +PVRHAE+YP     
Sbjct  353  RHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRLNPVRHAEKYPQNPIA  412

Query  361  CTGKREKCVIGKENNFKQPGERYRSFSPDRQERFICRWVDALSDPRITYEIRSIWISYWS  182
            C G REKC+I KENNFKQPGERYRS+  DRQERF+ R+VDAL++PR+T+EIRSIWIS W+
Sbjct  413  CAGNREKCMIEKENNFKQPGERYRSWDADRQERFVKRFVDALAEPRVTHEIRSIWISNWT  472

Query  181  QADKSLGQKIASRLNMRPNM  122
            +AD+SLGQK+A+RLN+ PN 
Sbjct  473  KADESLGQKLATRLNVSPNF  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440